data_2MYF # _entry.id 2MYF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104195 RCSB ? ? 2MYF PDB pdb_00002myf 10.2210/pdb2myf/pdb 25449 BMRB ? 10.13018/BMR25449 D_1000104195 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-01-27 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MYF _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-01-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 25449 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ganguly, A.K.' 1 'Bhavesh, N.S.' 2 # _citation.id primary _citation.title 'Solution structure of RNA recognition motif of a cyclophilin33-like protein from Plasmodium falciparum' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ganguly, A.K.' 1 ? primary 'Bhavesh, N.S.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RRM containing cyclophilin' _entity.formula_weight 10149.257 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RNA recognition motif (UNP residues 1-86)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMSDNNATDILFVGGIDETIDEKSLYDIFSSFGDIRNIEVPLNMTTKKNRGFAFVEYVEVDDAKHALYNMNNFELNGK RIHVNYSKT ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMSDNNATDILFVGGIDETIDEKSLYDIFSSFGDIRNIEVPLNMTTKKNRGFAFVEYVEVDDAKHALYNMNNFELNGK RIHVNYSKT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 ASP n 1 7 ASN n 1 8 ASN n 1 9 ALA n 1 10 THR n 1 11 ASP n 1 12 ILE n 1 13 LEU n 1 14 PHE n 1 15 VAL n 1 16 GLY n 1 17 GLY n 1 18 ILE n 1 19 ASP n 1 20 GLU n 1 21 THR n 1 22 ILE n 1 23 ASP n 1 24 GLU n 1 25 LYS n 1 26 SER n 1 27 LEU n 1 28 TYR n 1 29 ASP n 1 30 ILE n 1 31 PHE n 1 32 SER n 1 33 SER n 1 34 PHE n 1 35 GLY n 1 36 ASP n 1 37 ILE n 1 38 ARG n 1 39 ASN n 1 40 ILE n 1 41 GLU n 1 42 VAL n 1 43 PRO n 1 44 LEU n 1 45 ASN n 1 46 MET n 1 47 THR n 1 48 THR n 1 49 LYS n 1 50 LYS n 1 51 ASN n 1 52 ARG n 1 53 GLY n 1 54 PHE n 1 55 ALA n 1 56 PHE n 1 57 VAL n 1 58 GLU n 1 59 TYR n 1 60 VAL n 1 61 GLU n 1 62 VAL n 1 63 ASP n 1 64 ASP n 1 65 ALA n 1 66 LYS n 1 67 HIS n 1 68 ALA n 1 69 LEU n 1 70 TYR n 1 71 ASN n 1 72 MET n 1 73 ASN n 1 74 ASN n 1 75 PHE n 1 76 GLU n 1 77 LEU n 1 78 ASN n 1 79 GLY n 1 80 LYS n 1 81 ARG n 1 82 ILE n 1 83 HIS n 1 84 VAL n 1 85 ASN n 1 86 TYR n 1 87 SER n 1 88 LYS n 1 89 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF13_0122 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 3D7 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36329 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 HIS 3 0 0 HIS HIS A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 ASP 6 3 3 ASP ASP A . n A 1 7 ASN 7 4 4 ASN ASN A . n A 1 8 ASN 8 5 5 ASN ASN A . n A 1 9 ALA 9 6 6 ALA ALA A . n A 1 10 THR 10 7 7 THR THR A . n A 1 11 ASP 11 8 8 ASP ASP A . n A 1 12 ILE 12 9 9 ILE ILE A . n A 1 13 LEU 13 10 10 LEU LEU A . n A 1 14 PHE 14 11 11 PHE PHE A . n A 1 15 VAL 15 12 12 VAL VAL A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 ASP 19 16 16 ASP ASP A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 THR 21 18 18 THR THR A . n A 1 22 ILE 22 19 19 ILE ILE A . n A 1 23 ASP 23 20 20 ASP ASP A . n A 1 24 GLU 24 21 21 GLU GLU A . n A 1 25 LYS 25 22 22 LYS LYS A . n A 1 26 SER 26 23 23 SER SER A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 TYR 28 25 25 TYR TYR A . n A 1 29 ASP 29 26 26 ASP ASP A . n A 1 30 ILE 30 27 27 ILE ILE A . n A 1 31 PHE 31 28 28 PHE PHE A . n A 1 32 SER 32 29 29 SER SER A . n A 1 33 SER 33 30 30 SER SER A . n A 1 34 PHE 34 31 31 PHE PHE A . n A 1 35 GLY 35 32 32 GLY GLY A . n A 1 36 ASP 36 33 33 ASP ASP A . n A 1 37 ILE 37 34 34 ILE ILE A . n A 1 38 ARG 38 35 35 ARG ARG A . n A 1 39 ASN 39 36 36 ASN ASN A . n A 1 40 ILE 40 37 37 ILE ILE A . n A 1 41 GLU 41 38 38 GLU GLU A . n A 1 42 VAL 42 39 39 VAL VAL A . n A 1 43 PRO 43 40 40 PRO PRO A . n A 1 44 LEU 44 41 41 LEU LEU A . n A 1 45 ASN 45 42 42 ASN ASN A . n A 1 46 MET 46 43 43 MET MET A . n A 1 47 THR 47 44 44 THR THR A . n A 1 48 THR 48 45 45 THR THR A . n A 1 49 LYS 49 46 46 LYS LYS A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 ASN 51 48 48 ASN ASN A . n A 1 52 ARG 52 49 49 ARG ARG A . n A 1 53 GLY 53 50 50 GLY GLY A . n A 1 54 PHE 54 51 51 PHE PHE A . n A 1 55 ALA 55 52 52 ALA ALA A . n A 1 56 PHE 56 53 53 PHE PHE A . n A 1 57 VAL 57 54 54 VAL VAL A . n A 1 58 GLU 58 55 55 GLU GLU A . n A 1 59 TYR 59 56 56 TYR TYR A . n A 1 60 VAL 60 57 57 VAL VAL A . n A 1 61 GLU 61 58 58 GLU GLU A . n A 1 62 VAL 62 59 59 VAL VAL A . n A 1 63 ASP 63 60 60 ASP ASP A . n A 1 64 ASP 64 61 61 ASP ASP A . n A 1 65 ALA 65 62 62 ALA ALA A . n A 1 66 LYS 66 63 63 LYS LYS A . n A 1 67 HIS 67 64 64 HIS HIS A . n A 1 68 ALA 68 65 65 ALA ALA A . n A 1 69 LEU 69 66 66 LEU LEU A . n A 1 70 TYR 70 67 67 TYR TYR A . n A 1 71 ASN 71 68 68 ASN ASN A . n A 1 72 MET 72 69 69 MET MET A . n A 1 73 ASN 73 70 70 ASN ASN A . n A 1 74 ASN 74 71 71 ASN ASN A . n A 1 75 PHE 75 72 72 PHE PHE A . n A 1 76 GLU 76 73 73 GLU GLU A . n A 1 77 LEU 77 74 74 LEU LEU A . n A 1 78 ASN 78 75 75 ASN ASN A . n A 1 79 GLY 79 76 76 GLY GLY A . n A 1 80 LYS 80 77 77 LYS LYS A . n A 1 81 ARG 81 78 78 ARG ARG A . n A 1 82 ILE 82 79 79 ILE ILE A . n A 1 83 HIS 83 80 80 HIS HIS A . n A 1 84 VAL 84 81 81 VAL VAL A . n A 1 85 ASN 85 82 82 ASN ASN A . n A 1 86 TYR 86 83 83 TYR TYR A . n A 1 87 SER 87 84 84 SER SER A . n A 1 88 LYS 88 85 85 LYS LYS A . n A 1 89 THR 89 86 86 THR THR A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MYF _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MYF _struct.title 'Solution structure of RNA recognition motif of a cyclophilin33-like protein from Plasmodium falciparum' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MYF _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'PfCyp33, RNA recognition motif, RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C0H5C7_PLAF7 _struct_ref.pdbx_db_accession C0H5C7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSDNNATDILFVGGIDETIDEKSLYDIFSSFGDIRNIEVPLNMTTKKNRGFAFVEYVEVDDAKHALYNMNNFELNGKRIH VNYSKT ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MYF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C0H5C7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MYF GLY A 1 ? UNP C0H5C7 ? ? 'expression tag' -2 1 1 2MYF SER A 2 ? UNP C0H5C7 ? ? 'expression tag' -1 2 1 2MYF HIS A 3 ? UNP C0H5C7 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 23 ? SER A 32 ? ASP A 20 SER A 29 1 ? 10 HELX_P HELX_P2 2 GLU A 61 ? MET A 72 ? GLU A 58 MET A 69 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 37 ? GLU A 41 ? ILE A 34 GLU A 38 A 2 PHE A 56 ? TYR A 59 ? PHE A 53 TYR A 56 A 3 LEU A 13 ? GLY A 16 ? LEU A 10 GLY A 13 A 4 HIS A 83 ? ASN A 85 ? HIS A 80 ASN A 82 B 1 GLU A 76 ? LEU A 77 ? GLU A 73 LEU A 74 B 2 LYS A 80 ? ARG A 81 ? LYS A 77 ARG A 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 38 ? N ARG A 35 O GLU A 58 ? O GLU A 55 A 2 3 O VAL A 57 ? O VAL A 54 N LEU A 13 ? N LEU A 10 A 3 4 N PHE A 14 ? N PHE A 11 O ASN A 85 ? O ASN A 82 B 1 2 N LEU A 77 ? N LEU A 74 O LYS A 80 ? O LYS A 77 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 CB A TYR 56 ? ? CG A TYR 56 ? ? CD1 A TYR 56 ? ? 124.82 121.00 3.82 0.60 N 2 6 CB A TYR 25 ? ? CG A TYR 25 ? ? CD1 A TYR 25 ? ? 124.89 121.00 3.89 0.60 N 3 15 CB A TYR 25 ? ? CG A TYR 25 ? ? CD1 A TYR 25 ? ? 124.64 121.00 3.64 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A -1 ? ? -131.30 -59.91 2 1 ALA A 6 ? ? -55.95 96.19 3 1 ASP A 8 ? ? 51.20 13.30 4 2 HIS A 0 ? ? -148.74 -82.24 5 2 ASP A 3 ? ? -177.50 -77.48 6 2 ALA A 6 ? ? 69.73 117.03 7 2 ASP A 8 ? ? 53.08 10.41 8 2 ASN A 36 ? ? -173.67 132.04 9 3 ALA A 6 ? ? -56.89 95.65 10 3 ASP A 8 ? ? 54.47 12.76 11 4 SER A -1 ? ? -146.99 35.68 12 4 HIS A 0 ? ? -168.70 87.84 13 4 SER A 2 ? ? -85.87 -101.64 14 4 ASP A 3 ? ? -154.02 -22.10 15 4 ALA A 6 ? ? 64.55 104.32 16 4 ASP A 8 ? ? 48.86 13.55 17 4 ASN A 36 ? ? -171.84 134.99 18 4 LYS A 46 ? ? 40.53 81.17 19 4 SER A 84 ? ? -115.88 -164.39 20 5 ALA A 6 ? ? 69.96 106.40 21 5 ASP A 8 ? ? 51.21 12.79 22 5 LYS A 46 ? ? 54.52 79.98 23 6 HIS A 0 ? ? 64.74 -89.05 24 6 SER A 2 ? ? -161.33 111.62 25 6 ALA A 6 ? ? 68.17 101.12 26 6 ASP A 8 ? ? 52.79 12.58 27 6 LYS A 46 ? ? 53.61 87.33 28 7 HIS A 0 ? ? 70.97 95.76 29 7 MET A 1 ? ? -115.52 -135.83 30 7 SER A 2 ? ? -111.05 75.15 31 7 ASP A 3 ? ? 177.28 126.52 32 7 ALA A 6 ? ? -68.66 99.97 33 7 ASP A 8 ? ? 53.04 11.98 34 7 LYS A 46 ? ? 62.40 76.64 35 8 HIS A 0 ? ? 68.72 99.48 36 8 ALA A 6 ? ? -56.73 102.70 37 8 ASP A 8 ? ? 47.27 11.89 38 8 ASN A 36 ? ? -178.34 141.73 39 9 HIS A 0 ? ? 71.25 106.80 40 9 ALA A 6 ? ? 63.09 109.80 41 9 ASP A 8 ? ? 48.47 9.34 42 9 ASN A 36 ? ? 179.99 148.37 43 9 LYS A 46 ? ? 62.75 63.50 44 10 HIS A 0 ? ? 70.93 88.83 45 10 SER A 2 ? ? 85.07 127.43 46 10 ASN A 4 ? ? 58.09 -166.56 47 10 ALA A 6 ? ? -68.80 86.82 48 10 ASP A 8 ? ? 52.73 12.60 49 11 SER A -1 ? ? -160.47 -61.98 50 11 ASN A 4 ? ? 46.33 -166.36 51 12 SER A -1 ? ? -153.00 -68.90 52 12 MET A 1 ? ? -108.34 43.42 53 12 SER A 2 ? ? 64.77 135.32 54 12 ASN A 4 ? ? -148.77 -154.00 55 12 ALA A 6 ? ? 71.97 86.82 56 12 ASP A 8 ? ? 56.12 11.18 57 13 SER A -1 ? ? -138.82 -67.44 58 13 HIS A 0 ? ? -98.67 47.22 59 13 SER A 2 ? ? -66.60 -99.70 60 13 ASP A 3 ? ? -165.32 114.38 61 13 ASN A 4 ? ? 176.26 167.61 62 13 ALA A 6 ? ? 51.92 96.60 63 13 ASP A 8 ? ? 56.00 11.33 64 13 LYS A 85 ? ? -48.32 107.87 65 14 SER A -1 ? ? -113.25 78.00 66 14 HIS A 0 ? ? 56.49 -159.23 67 14 ALA A 6 ? ? 71.67 117.49 68 14 ASP A 8 ? ? 48.27 6.83 69 14 ASN A 36 ? ? 179.86 146.89 70 15 MET A 1 ? ? 75.36 133.85 71 15 ALA A 6 ? ? 85.09 93.58 72 15 ASP A 8 ? ? 52.36 11.24 73 15 LYS A 46 ? ? 54.52 81.48 74 16 SER A -1 ? ? -143.16 -51.56 75 16 SER A 2 ? ? 61.48 111.82 76 16 ALA A 6 ? ? -54.65 106.04 77 16 ASP A 8 ? ? 49.52 6.68 78 16 SER A 84 ? ? -110.72 -166.84 79 17 SER A -1 ? ? -123.61 -161.52 80 17 ASP A 3 ? ? 70.04 97.37 81 17 ALA A 6 ? ? -60.69 96.36 82 17 ASP A 8 ? ? 49.94 13.94 83 17 ASN A 36 ? ? -179.29 144.58 84 17 LYS A 46 ? ? 52.66 82.47 85 18 SER A -1 ? ? -152.19 -59.75 86 18 MET A 1 ? ? -134.94 -105.04 87 18 ASP A 3 ? ? -146.61 -67.32 88 18 ALA A 6 ? ? 62.30 112.47 89 18 ASP A 8 ? ? 53.12 7.72 90 18 ASN A 36 ? ? -175.03 149.86 91 18 LYS A 46 ? ? 51.83 84.49 92 18 SER A 84 ? ? -125.84 -158.81 93 19 HIS A 0 ? ? 64.83 83.46 94 19 MET A 1 ? ? -94.35 -104.70 95 19 ALA A 6 ? ? 66.83 99.55 96 19 ASP A 8 ? ? 49.48 12.61 97 19 LYS A 46 ? ? 63.09 65.76 98 20 SER A -1 ? ? -86.55 -85.45 99 20 HIS A 0 ? ? -150.08 -46.34 100 20 MET A 1 ? ? -148.75 -73.75 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 9 _pdbx_validate_peptide_omega.auth_comp_id_1 ASP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 16 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 17 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -148.92 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MYF _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MYF _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5-1 mM [U-100% 13C; U-100% 15N] RRM, 20 mM sodium phosphate, 50 mM sodium chloride, 50 uM DSS, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.5-1 mM [U-100% 13C; U-100% 15N] RRM, 20 mM sodium phosphate, 50 mM sodium chloride, 50 uM DSS, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id RRM-1 ? 0.5-1 mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 DSS-4 50 ? uM ? 1 RRM-5 ? 0.5-1 mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate-6' 20 ? mM ? 2 'sodium chloride-7' 50 ? mM ? 2 DSS-8 50 ? uM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D HNCO' 1 7 1 '3D C(CO)NH' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY aliphatic' 1 11 1 '3D 1H-13C NOESY aromatic' 1 12 2 '3D 1H-13C NOESY aliphatic' # _pdbx_nmr_refine.entry_id 2MYF _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing, molecular dynamics' _pdbx_nmr_refine.details 'WATER REFINEMENT' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Bruker Biospin' processing TopSpin ? 2 'Keller and Wuthrich' 'peak picking' CARA ? 3 'Keller and Wuthrich' 'chemical shift assignment' CARA ? 4 'Keller and Wuthrich' 'data analysis' CARA ? 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA 3.0 7 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TYR N N N N 284 TYR CA C N S 285 TYR C C N N 286 TYR O O N N 287 TYR CB C N N 288 TYR CG C Y N 289 TYR CD1 C Y N 290 TYR CD2 C Y N 291 TYR CE1 C Y N 292 TYR CE2 C Y N 293 TYR CZ C Y N 294 TYR OH O N N 295 TYR OXT O N N 296 TYR H H N N 297 TYR H2 H N N 298 TYR HA H N N 299 TYR HB2 H N N 300 TYR HB3 H N N 301 TYR HD1 H N N 302 TYR HD2 H N N 303 TYR HE1 H N N 304 TYR HE2 H N N 305 TYR HH H N N 306 TYR HXT H N N 307 VAL N N N N 308 VAL CA C N S 309 VAL C C N N 310 VAL O O N N 311 VAL CB C N N 312 VAL CG1 C N N 313 VAL CG2 C N N 314 VAL OXT O N N 315 VAL H H N N 316 VAL H2 H N N 317 VAL HA H N N 318 VAL HB H N N 319 VAL HG11 H N N 320 VAL HG12 H N N 321 VAL HG13 H N N 322 VAL HG21 H N N 323 VAL HG22 H N N 324 VAL HG23 H N N 325 VAL HXT H N N 326 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TYR N CA sing N N 272 TYR N H sing N N 273 TYR N H2 sing N N 274 TYR CA C sing N N 275 TYR CA CB sing N N 276 TYR CA HA sing N N 277 TYR C O doub N N 278 TYR C OXT sing N N 279 TYR CB CG sing N N 280 TYR CB HB2 sing N N 281 TYR CB HB3 sing N N 282 TYR CG CD1 doub Y N 283 TYR CG CD2 sing Y N 284 TYR CD1 CE1 sing Y N 285 TYR CD1 HD1 sing N N 286 TYR CD2 CE2 doub Y N 287 TYR CD2 HD2 sing N N 288 TYR CE1 CZ doub Y N 289 TYR CE1 HE1 sing N N 290 TYR CE2 CZ sing Y N 291 TYR CE2 HE2 sing N N 292 TYR CZ OH sing N N 293 TYR OH HH sing N N 294 TYR OXT HXT sing N N 295 VAL N CA sing N N 296 VAL N H sing N N 297 VAL N H2 sing N N 298 VAL CA C sing N N 299 VAL CA CB sing N N 300 VAL CA HA sing N N 301 VAL C O doub N N 302 VAL C OXT sing N N 303 VAL CB CG1 sing N N 304 VAL CB CG2 sing N N 305 VAL CB HB sing N N 306 VAL CG1 HG11 sing N N 307 VAL CG1 HG12 sing N N 308 VAL CG1 HG13 sing N N 309 VAL CG2 HG21 sing N N 310 VAL CG2 HG22 sing N N 311 VAL CG2 HG23 sing N N 312 VAL OXT HXT sing N N 313 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2MYF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_