data_2MVD # _entry.id 2MVD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MVD pdb_00002mvd 10.2210/pdb2mvd/pdb RCSB RCSB104091 ? ? BMRB 25261 ? ? WWPDB D_1000104091 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2MVC PDB . unspecified 25261 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MVD _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-10-02 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hexnerova, R.' 1 'Krizkova, K.' 2 'Maletinska, L.' 3 'Jiracek, J.' 4 'Brzozowski, A.M.' 5 'Zakova, L.' 6 'Veverka, V.' 7 # _citation.id primary _citation.title 'Structural and Functional Study of the GlnB22-Insulin Mutant Responsible for Maturity-Onset Diabetes of the Young.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 9 _citation.page_first e112883 _citation.page_last e112883 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25423173 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0112883 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Krizkova, K.' 1 ? primary 'Veverka, V.' 2 ? primary 'Maletinska, L.' 3 ? primary 'Hexnerova, R.' 4 ? primary 'Brzozowski, A.M.' 5 ? primary 'Jiracek, J.' 6 ? primary 'Zakova, L.' 7 ? # _cell.entry_id 2MVD _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MVD _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Insulin A chain' 2383.698 1 ? ? 'UNP residues 90-110' ? 2 polymer syn 'Insulin B chain' 3404.888 1 ? R46Q 'UNP residues 25-54' ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A ? 2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGEQGFFYTPKT FVNQHLCGSHLVEALYLVCGEQGFFYTPKT B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 HIS n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 GLN n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 PRO n 2 29 LYS n 2 30 THR n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample ? ? 'Homo sapiens' Human 9606 ? 2 1 sample ? ? 'Homo sapiens' Human 9606 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP INS_HUMAN P01308 1 GIVEQCCTSICSLYQLENYCN 90 ? 2 UNP INS_HUMAN P01308 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2MVD A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 2MVD B 1 ? 30 ? P01308 25 ? 54 ? 31 60 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 2MVD _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 22 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01308 _struct_ref_seq_dif.db_mon_id ARG _struct_ref_seq_dif.pdbx_seq_db_seq_num 46 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 52 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 1.9 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.2 mM protein_1, 0.2 mM protein_2, 20 % [U-99% 2H] acetic acid, 5 % [U-99% 2H] D2O, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MVD _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MVD _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MVD _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 Goddard 'chemical shift assignment' Sparky ? 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 3 . refinement YASARA ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MVD _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MVD _struct.title 'Solution structure of [GlnB22]-insulin mutant at pH 1.9' _struct.pdbx_model_details 'closest to the average, model9' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MVD _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'insulin, MODY, HORMONE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 1 ? SER A 9 ? GLY A 1 SER A 9 1 ? 9 HELX_P HELX_P2 2 SER A 12 ? TYR A 19 ? SER A 12 TYR A 19 1 ? 8 HELX_P HELX_P3 3 GLY B 8 ? GLY B 20 ? GLY B 38 GLY B 50 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 37 1_555 ? ? ? ? ? ? ? 2.048 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 49 1_555 ? ? ? ? ? ? ? 2.007 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2MVD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 31 31 PHE PHE B . n B 2 2 VAL 2 32 32 VAL VAL B . n B 2 3 ASN 3 33 33 ASN ASN B . n B 2 4 GLN 4 34 34 GLN GLN B . n B 2 5 HIS 5 35 35 HIS HIS B . n B 2 6 LEU 6 36 36 LEU LEU B . n B 2 7 CYS 7 37 37 CYS CYS B . n B 2 8 GLY 8 38 38 GLY GLY B . n B 2 9 SER 9 39 39 SER SER B . n B 2 10 HIS 10 40 40 HIS HIS B . n B 2 11 LEU 11 41 41 LEU LEU B . n B 2 12 VAL 12 42 42 VAL VAL B . n B 2 13 GLU 13 43 43 GLU GLU B . n B 2 14 ALA 14 44 44 ALA ALA B . n B 2 15 LEU 15 45 45 LEU LEU B . n B 2 16 TYR 16 46 46 TYR TYR B . n B 2 17 LEU 17 47 47 LEU LEU B . n B 2 18 VAL 18 48 48 VAL VAL B . n B 2 19 CYS 19 49 49 CYS CYS B . n B 2 20 GLY 20 50 50 GLY GLY B . n B 2 21 GLU 21 51 51 GLU GLU B . n B 2 22 GLN 22 52 52 GLN GLN B . n B 2 23 GLY 23 53 53 GLY GLY B . n B 2 24 PHE 24 54 54 PHE PHE B . n B 2 25 PHE 25 55 55 PHE PHE B . n B 2 26 TYR 26 56 56 TYR TYR B . n B 2 27 THR 27 57 57 THR THR B . n B 2 28 PRO 28 58 58 PRO PRO B . n B 2 29 LYS 29 59 59 LYS LYS B . n B 2 30 THR 30 60 60 THR THR B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-12-10 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1-1 0.2 ? mM ? 1 entity_2-2 0.2 ? mM ? 1 'acetic acid-3' 20 ? % '[U-99% 2H]' 1 D2O-4 5 ? % '[U-99% 2H]' 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 11 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 59 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HXT _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 60 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.54 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 4 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.174 1.252 -0.078 0.011 N 2 4 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.183 1.252 -0.069 0.011 N 3 5 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.181 1.252 -0.071 0.011 N 4 6 C A ASN 21 ? ? OXT A ASN 21 ? ? 1.352 1.229 0.123 0.019 N 5 7 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.180 1.252 -0.072 0.011 N 6 8 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.180 1.252 -0.072 0.011 N 7 8 C B THR 60 ? ? OXT B THR 60 ? ? 1.352 1.229 0.123 0.019 N 8 9 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.184 1.252 -0.068 0.011 N 9 10 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.185 1.252 -0.067 0.011 N 10 10 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.175 1.252 -0.077 0.011 N 11 11 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.179 1.252 -0.073 0.011 N 12 12 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.167 1.252 -0.085 0.011 N 13 12 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.175 1.252 -0.077 0.011 N 14 12 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.182 1.252 -0.070 0.011 N 15 13 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.170 1.252 -0.082 0.011 N 16 14 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.155 1.252 -0.097 0.011 N 17 14 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.177 1.252 -0.075 0.011 N 18 15 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.186 1.252 -0.066 0.011 N 19 15 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.183 1.252 -0.069 0.011 N 20 16 CD1 A TYR 19 ? ? CE1 A TYR 19 ? ? 1.485 1.389 0.096 0.015 N 21 16 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.178 1.252 -0.074 0.011 N 22 16 CD B GLU 51 ? ? OE2 B GLU 51 ? ? 1.321 1.252 0.069 0.011 N 23 17 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.184 1.252 -0.068 0.011 N 24 18 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.178 1.252 -0.074 0.011 N 25 19 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.159 1.252 -0.093 0.011 N 26 20 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.179 1.252 -0.073 0.011 N 27 20 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.179 1.252 -0.073 0.011 N 28 21 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.170 1.252 -0.082 0.011 N 29 22 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.183 1.252 -0.069 0.011 N 30 22 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.175 1.252 -0.077 0.011 N 31 23 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.175 1.252 -0.077 0.011 N 32 23 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.176 1.252 -0.076 0.011 N 33 25 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.322 1.252 0.070 0.011 N 34 26 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.182 1.252 -0.070 0.011 N 35 26 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.185 1.252 -0.067 0.011 N 36 27 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.175 1.252 -0.077 0.011 N 37 27 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.182 1.252 -0.070 0.011 N 38 27 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.184 1.252 -0.068 0.011 N 39 28 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.184 1.252 -0.068 0.011 N 40 28 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.186 1.252 -0.066 0.011 N 41 30 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.172 1.252 -0.080 0.011 N 42 31 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.183 1.252 -0.069 0.011 N 43 31 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.184 1.252 -0.068 0.011 N 44 32 N A GLY 1 ? ? CA A GLY 1 ? ? 1.550 1.456 0.094 0.015 N 45 32 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.181 1.252 -0.071 0.011 N 46 33 CD B GLU 43 ? ? OE2 B GLU 43 ? ? 1.323 1.252 0.071 0.011 N 47 34 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.185 1.252 -0.067 0.011 N 48 36 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.180 1.252 -0.072 0.011 N 49 36 CD A GLU 17 ? ? OE2 A GLU 17 ? ? 1.318 1.252 0.066 0.011 N 50 37 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.165 1.252 -0.087 0.011 N 51 37 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.170 1.252 -0.082 0.011 N 52 38 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.328 1.252 0.076 0.011 N 53 38 CD B GLU 43 ? ? OE1 B GLU 43 ? ? 1.185 1.252 -0.067 0.011 N 54 38 CD B GLU 43 ? ? OE2 B GLU 43 ? ? 1.327 1.252 0.075 0.011 N 55 39 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.180 1.252 -0.072 0.011 N 56 39 CD B GLU 51 ? ? OE1 B GLU 51 ? ? 1.184 1.252 -0.068 0.011 N 57 40 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.160 1.252 -0.092 0.011 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU B 36 ? ? 45.22 86.47 2 1 GLU B 51 ? ? 64.48 167.64 3 1 PHE B 54 ? ? 68.78 123.66 4 3 CYS B 37 ? ? -126.99 -159.83 5 3 SER B 39 ? ? 65.04 -49.55 6 3 GLN B 52 ? ? -144.26 24.49 7 3 PHE B 54 ? ? 67.45 130.81 8 3 TYR B 56 ? ? 56.56 116.42 9 4 GLN B 52 ? ? -75.22 40.65 10 4 PHE B 54 ? ? 64.28 125.38 11 5 CYS B 49 ? ? -162.77 -7.88 12 7 CYS A 7 ? ? -82.17 37.51 13 7 THR A 8 ? ? -125.91 -72.69 14 7 SER A 9 ? ? -142.74 41.09 15 7 ILE A 10 ? ? 68.33 107.60 16 7 VAL B 32 ? ? -98.30 55.03 17 7 ASN B 33 ? ? -76.04 35.18 18 7 GLN B 34 ? ? 60.32 170.96 19 7 CYS B 37 ? ? -140.04 -71.59 20 7 GLN B 52 ? ? -167.66 40.56 21 8 THR A 8 ? ? -146.49 -54.96 22 8 ILE A 10 ? ? 62.64 84.34 23 8 CYS B 49 ? ? -151.40 20.54 24 9 CYS A 11 ? ? 54.20 86.81 25 9 CYS B 37 ? ? -139.87 -58.98 26 9 GLN B 52 ? ? -87.14 48.81 27 9 PHE B 54 ? ? 68.07 -20.67 28 10 LYS B 59 ? ? -148.76 44.55 29 11 TYR B 56 ? ? 60.99 164.07 30 12 THR A 8 ? ? -146.44 -5.94 31 13 SER A 9 ? ? 51.50 -153.57 32 13 CYS B 37 ? ? -126.47 -146.18 33 13 SER B 39 ? ? 63.80 -51.89 34 13 GLN B 52 ? ? -144.78 -32.25 35 14 CYS A 7 ? ? -88.41 40.19 36 14 THR A 8 ? ? -133.29 -91.13 37 14 CYS B 37 ? ? -129.27 -144.37 38 14 SER B 39 ? ? 63.94 -61.34 39 15 CYS A 20 ? ? -116.26 -162.58 40 15 SER B 39 ? ? 60.21 -32.64 41 15 TYR B 56 ? ? 59.27 139.53 42 16 CYS A 20 ? ? -93.99 50.90 43 16 CYS B 37 ? ? -140.81 -43.61 44 17 SER B 39 ? ? 61.55 -43.68 45 18 THR A 8 ? ? -153.29 -40.87 46 18 SER A 9 ? ? -146.90 36.83 47 18 ILE A 10 ? ? 56.59 76.43 48 18 CYS A 20 ? ? -107.41 40.24 49 18 PHE B 54 ? ? -141.53 -138.74 50 19 CYS B 37 ? ? -131.06 -54.94 51 19 PHE B 55 ? ? -151.97 44.40 52 19 TYR B 56 ? ? 65.67 110.46 53 20 SER A 9 ? ? 59.11 176.73 54 20 PHE B 55 ? ? -145.54 34.06 55 20 TYR B 56 ? ? 66.02 120.98 56 21 GLU B 51 ? ? -153.03 22.91 57 22 CYS B 37 ? ? -105.03 -82.26 58 22 CYS B 49 ? ? -148.07 53.40 59 22 THR B 57 ? ? -118.18 79.96 60 22 LYS B 59 ? ? -142.92 -63.04 61 23 SER B 39 ? ? 71.11 -26.03 62 23 CYS B 49 ? ? -157.55 33.23 63 23 GLN B 52 ? ? 58.95 19.68 64 23 LYS B 59 ? ? -157.83 33.39 65 24 CYS A 20 ? ? -152.97 56.93 66 24 CYS B 37 ? ? -137.04 -60.55 67 25 CYS B 49 ? ? -169.05 77.07 68 25 TYR B 56 ? ? 60.60 101.99 69 26 ILE A 10 ? ? 0.10 99.45 70 26 CYS B 37 ? ? -143.28 -130.97 71 26 SER B 39 ? ? 65.18 -44.24 72 26 GLU B 51 ? ? 45.43 -131.27 73 26 PHE B 54 ? ? -112.92 -96.50 74 27 CYS B 49 ? ? -144.85 15.18 75 27 GLU B 51 ? ? 39.49 -106.50 76 28 CYS B 37 ? ? -165.23 66.66 77 29 THR A 8 ? ? -158.38 -27.62 78 29 SER A 9 ? ? -146.47 39.68 79 29 ILE A 10 ? ? 66.60 111.81 80 29 CYS B 49 ? ? -174.22 39.57 81 30 THR A 8 ? ? -152.66 -5.65 82 30 GLU B 51 ? ? -82.31 -74.65 83 30 GLN B 52 ? ? -160.18 -30.66 84 30 THR B 57 ? ? -153.27 88.95 85 31 SER A 9 ? ? 58.06 -172.92 86 31 CYS B 37 ? ? -157.40 65.54 87 32 LEU B 36 ? ? 45.72 91.09 88 32 SER B 39 ? ? 58.18 -61.79 89 32 GLU B 51 ? ? 66.46 -140.69 90 32 PHE B 54 ? ? 58.93 122.03 91 32 LYS B 59 ? ? -146.08 13.57 92 33 CYS B 37 ? ? -146.68 -49.12 93 33 CYS B 49 ? ? -143.53 44.13 94 33 PHE B 54 ? ? 66.82 118.10 95 33 THR B 57 ? ? -151.29 81.84 96 34 SER A 9 ? ? 61.90 -178.71 97 34 LEU B 36 ? ? 53.38 80.44 98 35 CYS A 7 ? ? -88.15 43.60 99 35 ILE A 10 ? ? 33.72 100.42 100 35 GLN B 34 ? ? 59.25 177.57 101 35 CYS B 37 ? ? -144.17 -37.50 102 35 GLN B 52 ? ? -148.30 -113.19 103 36 GLN B 34 ? ? 61.44 -179.29 104 36 LEU B 36 ? ? 67.01 149.46 105 36 CYS B 37 ? ? -155.37 43.02 106 36 GLU B 51 ? ? -156.19 4.90 107 36 PHE B 54 ? ? 67.76 140.05 108 37 GLU B 51 ? ? 55.41 175.47 109 38 CYS B 49 ? ? -165.42 71.65 110 38 GLU B 51 ? ? 51.52 17.29 111 38 PHE B 55 ? ? 36.43 89.05 112 39 SER A 9 ? ? 50.32 -134.40 113 39 CYS A 20 ? ? -118.95 58.59 114 39 GLU B 51 ? ? 57.45 -159.88 115 40 GLU B 51 ? ? 48.24 -134.49 #