data_2MPE # _entry.id 2MPE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MPE pdb_00002mpe 10.2210/pdb2mpe/pdb RCSB RCSB103891 ? ? BMRB 19042 ? ? WWPDB D_1000103891 ? ? # _pdbx_database_related.db_id 19042 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MPE _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-05-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gaudesi, D.' 1 'Musco, G.' 2 'Quilici, G.' 3 # _citation.id primary _citation.title 'Structure-Based Design of a B Cell Antigen from B. pseudomallei.' _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_volume 10 _citation.page_first 803 _citation.page_last 812 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1554-8929 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25495888 _citation.pdbx_database_id_DOI 10.1021/cb500831y # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gaudesi, D.' 1 ? primary 'Peri, C.' 2 ? primary 'Quilici, G.' 3 ? primary 'Gori, A.' 4 ? primary 'Ferrer-Navarro, M.' 5 ? primary 'Conchillo-Sole, O.' 6 ? primary 'Thomas, R.' 7 ? primary 'Nithichanon, A.' 8 ? primary 'Lertmemongkolchai, G.' 9 ? primary 'Titball, R.' 10 ? primary 'Daura, X.' 11 ? primary 'Colombo, G.' 12 ? primary 'Musco, G.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description BPSL1050 _entity.formula_weight 14261.010 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGMSPDTARRFDTEFAPRIARAIADLLNHRAHTDVVGYGGHGHPTQVRIVAPHAEHVRGYAHPLNLALTWNTDEIERL MEADGAARFERYLAALPRKLAAWENARGVDFGSRTQADALVLLGGLDFEA ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGMSPDTARRFDTEFAPRIARAIADLLNHRAHTDVVGYGGHGHPTQVRIVAPHAEHVRGYAHPLNLALTWNTDEIERL MEADGAARFERYLAALPRKLAAWENARGVDFGSRTQADALVLLGGLDFEA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 MET n 1 6 SER n 1 7 PRO n 1 8 ASP n 1 9 THR n 1 10 ALA n 1 11 ARG n 1 12 ARG n 1 13 PHE n 1 14 ASP n 1 15 THR n 1 16 GLU n 1 17 PHE n 1 18 ALA n 1 19 PRO n 1 20 ARG n 1 21 ILE n 1 22 ALA n 1 23 ARG n 1 24 ALA n 1 25 ILE n 1 26 ALA n 1 27 ASP n 1 28 LEU n 1 29 LEU n 1 30 ASN n 1 31 HIS n 1 32 ARG n 1 33 ALA n 1 34 HIS n 1 35 THR n 1 36 ASP n 1 37 VAL n 1 38 VAL n 1 39 GLY n 1 40 TYR n 1 41 GLY n 1 42 GLY n 1 43 HIS n 1 44 GLY n 1 45 HIS n 1 46 PRO n 1 47 THR n 1 48 GLN n 1 49 VAL n 1 50 ARG n 1 51 ILE n 1 52 VAL n 1 53 ALA n 1 54 PRO n 1 55 HIS n 1 56 ALA n 1 57 GLU n 1 58 HIS n 1 59 VAL n 1 60 ARG n 1 61 GLY n 1 62 TYR n 1 63 ALA n 1 64 HIS n 1 65 PRO n 1 66 LEU n 1 67 ASN n 1 68 LEU n 1 69 ALA n 1 70 LEU n 1 71 THR n 1 72 TRP n 1 73 ASN n 1 74 THR n 1 75 ASP n 1 76 GLU n 1 77 ILE n 1 78 GLU n 1 79 ARG n 1 80 LEU n 1 81 MET n 1 82 GLU n 1 83 ALA n 1 84 ASP n 1 85 GLY n 1 86 ALA n 1 87 ALA n 1 88 ARG n 1 89 PHE n 1 90 GLU n 1 91 ARG n 1 92 TYR n 1 93 LEU n 1 94 ALA n 1 95 ALA n 1 96 LEU n 1 97 PRO n 1 98 ARG n 1 99 LYS n 1 100 LEU n 1 101 ALA n 1 102 ALA n 1 103 TRP n 1 104 GLU n 1 105 ASN n 1 106 ALA n 1 107 ARG n 1 108 GLY n 1 109 VAL n 1 110 ASP n 1 111 PHE n 1 112 GLY n 1 113 SER n 1 114 ARG n 1 115 THR n 1 116 GLN n 1 117 ALA n 1 118 ASP n 1 119 ALA n 1 120 LEU n 1 121 VAL n 1 122 LEU n 1 123 LEU n 1 124 GLY n 1 125 GLY n 1 126 LEU n 1 127 ASP n 1 128 PHE n 1 129 GLU n 1 130 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BPSL1050 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K96243 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia pseudomallei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272560 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pETM11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q63W39_BURPS _struct_ref.pdbx_db_accession Q63W39 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSPDTARRFDTEFAPRIARAIADLLNHRAHTDVVGYGGHGHPTQVRIVAPHAEHVRGYAHPLNLALTWNTDEIERLMEAD GAARFERYLAALPRKLAAWENARGVDFGSRTQADALVLLGGLDFEA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MPE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q63W39 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 126 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MPE GLY A 1 ? UNP Q63W39 ? ? 'expression tag' 1 1 1 2MPE ALA A 2 ? UNP Q63W39 ? ? 'expression tag' 2 2 1 2MPE MET A 3 ? UNP Q63W39 ? ? 'expression tag' 3 3 1 2MPE GLY A 4 ? UNP Q63W39 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 2 2 2 '2D 1H-1H NOESY' 3 3 3 '3D 1H-15N NOESY' 4 4 4 '3D 1H-13C NOESY' 3 5 3 'HN-N Residual dipolar coupling' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 0.15 6.8 ambient ? 298 K 2 0.15 6.8 ambient ? 298 K 3 0.15 6.8 ambient ? 298 K 4 0.15 6.8 ambient ? 298 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.6 mM BPSL1050, 20 mM potassium phosphate, 150 mM sodium chloride, 2 mM DTT, 150 mM [U-100% 2H] DSS, 100% D2O' 1 '100% D2O' '0.7 mM BPSL1050, 20 mM potassium phosphate, 150 mM sodium chloride, 2 mM DTT, 150 mM [U-100% 2H] DSS, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '0.7 mM [U-99% 15N] BPSL1050, 20 mM potassium phosphate, 150 mM sodium chloride, 2 mM DTT, 150 mM [U-100% 2H] DSS, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' ;0.7 mM [U-99% 13C; U-99% 15N] BPSL1050, 20 mM potassium phosphate, 150 mM sodium chloride, 2 mM DTT, 150 mM [U-100% 2H] DSS, 100% D2O ; 4 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MPE _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MPE _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MPE _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA ? 1 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MPE _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MPE _struct.title 'Solution NMR structure for B. pseudomallei BPSL1050' _struct.pdbx_model_details 'minimized average structure, model5' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2MPE _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'MELIOIDOSIS, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? PHE A 17 ? SER A 6 PHE A 17 1 ? 12 HELX_P HELX_P2 2 PHE A 17 ? LEU A 29 ? PHE A 17 LEU A 29 1 ? 13 HELX_P HELX_P3 3 ASN A 73 ? LEU A 80 ? ASN A 73 LEU A 80 1 ? 8 HELX_P HELX_P4 4 GLU A 82 ? ALA A 95 ? GLU A 82 ALA A 95 1 ? 14 HELX_P HELX_P5 5 ALA A 95 ? GLY A 108 ? ALA A 95 GLY A 108 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 34 ? VAL A 38 ? HIS A 34 VAL A 38 A 2 GLN A 48 ? ALA A 53 ? GLN A 48 ALA A 53 A 3 LEU A 66 ? TRP A 72 ? LEU A 66 TRP A 72 A 4 VAL A 121 ? LEU A 126 ? VAL A 121 LEU A 126 B 1 VAL A 109 ? ASP A 110 ? VAL A 109 ASP A 110 B 2 THR A 115 ? GLN A 116 ? THR A 115 GLN A 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 38 ? N VAL A 38 O GLN A 48 ? O GLN A 48 A 2 3 N VAL A 49 ? N VAL A 49 O LEU A 70 ? O LEU A 70 A 3 4 N ALA A 69 ? N ALA A 69 O LEU A 123 ? O LEU A 123 B 1 2 N ASP A 110 ? N ASP A 110 O THR A 115 ? O THR A 115 # _atom_sites.entry_id 2MPE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 TRP 103 103 103 TRP TRP A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 ALA 130 130 130 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-03-11 2 'Structure model' 1 1 2015-04-08 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id BPSL1050-1 0.6 ? mM ? 1 'potassium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 150 ? mM ? 1 DTT-4 2 ? mM ? 1 DSS-5 150 ? mM '[U-100% 2H]' 1 BPSL1050-6 0.7 ? mM ? 2 'potassium phosphate-7' 20 ? mM ? 2 'sodium chloride-8' 150 ? mM ? 2 DTT-9 2 ? mM ? 2 DSS-10 150 ? mM '[U-100% 2H]' 2 BPSL1050-11 0.7 ? mM '[U-99% 15N]' 3 'potassium phosphate-12' 20 ? mM ? 3 'sodium chloride-13' 150 ? mM ? 3 DTT-14 2 ? mM ? 3 DSS-15 150 ? mM '[U-100% 2H]' 3 BPSL1050-16 0.7 ? mM '[U-99% 13C; U-99% 15N]' 4 'potassium phosphate-17' 20 ? mM ? 4 'sodium chloride-18' 150 ? mM ? 4 DTT-19 2 ? mM ? 4 DSS-20 150 ? mM '[U-100% 2H]' 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 14 _pdbx_validate_close_contact.auth_atom_id_1 HH _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 40 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HD1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HIS _pdbx_validate_close_contact.auth_seq_id_2 43 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.04 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 55 ? ? 59.92 74.23 2 1 ALA A 63 ? ? -92.66 33.69 3 2 ALA A 63 ? ? -84.04 39.76 4 2 PHE A 128 ? ? -99.70 40.17 5 3 HIS A 31 ? ? 59.08 14.65 6 3 HIS A 58 ? ? -119.51 66.47 7 3 ALA A 63 ? ? -89.42 36.43 8 4 MET A 3 ? ? -99.69 43.98 9 4 HIS A 43 ? ? -105.16 72.42 10 4 GLU A 57 ? ? 70.02 141.32 11 5 MET A 3 ? ? -111.11 -84.09 12 5 SER A 6 ? ? 58.29 71.26 13 6 ALA A 63 ? ? -84.35 49.33 14 6 PHE A 128 ? ? -94.01 41.89 15 7 MET A 3 ? ? 69.77 -53.92 16 8 PRO A 54 ? ? -59.32 99.49 17 8 ARG A 60 ? ? -176.92 -58.18 18 8 ALA A 63 ? ? -87.75 37.29 19 8 LEU A 120 ? ? -170.40 125.25 20 8 PHE A 128 ? ? -98.85 46.59 21 9 ALA A 56 ? ? 59.57 -80.52 22 9 ALA A 63 ? ? -83.95 45.52 23 9 PHE A 128 ? ? -97.45 31.11 24 10 HIS A 58 ? ? -103.18 75.72 25 10 ALA A 63 ? ? -83.79 45.37 26 11 SER A 6 ? ? 60.35 77.30 27 11 HIS A 58 ? ? -78.68 29.43 28 11 ARG A 60 ? ? -91.68 47.95 29 11 ALA A 63 ? ? -83.75 47.06 30 12 MET A 5 ? ? -143.45 -61.45 31 12 HIS A 43 ? ? -177.43 -36.11 32 12 VAL A 59 ? ? 74.97 -58.18 33 12 ALA A 63 ? ? -84.94 35.03 34 13 HIS A 43 ? ? -148.45 -29.81 35 13 HIS A 45 ? ? 63.94 89.98 36 14 PRO A 54 ? ? -80.45 48.18 37 14 HIS A 58 ? ? -151.03 51.04 38 14 PHE A 128 ? ? -104.46 41.39 39 15 SER A 6 ? ? -151.79 -57.17 40 15 ALA A 63 ? ? -97.49 48.76 41 15 PHE A 128 ? ? -96.89 39.32 #