data_2MW5 # _entry.id 2MW5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104118 RCSB ? ? 2MW5 PDB pdb_00002mw5 10.2210/pdb2mw5/pdb 25299 BMRB ? ? D_1000104118 WWPDB ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1A5R PDB . unspecified 2ASQ PDB . unspecified 25299 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MW5 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2014-10-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kumar, D.' 1 'Jaiswal, N.' 2 'Raikwal, N.' 3 'Shukla, V.' 4 'Arora, A.' 5 # _citation.id primary _citation.title 'Prot3DNMR: A simple and swift NMR strategy for Three-Dimentional structutral determination of proteins.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, D.' 1 ? primary 'Jaiswal, N.' 2 ? primary 'Raikwal, N.' 3 ? primary 'Shukla, V.K.' 4 ? primary 'Arora, A.' 5 ? # _cell.entry_id 2MW5 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MW5 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Small ubiquitin-related modifier 1' _entity.formula_weight 11149.545 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;SUMO-1, GAP-modifying protein 1, GMP1, SMT3 homolog 3, Sentrin, Ubiquitin-homology domain protein PIC1, Ubiquitin-like protein SMT3C, Smt3C, Ubiquitin-like protein UBL1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGG ; _entity_poly.pdbx_seq_one_letter_code_can ;MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASP n 1 4 GLN n 1 5 GLU n 1 6 ALA n 1 7 LYS n 1 8 PRO n 1 9 SER n 1 10 THR n 1 11 GLU n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 ASP n 1 16 LYS n 1 17 LYS n 1 18 GLU n 1 19 GLY n 1 20 GLU n 1 21 TYR n 1 22 ILE n 1 23 LYS n 1 24 LEU n 1 25 LYS n 1 26 VAL n 1 27 ILE n 1 28 GLY n 1 29 GLN n 1 30 ASP n 1 31 SER n 1 32 SER n 1 33 GLU n 1 34 ILE n 1 35 HIS n 1 36 PHE n 1 37 LYS n 1 38 VAL n 1 39 LYS n 1 40 MET n 1 41 THR n 1 42 THR n 1 43 HIS n 1 44 LEU n 1 45 LYS n 1 46 LYS n 1 47 LEU n 1 48 LYS n 1 49 GLU n 1 50 SER n 1 51 TYR n 1 52 CYS n 1 53 GLN n 1 54 ARG n 1 55 GLN n 1 56 GLY n 1 57 VAL n 1 58 PRO n 1 59 MET n 1 60 ASN n 1 61 SER n 1 62 LEU n 1 63 ARG n 1 64 PHE n 1 65 LEU n 1 66 PHE n 1 67 GLU n 1 68 GLY n 1 69 GLN n 1 70 ARG n 1 71 ILE n 1 72 ALA n 1 73 ASP n 1 74 ASN n 1 75 HIS n 1 76 THR n 1 77 PRO n 1 78 LYS n 1 79 GLU n 1 80 LEU n 1 81 GLY n 1 82 MET n 1 83 GLU n 1 84 GLU n 1 85 GLU n 1 86 ASP n 1 87 VAL n 1 88 ILE n 1 89 GLU n 1 90 VAL n 1 91 TYR n 1 92 GLN n 1 93 GLU n 1 94 GLN n 1 95 THR n 1 96 GLY n 1 97 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SUMO1, SMT3C, SMT3H3, UBL1, OK/SW-cl.43' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 Lambda DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pQE80L _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SUMO1_HUMAN _struct_ref.pdbx_db_accession P63165 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL GMEEEDVIEVYQEQTGG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MW5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 97 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P63165 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 100 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N TOCSY' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D 1H-13C NOESY' 1 7 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.8-1 mM [U-100% 13C; U-100% 15N] sodium phosphate-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MW5 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 3.73 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MW5 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 5 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 6.9 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 7 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method 'Talos Plus' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MW5 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Keller and Wuthrich' 'chemical shift assignment' CARA 1 9.8 ? refinement CYANA 2 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MW5 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MW5 _struct.title 'Backbone fold of Human Small Ubiquitin like Modifier protein-1 (SUMO-1) based on Prot3D-NMR approach.' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MW5 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'human SUMO, Small Ubiquitin like Modifier, SUMO-1, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 43 ? GLY A 56 ? HIS A 46 GLY A 59 1 ? 14 HELX_P HELX_P2 2 PRO A 58 ? ASN A 60 ? PRO A 61 ASN A 63 5 ? 3 HELX_P HELX_P3 3 THR A 76 ? GLY A 81 ? THR A 79 GLY A 84 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 69 ? ARG A 70 ? GLN A 72 ARG A 73 A 2 LEU A 62 ? PHE A 66 ? LEU A 65 PHE A 69 A 3 GLU A 89 ? GLN A 92 ? GLU A 92 GLN A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 69 ? O GLN A 72 N PHE A 66 ? N PHE A 69 A 2 3 N LEU A 65 ? N LEU A 68 O GLU A 89 ? O GLU A 92 # _atom_sites.entry_id 2MW5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 4 4 MET MET A . n A 1 2 SER 2 5 5 SER SER A . n A 1 3 ASP 3 6 6 ASP ASP A . n A 1 4 GLN 4 7 7 GLN GLN A . n A 1 5 GLU 5 8 8 GLU GLU A . n A 1 6 ALA 6 9 9 ALA ALA A . n A 1 7 LYS 7 10 10 LYS LYS A . n A 1 8 PRO 8 11 11 PRO PRO A . n A 1 9 SER 9 12 12 SER SER A . n A 1 10 THR 10 13 13 THR THR A . n A 1 11 GLU 11 14 14 GLU GLU A . n A 1 12 ASP 12 15 15 ASP ASP A . n A 1 13 LEU 13 16 16 LEU LEU A . n A 1 14 GLY 14 17 17 GLY GLY A . n A 1 15 ASP 15 18 18 ASP ASP A . n A 1 16 LYS 16 19 19 LYS LYS A . n A 1 17 LYS 17 20 20 LYS LYS A . n A 1 18 GLU 18 21 21 GLU GLU A . n A 1 19 GLY 19 22 22 GLY GLY A . n A 1 20 GLU 20 23 23 GLU GLU A . n A 1 21 TYR 21 24 24 TYR TYR A . n A 1 22 ILE 22 25 25 ILE ILE A . n A 1 23 LYS 23 26 26 LYS LYS A . n A 1 24 LEU 24 27 27 LEU LEU A . n A 1 25 LYS 25 28 28 LYS LYS A . n A 1 26 VAL 26 29 29 VAL VAL A . n A 1 27 ILE 27 30 30 ILE ILE A . n A 1 28 GLY 28 31 31 GLY GLY A . n A 1 29 GLN 29 32 32 GLN GLN A . n A 1 30 ASP 30 33 33 ASP ASP A . n A 1 31 SER 31 34 34 SER SER A . n A 1 32 SER 32 35 35 SER SER A . n A 1 33 GLU 33 36 36 GLU GLU A . n A 1 34 ILE 34 37 37 ILE ILE A . n A 1 35 HIS 35 38 38 HIS HIS A . n A 1 36 PHE 36 39 39 PHE PHE A . n A 1 37 LYS 37 40 40 LYS LYS A . n A 1 38 VAL 38 41 41 VAL VAL A . n A 1 39 LYS 39 42 42 LYS LYS A . n A 1 40 MET 40 43 43 MET MET A . n A 1 41 THR 41 44 44 THR THR A . n A 1 42 THR 42 45 45 THR THR A . n A 1 43 HIS 43 46 46 HIS HIS A . n A 1 44 LEU 44 47 47 LEU LEU A . n A 1 45 LYS 45 48 48 LYS LYS A . n A 1 46 LYS 46 49 49 LYS LYS A . n A 1 47 LEU 47 50 50 LEU LEU A . n A 1 48 LYS 48 51 51 LYS LYS A . n A 1 49 GLU 49 52 52 GLU GLU A . n A 1 50 SER 50 53 53 SER SER A . n A 1 51 TYR 51 54 54 TYR TYR A . n A 1 52 CYS 52 55 55 CYS CYS A . n A 1 53 GLN 53 56 56 GLN GLN A . n A 1 54 ARG 54 57 57 ARG ARG A . n A 1 55 GLN 55 58 58 GLN GLN A . n A 1 56 GLY 56 59 59 GLY GLY A . n A 1 57 VAL 57 60 60 VAL VAL A . n A 1 58 PRO 58 61 61 PRO PRO A . n A 1 59 MET 59 62 62 MET MET A . n A 1 60 ASN 60 63 63 ASN ASN A . n A 1 61 SER 61 64 64 SER SER A . n A 1 62 LEU 62 65 65 LEU LEU A . n A 1 63 ARG 63 66 66 ARG ARG A . n A 1 64 PHE 64 67 67 PHE PHE A . n A 1 65 LEU 65 68 68 LEU LEU A . n A 1 66 PHE 66 69 69 PHE PHE A . n A 1 67 GLU 67 70 70 GLU GLU A . n A 1 68 GLY 68 71 71 GLY GLY A . n A 1 69 GLN 69 72 72 GLN GLN A . n A 1 70 ARG 70 73 73 ARG ARG A . n A 1 71 ILE 71 74 74 ILE ILE A . n A 1 72 ALA 72 75 75 ALA ALA A . n A 1 73 ASP 73 76 76 ASP ASP A . n A 1 74 ASN 74 77 77 ASN ASN A . n A 1 75 HIS 75 78 78 HIS HIS A . n A 1 76 THR 76 79 79 THR THR A . n A 1 77 PRO 77 80 80 PRO PRO A . n A 1 78 LYS 78 81 81 LYS LYS A . n A 1 79 GLU 79 82 82 GLU GLU A . n A 1 80 LEU 80 83 83 LEU LEU A . n A 1 81 GLY 81 84 84 GLY GLY A . n A 1 82 MET 82 85 85 MET MET A . n A 1 83 GLU 83 86 86 GLU GLU A . n A 1 84 GLU 84 87 87 GLU GLU A . n A 1 85 GLU 85 88 88 GLU GLU A . n A 1 86 ASP 86 89 89 ASP ASP A . n A 1 87 VAL 87 90 90 VAL VAL A . n A 1 88 ILE 88 91 91 ILE ILE A . n A 1 89 GLU 89 92 92 GLU GLU A . n A 1 90 VAL 90 93 93 VAL VAL A . n A 1 91 TYR 91 94 94 TYR TYR A . n A 1 92 GLN 92 95 95 GLN GLN A . n A 1 93 GLU 93 96 96 GLU GLU A . n A 1 94 GLN 94 97 97 GLN GLN A . n A 1 95 THR 95 98 98 THR THR A . n A 1 96 GLY 96 99 99 GLY GLY A . n A 1 97 GLY 97 100 100 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-12-03 2 'Structure model' 1 1 2014-12-10 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.66 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.13 _pdbx_nmr_ensemble_rms.entry_id 2MW5 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_exptl_sample.component 'sodium phosphate-1' _pdbx_nmr_exptl_sample.concentration ? _pdbx_nmr_exptl_sample.concentration_range 0.8-1 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MW5 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 509 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count 122 _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 66 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 66 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 124.73 120.30 4.43 0.50 N 2 1 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 123.99 120.30 3.69 0.50 N 3 1 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.80 120.30 4.50 0.50 N 4 2 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 124.45 120.30 4.15 0.50 N 5 2 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 123.87 120.30 3.57 0.50 N 6 2 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.24 120.30 3.94 0.50 N 7 3 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 124.16 120.30 3.86 0.50 N 8 3 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 123.58 120.30 3.28 0.50 N 9 3 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 123.82 120.30 3.52 0.50 N 10 4 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 123.40 120.30 3.10 0.50 N 11 4 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 124.22 120.30 3.92 0.50 N 12 4 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.51 120.30 4.21 0.50 N 13 5 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 124.36 120.30 4.06 0.50 N 14 5 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.61 120.30 4.31 0.50 N 15 6 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 124.22 120.30 3.92 0.50 N 16 6 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 124.77 120.30 4.47 0.50 N 17 6 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.72 120.30 4.42 0.50 N 18 7 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 123.57 120.30 3.27 0.50 N 19 7 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 124.43 120.30 4.13 0.50 N 20 7 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.47 120.30 4.17 0.50 N 21 8 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 123.99 120.30 3.69 0.50 N 22 8 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 123.83 120.30 3.53 0.50 N 23 8 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.40 120.30 4.10 0.50 N 24 9 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 123.90 120.30 3.60 0.50 N 25 9 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 124.33 120.30 4.03 0.50 N 26 9 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 124.46 120.30 4.16 0.50 N 27 10 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 124.51 120.30 4.21 0.50 N 28 10 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 124.92 120.30 4.62 0.50 N 29 10 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 123.57 120.30 3.27 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 40 ? ? -81.26 40.43 2 1 ASN A 63 ? ? -69.52 0.59 3 2 ASP A 18 ? ? -86.00 49.28 4 2 GLU A 86 ? ? 60.02 -40.13 5 2 GLU A 87 ? ? -130.39 -57.65 6 3 GLU A 21 ? ? 60.15 -23.39 7 3 GLU A 87 ? ? -148.51 -54.52 8 4 GLU A 21 ? ? 57.01 13.87 9 4 GLN A 32 ? ? 60.87 -52.16 10 4 GLU A 86 ? ? 64.72 -26.96 11 5 SER A 12 ? ? 59.10 16.78 12 5 GLU A 21 ? ? 56.01 -159.96 13 5 GLU A 88 ? ? 62.08 160.75 14 5 ASP A 89 ? ? -134.50 -80.83 15 6 GLU A 14 ? ? 63.70 -33.10 16 6 GLU A 86 ? ? 61.87 -38.21 17 7 SER A 12 ? ? 54.27 18.49 18 7 LYS A 28 ? ? -118.85 72.84 19 7 GLU A 86 ? ? 66.58 174.67 20 8 ASP A 18 ? ? 59.41 -67.64 21 8 LYS A 40 ? ? -69.88 98.80 22 8 GLU A 86 ? ? 62.38 -18.02 23 9 GLU A 86 ? ? 61.97 -40.64 24 10 LYS A 19 ? ? 64.49 -36.47 25 10 GLU A 21 ? ? 56.48 -162.45 26 10 GLU A 86 ? ? 38.83 -80.04 27 10 GLU A 88 ? ? 56.75 171.53 28 10 ASP A 89 ? ? -147.56 -22.80 #