data_2MRM # _entry.id 2MRM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MRM pdb_00002mrm 10.2210/pdb2mrm/pdb RCSB RCSB103969 ? ? BMRB 25085 ? 10.13018/BMR25085 WWPDB D_1000103969 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-08 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MRM _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2014-07-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 25085 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, W.' 1 'Zhou, P.' 2 'Tian, C.' 3 'Wu, F.' 4 # _citation.id primary _citation.title 'Fast conformational exchange between the sulfur-free and persulfide-bound rhodanese domain of E. coli YgaP' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 452 _citation.page_first 817 _citation.page_last 821 _citation.year 2014 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25204500 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2014.09.002 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, W.' 1 ? primary 'Zhou, P.' 2 ? primary 'He, Y.' 3 ? primary 'Yu, L.' 4 ? primary 'Xiong, Y.' 5 ? primary 'Tian, C.' 6 ? primary 'Wu, F.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Membrane protein' _entity.formula_weight 12620.390 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 1-107' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name YgaP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHMALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNN ADKLAAIAAPAEIFLLEDGIDGWKRAGLPVAVNK ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHMALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNN ADKLAAIAAPAEIFLLEDGIDGWKRAGLPVAVNK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 ALA n 1 10 LEU n 1 11 THR n 1 12 THR n 1 13 ILE n 1 14 SER n 1 15 PRO n 1 16 HIS n 1 17 ASP n 1 18 ALA n 1 19 GLN n 1 20 GLU n 1 21 LEU n 1 22 ILE n 1 23 ALA n 1 24 ARG n 1 25 GLY n 1 26 ALA n 1 27 LYS n 1 28 LEU n 1 29 ILE n 1 30 ASP n 1 31 ILE n 1 32 ARG n 1 33 ASP n 1 34 ALA n 1 35 ASP n 1 36 GLU n 1 37 TYR n 1 38 LEU n 1 39 ARG n 1 40 GLU n 1 41 HIS n 1 42 ILE n 1 43 PRO n 1 44 GLU n 1 45 ALA n 1 46 ASP n 1 47 LEU n 1 48 ALA n 1 49 PRO n 1 50 LEU n 1 51 SER n 1 52 VAL n 1 53 LEU n 1 54 GLU n 1 55 GLN n 1 56 SER n 1 57 GLY n 1 58 LEU n 1 59 PRO n 1 60 ALA n 1 61 LYS n 1 62 LEU n 1 63 ARG n 1 64 HIS n 1 65 GLU n 1 66 GLN n 1 67 ILE n 1 68 ILE n 1 69 PHE n 1 70 HIS n 1 71 CYS n 1 72 GLN n 1 73 ALA n 1 74 GLY n 1 75 LYS n 1 76 ARG n 1 77 THR n 1 78 SER n 1 79 ASN n 1 80 ASN n 1 81 ALA n 1 82 ASP n 1 83 LYS n 1 84 LEU n 1 85 ALA n 1 86 ALA n 1 87 ILE n 1 88 ALA n 1 89 ALA n 1 90 PRO n 1 91 ALA n 1 92 GLU n 1 93 ILE n 1 94 PHE n 1 95 LEU n 1 96 LEU n 1 97 GLU n 1 98 ASP n 1 99 GLY n 1 100 ILE n 1 101 ASP n 1 102 GLY n 1 103 TRP n 1 104 LYS n 1 105 ARG n 1 106 ALA n 1 107 GLY n 1 108 LEU n 1 109 PRO n 1 110 VAL n 1 111 ALA n 1 112 VAL n 1 113 ASN n 1 114 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BU34_15760, CF57_07085, CF61_07785' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-Gold(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector p28 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -6 ? ? ? A . n A 1 2 HIS 2 -5 ? ? ? A . n A 1 3 HIS 3 -4 ? ? ? A . n A 1 4 HIS 4 -3 ? ? ? A . n A 1 5 HIS 5 -2 ? ? ? A . n A 1 6 HIS 6 -1 ? ? ? A . n A 1 7 HIS 7 0 ? ? ? A . n A 1 8 MET 8 1 1 MET MET A . n A 1 9 ALA 9 2 2 ALA ALA A . n A 1 10 LEU 10 3 3 LEU LEU A . n A 1 11 THR 11 4 4 THR THR A . n A 1 12 THR 12 5 5 THR THR A . n A 1 13 ILE 13 6 6 ILE ILE A . n A 1 14 SER 14 7 7 SER SER A . n A 1 15 PRO 15 8 8 PRO PRO A . n A 1 16 HIS 16 9 9 HIS HIS A . n A 1 17 ASP 17 10 10 ASP ASP A . n A 1 18 ALA 18 11 11 ALA ALA A . n A 1 19 GLN 19 12 12 GLN GLN A . n A 1 20 GLU 20 13 13 GLU GLU A . n A 1 21 LEU 21 14 14 LEU LEU A . n A 1 22 ILE 22 15 15 ILE ILE A . n A 1 23 ALA 23 16 16 ALA ALA A . n A 1 24 ARG 24 17 17 ARG ARG A . n A 1 25 GLY 25 18 18 GLY GLY A . n A 1 26 ALA 26 19 19 ALA ALA A . n A 1 27 LYS 27 20 20 LYS LYS A . n A 1 28 LEU 28 21 21 LEU LEU A . n A 1 29 ILE 29 22 22 ILE ILE A . n A 1 30 ASP 30 23 23 ASP ASP A . n A 1 31 ILE 31 24 24 ILE ILE A . n A 1 32 ARG 32 25 25 ARG ARG A . n A 1 33 ASP 33 26 26 ASP ASP A . n A 1 34 ALA 34 27 27 ALA ALA A . n A 1 35 ASP 35 28 28 ASP ASP A . n A 1 36 GLU 36 29 29 GLU GLU A . n A 1 37 TYR 37 30 30 TYR TYR A . n A 1 38 LEU 38 31 31 LEU LEU A . n A 1 39 ARG 39 32 32 ARG ARG A . n A 1 40 GLU 40 33 33 GLU GLU A . n A 1 41 HIS 41 34 34 HIS HIS A . n A 1 42 ILE 42 35 35 ILE ILE A . n A 1 43 PRO 43 36 36 PRO PRO A . n A 1 44 GLU 44 37 37 GLU GLU A . n A 1 45 ALA 45 38 38 ALA ALA A . n A 1 46 ASP 46 39 39 ASP ASP A . n A 1 47 LEU 47 40 40 LEU LEU A . n A 1 48 ALA 48 41 41 ALA ALA A . n A 1 49 PRO 49 42 42 PRO PRO A . n A 1 50 LEU 50 43 43 LEU LEU A . n A 1 51 SER 51 44 44 SER SER A . n A 1 52 VAL 52 45 45 VAL VAL A . n A 1 53 LEU 53 46 46 LEU LEU A . n A 1 54 GLU 54 47 47 GLU GLU A . n A 1 55 GLN 55 48 48 GLN GLN A . n A 1 56 SER 56 49 49 SER SER A . n A 1 57 GLY 57 50 50 GLY GLY A . n A 1 58 LEU 58 51 51 LEU LEU A . n A 1 59 PRO 59 52 52 PRO PRO A . n A 1 60 ALA 60 53 53 ALA ALA A . n A 1 61 LYS 61 54 54 LYS LYS A . n A 1 62 LEU 62 55 55 LEU LEU A . n A 1 63 ARG 63 56 56 ARG ARG A . n A 1 64 HIS 64 57 57 HIS HIS A . n A 1 65 GLU 65 58 58 GLU GLU A . n A 1 66 GLN 66 59 59 GLN GLN A . n A 1 67 ILE 67 60 60 ILE ILE A . n A 1 68 ILE 68 61 61 ILE ILE A . n A 1 69 PHE 69 62 62 PHE PHE A . n A 1 70 HIS 70 63 63 HIS HIS A . n A 1 71 CYS 71 64 64 CYS CYS A . n A 1 72 GLN 72 65 65 GLN GLN A . n A 1 73 ALA 73 66 66 ALA ALA A . n A 1 74 GLY 74 67 67 GLY GLY A . n A 1 75 LYS 75 68 68 LYS LYS A . n A 1 76 ARG 76 69 69 ARG ARG A . n A 1 77 THR 77 70 70 THR THR A . n A 1 78 SER 78 71 71 SER SER A . n A 1 79 ASN 79 72 72 ASN ASN A . n A 1 80 ASN 80 73 73 ASN ASN A . n A 1 81 ALA 81 74 74 ALA ALA A . n A 1 82 ASP 82 75 75 ASP ASP A . n A 1 83 LYS 83 76 76 LYS LYS A . n A 1 84 LEU 84 77 77 LEU LEU A . n A 1 85 ALA 85 78 78 ALA ALA A . n A 1 86 ALA 86 79 79 ALA ALA A . n A 1 87 ILE 87 80 80 ILE ILE A . n A 1 88 ALA 88 81 81 ALA ALA A . n A 1 89 ALA 89 82 82 ALA ALA A . n A 1 90 PRO 90 83 83 PRO PRO A . n A 1 91 ALA 91 84 84 ALA ALA A . n A 1 92 GLU 92 85 85 GLU GLU A . n A 1 93 ILE 93 86 86 ILE ILE A . n A 1 94 PHE 94 87 87 PHE PHE A . n A 1 95 LEU 95 88 88 LEU LEU A . n A 1 96 LEU 96 89 89 LEU LEU A . n A 1 97 GLU 97 90 90 GLU GLU A . n A 1 98 ASP 98 91 91 ASP ASP A . n A 1 99 GLY 99 92 92 GLY GLY A . n A 1 100 ILE 100 93 93 ILE ILE A . n A 1 101 ASP 101 94 94 ASP ASP A . n A 1 102 GLY 102 95 95 GLY GLY A . n A 1 103 TRP 103 96 96 TRP TRP A . n A 1 104 LYS 104 97 97 LYS LYS A . n A 1 105 ARG 105 98 98 ARG ARG A . n A 1 106 ALA 106 99 99 ALA ALA A . n A 1 107 GLY 107 100 100 GLY GLY A . n A 1 108 LEU 108 101 101 LEU LEU A . n A 1 109 PRO 109 102 102 PRO PRO A . n A 1 110 VAL 110 103 103 VAL VAL A . n A 1 111 ALA 111 104 104 ALA ALA A . n A 1 112 VAL 112 105 105 VAL VAL A . n A 1 113 ASN 113 106 106 ASN ASN A . n A 1 114 LYS 114 107 107 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MRM _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MRM _struct.title 'Solution structure of the rhodanese domain of YgaP from E. coli' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MRM _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'rhodanese domain, YgaP, E. coli, Integral Membrane Protein, Membrane Protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code W8T678_ECOLX _struct_ref.pdbx_db_accession W8T678 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAI AAPAEIFLLEDGIDGWKRAGLPVAVNK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MRM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession W8T678 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MRM MET A 1 ? UNP W8T678 ? ? 'expression tag' -6 1 1 2MRM HIS A 2 ? UNP W8T678 ? ? 'expression tag' -5 2 1 2MRM HIS A 3 ? UNP W8T678 ? ? 'expression tag' -4 3 1 2MRM HIS A 4 ? UNP W8T678 ? ? 'expression tag' -3 4 1 2MRM HIS A 5 ? UNP W8T678 ? ? 'expression tag' -2 5 1 2MRM HIS A 6 ? UNP W8T678 ? ? 'expression tag' -1 6 1 2MRM HIS A 7 ? UNP W8T678 ? ? 'expression tag' 0 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 14 ? ALA A 23 ? SER A 7 ALA A 16 1 ? 10 HELX_P HELX_P2 2 ASP A 33 ? GLU A 40 ? ASP A 26 GLU A 33 1 ? 8 HELX_P HELX_P3 3 PRO A 49 ? SER A 56 ? PRO A 42 SER A 49 1 ? 8 HELX_P HELX_P4 4 PRO A 59 ? HIS A 64 ? PRO A 52 HIS A 57 5 ? 6 HELX_P HELX_P5 5 ARG A 76 ? ALA A 88 ? ARG A 69 ALA A 81 1 ? 13 HELX_P HELX_P6 6 GLY A 99 ? ALA A 106 ? GLY A 92 ALA A 99 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 11 ? ILE A 13 ? THR A 4 ILE A 6 A 2 GLU A 92 ? LEU A 96 ? GLU A 85 LEU A 89 A 3 GLN A 66 ? HIS A 70 ? GLN A 59 HIS A 63 A 4 LYS A 27 ? ASP A 30 ? LYS A 20 ASP A 23 A 5 ASP A 46 ? LEU A 47 ? ASP A 39 LEU A 40 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 13 ? N ILE A 6 O LEU A 95 ? O LEU A 88 A 2 3 O PHE A 94 ? O PHE A 87 N ILE A 67 ? N ILE A 60 A 3 4 O ILE A 68 ? O ILE A 61 N LYS A 27 ? N LYS A 20 A 4 5 N LEU A 28 ? N LEU A 21 O ASP A 46 ? O ASP A 39 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ3 A LYS 20 ? ? HE A ARG 56 ? ? 1.21 2 1 HD1 A HIS 34 ? ? H A ILE 35 ? ? 1.27 3 1 O A PRO 42 ? ? H A VAL 45 ? ? 1.53 4 1 O A ALA 27 ? ? H A LEU 31 ? ? 1.55 5 1 H A HIS 34 ? ? O A ALA 104 ? ? 1.56 6 1 O A THR 70 ? ? H A ALA 74 ? ? 1.57 7 1 O A LEU 77 ? ? H A ALA 81 ? ? 1.57 8 1 O A ILE 35 ? ? H A GLU 37 ? ? 1.57 9 1 O A LEU 14 ? ? H A ARG 17 ? ? 1.57 10 1 O A SER 7 ? ? H A ASP 10 ? ? 1.57 11 1 O A LEU 21 ? ? H A ASP 39 ? ? 1.57 12 1 O A LEU 51 ? ? H A ALA 53 ? ? 1.58 13 1 OD2 A ASP 23 ? ? HH21 A ARG 25 ? ? 1.59 14 2 O A ALA 27 ? ? H A LEU 31 ? ? 1.51 15 2 O A ILE 35 ? ? H A GLU 37 ? ? 1.54 16 2 H A HIS 34 ? ? O A ALA 104 ? ? 1.54 17 2 O A PRO 52 ? ? H A LEU 55 ? ? 1.55 18 2 O A ASP 26 ? ? H A GLU 29 ? ? 1.56 19 2 O A GLU 90 ? ? H A GLY 92 ? ? 1.56 20 2 O A PRO 42 ? ? H A VAL 45 ? ? 1.57 21 2 O A ASN 73 ? ? H A LYS 76 ? ? 1.58 22 2 O A GLY 67 ? ? H A THR 70 ? ? 1.59 23 3 O A ALA 27 ? ? H A LEU 31 ? ? 1.50 24 3 O A ILE 35 ? ? H A GLU 37 ? ? 1.54 25 3 O A PRO 42 ? ? H A VAL 45 ? ? 1.56 26 3 O A ALA 82 ? ? H A ALA 84 ? ? 1.57 27 3 HD1 A HIS 34 ? ? O A ALA 104 ? ? 1.58 28 3 O A THR 70 ? ? H A ALA 74 ? ? 1.58 29 3 O A LEU 14 ? ? H A ARG 17 ? ? 1.59 30 3 O A SER 7 ? ? H A ASP 10 ? ? 1.60 31 4 O A SER 7 ? ? H A ASP 10 ? ? 1.54 32 4 H A HIS 34 ? ? O A ALA 104 ? ? 1.54 33 4 O A ALA 27 ? ? H A LEU 31 ? ? 1.56 34 4 H A ILE 6 ? ? O A LEU 88 ? ? 1.56 35 4 O A ASP 26 ? ? H A GLU 29 ? ? 1.59 36 4 O A LEU 14 ? ? H A ARG 17 ? ? 1.59 37 5 O A CYS 64 ? ? H A GLY 67 ? ? 1.53 38 5 O A ALA 82 ? ? H A ALA 84 ? ? 1.55 39 5 O A PRO 42 ? ? H A VAL 45 ? ? 1.56 40 5 H A HIS 34 ? ? O A ALA 104 ? ? 1.56 41 5 OD1 A ASP 23 ? ? HE A ARG 25 ? ? 1.57 42 5 O A PRO 52 ? ? H A LEU 55 ? ? 1.57 43 5 O A SER 7 ? ? H A ASP 10 ? ? 1.60 44 6 O A ASP 26 ? ? H A GLU 29 ? ? 1.53 45 6 O A ALA 82 ? ? H A ALA 84 ? ? 1.54 46 6 O A SER 7 ? ? H A ASP 10 ? ? 1.57 47 6 H A ILE 6 ? ? O A LEU 88 ? ? 1.57 48 6 O A ARG 69 ? ? H A ASN 73 ? ? 1.57 49 6 O A ALA 27 ? ? H A LEU 31 ? ? 1.58 50 6 O A LEU 14 ? ? H A ARG 17 ? ? 1.58 51 6 O A ALA 53 ? ? H A ARG 56 ? ? 1.59 52 6 O A THR 70 ? ? H A ALA 74 ? ? 1.60 53 7 O A ALA 82 ? ? H A ALA 84 ? ? 1.55 54 7 O A ALA 27 ? ? H A LEU 31 ? ? 1.55 55 7 H A HIS 34 ? ? O A ALA 104 ? ? 1.56 56 7 O A PRO 42 ? ? H A VAL 45 ? ? 1.57 57 7 H A ILE 6 ? ? O A LEU 88 ? ? 1.57 58 7 O A PRO 52 ? ? H A LEU 55 ? ? 1.57 59 7 O A ASP 26 ? ? H A GLU 29 ? ? 1.58 60 7 O A LEU 14 ? ? H A ARG 17 ? ? 1.59 61 8 HD1 A HIS 57 ? ? H A GLN 59 ? ? 1.31 62 8 O A ARG 69 ? ? H A ASN 73 ? ? 1.54 63 8 O A LEU 14 ? ? H A ARG 17 ? ? 1.55 64 8 O A ALA 82 ? ? H A ALA 84 ? ? 1.56 65 8 O A ASP 26 ? ? H A GLU 29 ? ? 1.57 66 8 O A LEU 51 ? ? H A ALA 53 ? ? 1.58 67 8 H A HIS 34 ? ? O A ALA 104 ? ? 1.58 68 9 O A ALA 27 ? ? H A LEU 31 ? ? 1.54 69 9 O A SER 7 ? ? H A ASP 10 ? ? 1.54 70 9 O A THR 70 ? ? H A ALA 74 ? ? 1.55 71 9 O A ASP 26 ? ? H A GLU 29 ? ? 1.56 72 9 O A PRO 52 ? ? H A LEU 55 ? ? 1.56 73 9 O A ILE 35 ? ? H A GLU 37 ? ? 1.56 74 9 O A LEU 14 ? ? H A ARG 17 ? ? 1.56 75 9 O A VAL 45 ? ? H A SER 49 ? ? 1.57 76 9 O A LEU 21 ? ? H A ASP 39 ? ? 1.59 77 9 H A HIS 34 ? ? O A ALA 104 ? ? 1.59 78 10 O A PRO 52 ? ? H A LEU 55 ? ? 1.55 79 10 O A ALA 27 ? ? H A LEU 31 ? ? 1.55 80 10 O A ASP 26 ? ? H A GLU 29 ? ? 1.57 81 10 O A PRO 42 ? ? H A VAL 45 ? ? 1.57 82 10 O A LEU 14 ? ? H A ARG 17 ? ? 1.57 83 10 O A ALA 53 ? ? H A ARG 56 ? ? 1.57 84 10 O A SER 7 ? ? H A ASP 10 ? ? 1.58 85 10 O A ARG 69 ? ? H A ASN 73 ? ? 1.59 86 10 H A HIS 34 ? ? O A ALA 104 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -153.07 35.19 2 1 PRO A 8 ? ? -42.06 -16.98 3 1 ALA A 19 ? ? -31.29 151.48 4 1 ARG A 25 ? ? -154.73 -145.54 5 1 PRO A 36 ? ? -49.37 66.38 6 1 GLU A 37 ? ? -179.46 27.83 7 1 PRO A 52 ? ? -51.87 67.05 8 1 HIS A 57 ? ? 166.17 -167.07 9 1 ALA A 66 ? ? -142.65 54.08 10 1 ALA A 82 ? ? 42.98 -179.47 11 1 PRO A 83 ? ? -62.49 15.75 12 1 ALA A 84 ? ? -53.10 -152.48 13 1 ASP A 91 ? ? 82.22 -50.26 14 2 PRO A 8 ? ? -38.23 -16.82 15 2 ALA A 19 ? ? -27.07 144.33 16 2 ARG A 25 ? ? -160.81 -136.64 17 2 GLU A 33 ? ? -172.83 137.02 18 2 PRO A 36 ? ? -54.33 19.46 19 2 SER A 49 ? ? -82.99 -77.59 20 2 PRO A 52 ? ? -69.33 78.12 21 2 HIS A 57 ? ? -170.14 -169.04 22 2 GLN A 65 ? ? -34.91 -39.89 23 2 ALA A 82 ? ? 52.63 -179.85 24 2 PRO A 83 ? ? -60.54 7.51 25 2 ALA A 84 ? ? -46.48 169.39 26 2 ASP A 91 ? ? 68.35 -47.44 27 2 PRO A 102 ? ? -45.62 152.09 28 3 PRO A 8 ? ? -39.46 -17.71 29 3 ARG A 25 ? ? -173.91 -141.95 30 3 PRO A 36 ? ? -54.44 19.49 31 3 LEU A 43 ? ? -39.79 -29.79 32 3 HIS A 57 ? ? 177.97 -164.06 33 3 GLN A 65 ? ? -28.23 -41.81 34 3 ALA A 66 ? ? -126.27 -60.45 35 3 ALA A 82 ? ? 44.95 -179.27 36 3 PRO A 83 ? ? -60.23 26.40 37 3 ALA A 84 ? ? -69.11 -162.68 38 3 ASP A 91 ? ? 69.34 -40.21 39 3 ALA A 99 ? ? -39.26 -33.89 40 4 LEU A 3 ? ? -38.55 143.11 41 4 PRO A 8 ? ? -40.06 -18.10 42 4 ILE A 24 ? ? -112.89 -73.36 43 4 ARG A 25 ? ? 20.57 -143.34 44 4 PRO A 36 ? ? -76.70 24.07 45 4 GLU A 37 ? ? -146.18 35.57 46 4 ALA A 41 ? ? -160.25 95.57 47 4 SER A 49 ? ? -72.80 -78.28 48 4 PRO A 52 ? ? -58.10 73.66 49 4 HIS A 57 ? ? 169.51 -163.75 50 4 GLN A 65 ? ? -21.66 -56.24 51 4 ALA A 82 ? ? 45.71 179.53 52 4 PRO A 83 ? ? -58.25 9.91 53 4 ALA A 84 ? ? -55.26 -167.22 54 4 ASP A 91 ? ? 77.70 -35.64 55 4 PRO A 102 ? ? -44.87 160.17 56 5 LEU A 3 ? ? -38.08 116.23 57 5 PRO A 8 ? ? -39.64 -26.25 58 5 ALA A 19 ? ? -28.41 137.11 59 5 ARG A 25 ? ? -156.63 -150.00 60 5 GLU A 33 ? ? -172.03 139.50 61 5 GLU A 37 ? ? -158.74 18.99 62 5 SER A 49 ? ? -73.14 -77.03 63 5 PRO A 52 ? ? -58.67 83.87 64 5 HIS A 57 ? ? -179.83 -167.57 65 5 GLN A 65 ? ? -22.86 -59.96 66 5 ALA A 82 ? ? -39.43 170.71 67 5 PRO A 83 ? ? -50.36 65.96 68 5 ALA A 84 ? ? -104.73 -167.92 69 5 ASP A 91 ? ? 77.79 -46.07 70 5 PRO A 102 ? ? -48.37 177.65 71 6 ALA A 2 ? ? -94.81 38.95 72 6 PRO A 8 ? ? -40.74 -19.46 73 6 ILE A 24 ? ? -114.78 -73.65 74 6 ARG A 25 ? ? 16.42 -139.61 75 6 ALA A 27 ? ? -38.32 -23.45 76 6 PRO A 36 ? ? -74.49 24.87 77 6 ALA A 41 ? ? -162.71 96.53 78 6 SER A 49 ? ? -94.95 -71.64 79 6 PRO A 52 ? ? -45.20 -7.80 80 6 LYS A 54 ? ? -57.11 -5.75 81 6 ARG A 56 ? ? -62.64 8.24 82 6 HIS A 57 ? ? -134.88 -145.38 83 6 GLU A 58 ? ? -144.40 -43.89 84 6 GLN A 65 ? ? -26.74 -70.46 85 6 ALA A 82 ? ? 67.91 173.79 86 6 PRO A 83 ? ? -53.57 65.27 87 6 ASP A 91 ? ? 69.52 -34.77 88 6 PRO A 102 ? ? -35.49 146.16 89 7 LEU A 3 ? ? -39.61 120.81 90 7 PRO A 8 ? ? -39.24 -16.89 91 7 ALA A 19 ? ? -57.42 175.28 92 7 ARG A 25 ? ? -169.04 -143.50 93 7 PRO A 36 ? ? -77.68 21.32 94 7 GLU A 37 ? ? -141.96 26.49 95 7 LEU A 43 ? ? -38.26 -34.68 96 7 PRO A 52 ? ? -58.76 21.14 97 7 HIS A 57 ? ? -148.87 -146.08 98 7 GLU A 58 ? ? -150.15 -36.24 99 7 GLN A 65 ? ? -36.03 -33.57 100 7 ALA A 66 ? ? -140.09 -37.42 101 7 ALA A 82 ? ? 75.62 177.02 102 7 PRO A 83 ? ? -54.55 65.30 103 7 ALA A 84 ? ? -128.89 -151.44 104 7 ASP A 91 ? ? 69.19 -12.36 105 8 LEU A 3 ? ? -39.44 99.45 106 8 ARG A 25 ? ? -165.42 -144.45 107 8 PRO A 36 ? ? -74.50 23.79 108 8 GLU A 37 ? ? -146.71 30.60 109 8 PRO A 52 ? ? -58.01 64.16 110 8 HIS A 57 ? ? 179.30 -150.67 111 8 GLU A 58 ? ? -137.38 -41.18 112 8 GLN A 65 ? ? -29.69 -47.49 113 8 ALA A 82 ? ? -44.02 178.93 114 8 PRO A 83 ? ? -57.36 64.09 115 8 ALA A 84 ? ? -104.80 -149.81 116 8 ASP A 91 ? ? 70.22 -27.42 117 8 ALA A 99 ? ? -46.30 -15.21 118 9 PRO A 8 ? ? -40.85 -16.71 119 9 ALA A 19 ? ? -28.71 149.91 120 9 ARG A 25 ? ? -157.27 -146.50 121 9 ALA A 27 ? ? -38.16 -39.85 122 9 PRO A 36 ? ? -54.23 18.17 123 9 SER A 49 ? ? -61.68 -70.17 124 9 PRO A 52 ? ? -64.97 79.23 125 9 HIS A 57 ? ? -177.38 -166.07 126 9 GLN A 65 ? ? -27.40 -54.60 127 9 LYS A 68 ? ? -31.56 -33.60 128 9 ALA A 78 ? ? -39.98 -34.25 129 9 ALA A 82 ? ? 45.44 179.59 130 9 PRO A 83 ? ? -60.12 20.08 131 9 ALA A 84 ? ? -66.11 -157.39 132 9 ASP A 91 ? ? 74.15 -47.84 133 10 ALA A 2 ? ? 174.85 82.11 134 10 PRO A 8 ? ? -41.64 -17.16 135 10 ALA A 19 ? ? -30.96 147.06 136 10 ARG A 25 ? ? -168.32 -149.10 137 10 PRO A 36 ? ? -77.34 23.17 138 10 GLU A 37 ? ? -141.67 34.47 139 10 SER A 49 ? ? -86.26 -72.83 140 10 PRO A 52 ? ? -68.79 62.22 141 10 ALA A 53 ? ? -39.72 -27.64 142 10 HIS A 57 ? ? -179.52 -169.29 143 10 GLN A 65 ? ? -34.15 -36.78 144 10 ALA A 78 ? ? -39.27 -27.35 145 10 ALA A 82 ? ? 44.47 -178.86 146 10 PRO A 83 ? ? -60.45 21.61 147 10 ASP A 91 ? ? 94.11 -26.98 148 10 PRO A 102 ? ? -30.17 118.97 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MRM _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MRM _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '50 mM sodium chloride-1, 20 mM TRIS-2, 0.5 mM [U-100% 13C; U-100% 15N] YgaP-3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '20 mM TRIS-4, 50 mM sodium chloride-5, 0.5 mM [U-100% 13C; U-100% 15N] YgaP-6, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium chloride-1' 50 ? mM ? 1 TRIS-2 20 ? mM ? 1 YgaP-3 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 TRIS-4 20 ? mM ? 2 'sodium chloride-5' 50 ? mM ? 2 YgaP-6 0.5 ? mM '[U-100% 13C; U-100% 15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCACB' 1 4 1 '3D HNCO' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D C(CO)NH' 1 8 1 '3D 1H-15N NOESY' 1 9 2 '3D HCCH-TOCSY' 1 10 2 '3D HCCH-COSY' 1 11 2 '3D 1H-13C NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MRM _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1875 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 345 _pdbx_nmr_constraints.NOE_long_range_total_count 519 _pdbx_nmr_constraints.NOE_medium_range_total_count 459 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 552 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 63 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 63 # _pdbx_nmr_refine.entry_id 2MRM _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe 1 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2 ? Goddard 'peak picking' Sparky 3 ? Goddard 'chemical shift assignment' Sparky 4 ? 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 5 ? 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 6 ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -6 ? A MET 1 2 1 Y 1 A HIS -5 ? A HIS 2 3 1 Y 1 A HIS -4 ? A HIS 3 4 1 Y 1 A HIS -3 ? A HIS 4 5 1 Y 1 A HIS -2 ? A HIS 5 6 1 Y 1 A HIS -1 ? A HIS 6 7 1 Y 1 A HIS 0 ? A HIS 7 8 2 Y 1 A MET -6 ? A MET 1 9 2 Y 1 A HIS -5 ? A HIS 2 10 2 Y 1 A HIS -4 ? A HIS 3 11 2 Y 1 A HIS -3 ? A HIS 4 12 2 Y 1 A HIS -2 ? A HIS 5 13 2 Y 1 A HIS -1 ? A HIS 6 14 2 Y 1 A HIS 0 ? A HIS 7 15 3 Y 1 A MET -6 ? A MET 1 16 3 Y 1 A HIS -5 ? A HIS 2 17 3 Y 1 A HIS -4 ? A HIS 3 18 3 Y 1 A HIS -3 ? A HIS 4 19 3 Y 1 A HIS -2 ? A HIS 5 20 3 Y 1 A HIS -1 ? A HIS 6 21 3 Y 1 A HIS 0 ? A HIS 7 22 4 Y 1 A MET -6 ? A MET 1 23 4 Y 1 A HIS -5 ? A HIS 2 24 4 Y 1 A HIS -4 ? A HIS 3 25 4 Y 1 A HIS -3 ? A HIS 4 26 4 Y 1 A HIS -2 ? A HIS 5 27 4 Y 1 A HIS -1 ? A HIS 6 28 4 Y 1 A HIS 0 ? A HIS 7 29 5 Y 1 A MET -6 ? A MET 1 30 5 Y 1 A HIS -5 ? A HIS 2 31 5 Y 1 A HIS -4 ? A HIS 3 32 5 Y 1 A HIS -3 ? A HIS 4 33 5 Y 1 A HIS -2 ? A HIS 5 34 5 Y 1 A HIS -1 ? A HIS 6 35 5 Y 1 A HIS 0 ? A HIS 7 36 6 Y 1 A MET -6 ? A MET 1 37 6 Y 1 A HIS -5 ? A HIS 2 38 6 Y 1 A HIS -4 ? A HIS 3 39 6 Y 1 A HIS -3 ? A HIS 4 40 6 Y 1 A HIS -2 ? A HIS 5 41 6 Y 1 A HIS -1 ? A HIS 6 42 6 Y 1 A HIS 0 ? A HIS 7 43 7 Y 1 A MET -6 ? A MET 1 44 7 Y 1 A HIS -5 ? A HIS 2 45 7 Y 1 A HIS -4 ? A HIS 3 46 7 Y 1 A HIS -3 ? A HIS 4 47 7 Y 1 A HIS -2 ? A HIS 5 48 7 Y 1 A HIS -1 ? A HIS 6 49 7 Y 1 A HIS 0 ? A HIS 7 50 8 Y 1 A MET -6 ? A MET 1 51 8 Y 1 A HIS -5 ? A HIS 2 52 8 Y 1 A HIS -4 ? A HIS 3 53 8 Y 1 A HIS -3 ? A HIS 4 54 8 Y 1 A HIS -2 ? A HIS 5 55 8 Y 1 A HIS -1 ? A HIS 6 56 8 Y 1 A HIS 0 ? A HIS 7 57 9 Y 1 A MET -6 ? A MET 1 58 9 Y 1 A HIS -5 ? A HIS 2 59 9 Y 1 A HIS -4 ? A HIS 3 60 9 Y 1 A HIS -3 ? A HIS 4 61 9 Y 1 A HIS -2 ? A HIS 5 62 9 Y 1 A HIS -1 ? A HIS 6 63 9 Y 1 A HIS 0 ? A HIS 7 64 10 Y 1 A MET -6 ? A MET 1 65 10 Y 1 A HIS -5 ? A HIS 2 66 10 Y 1 A HIS -4 ? A HIS 3 67 10 Y 1 A HIS -3 ? A HIS 4 68 10 Y 1 A HIS -2 ? A HIS 5 69 10 Y 1 A HIS -1 ? A HIS 6 70 10 Y 1 A HIS 0 ? A HIS 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2MRM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_