data_2MZJ # _entry.id 2MZJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104232 RCSB ? ? 2MZJ PDB pdb_00002mzj 10.2210/pdb2mzj/pdb 19098 BMRB ? ? D_1000104232 WWPDB ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 19098 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MZJ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-02-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wurm, J.' 1 'Lioutikov, A.' 2 'Koetter, P.' 3 'Entian, K.' 4 'Woehnert, J.' 5 # _citation.id primary _citation.title 'Not known yet' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wurm, J.' 1 ? primary 'Lioutikov, A.' 2 ? primary 'Koetter, P.' 3 ? primary 'Entian, K.' 4 ? primary 'Woehnert, J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Nucleolar protein 6' _entity.formula_weight 9248.613 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment Nop6-RBD _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GNRFIVFVGSLPRDITAVELQNHFKNSSPDQIRLRADKGIAFLEFDADKDRTGIQRRMDIALLQHGTLLKEKKINVELTV GG ; _entity_poly.pdbx_seq_one_letter_code_can ;GNRFIVFVGSLPRDITAVELQNHFKNSSPDQIRLRADKGIAFLEFDADKDRTGIQRRMDIALLQHGTLLKEKKINVELTV GG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASN n 1 3 ARG n 1 4 PHE n 1 5 ILE n 1 6 VAL n 1 7 PHE n 1 8 VAL n 1 9 GLY n 1 10 SER n 1 11 LEU n 1 12 PRO n 1 13 ARG n 1 14 ASP n 1 15 ILE n 1 16 THR n 1 17 ALA n 1 18 VAL n 1 19 GLU n 1 20 LEU n 1 21 GLN n 1 22 ASN n 1 23 HIS n 1 24 PHE n 1 25 LYS n 1 26 ASN n 1 27 SER n 1 28 SER n 1 29 PRO n 1 30 ASP n 1 31 GLN n 1 32 ILE n 1 33 ARG n 1 34 LEU n 1 35 ARG n 1 36 ALA n 1 37 ASP n 1 38 LYS n 1 39 GLY n 1 40 ILE n 1 41 ALA n 1 42 PHE n 1 43 LEU n 1 44 GLU n 1 45 PHE n 1 46 ASP n 1 47 ALA n 1 48 ASP n 1 49 LYS n 1 50 ASP n 1 51 ARG n 1 52 THR n 1 53 GLY n 1 54 ILE n 1 55 GLN n 1 56 ARG n 1 57 ARG n 1 58 MET n 1 59 ASP n 1 60 ILE n 1 61 ALA n 1 62 LEU n 1 63 LEU n 1 64 GLN n 1 65 HIS n 1 66 GLY n 1 67 THR n 1 68 LEU n 1 69 LEU n 1 70 LYS n 1 71 GLU n 1 72 LYS n 1 73 LYS n 1 74 ILE n 1 75 ASN n 1 76 VAL n 1 77 GLU n 1 78 LEU n 1 79 THR n 1 80 VAL n 1 81 GLY n 1 82 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;Baker's yeast ; _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NOP6, YDL213C, D1018' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 204508 / S288c' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae S288c' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NOP6_YEAST _struct_ref.pdbx_db_accession Q07623 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GNRFIVFVGSLPRDITAVELQNHFKNSSPDQIRLRADKGIAFLEFDADKDRTGIQRRMDIALLQHGTLLKEKKINVELTV GG ; _struct_ref.pdbx_align_begin 75 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MZJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q07623 _struct_ref_seq.db_align_beg 75 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 156 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-15N HSQC' 1 3 2 '2D 1H-13C HSQC' 1 4 2 '2D 1H-13C HSQC aliphatic' 1 5 2 '2D 1H-13C HSQC aromatic' 1 6 2 '3D HNCACB' 1 7 2 '3D HN(CA)CO' 1 8 2 '3D HNCO' 1 9 1 '3D 1H-15N NOESY' 1 10 2 '3D 1H-13C NOESY aliphatic' 1 11 2 '3D 1H-13C NOESY aromatic' 1 12 2 '3D H(CCO)NH' 1 13 2 '3D HBHA(CO)NH' 1 14 2 '3D C(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.13 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-15N] entity, 100 mM sodium chloride, 8 mM sodium phosphate, 2 mM potassium phosphate, 2.7 mM potassium chloride, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1 mM [U-13C; U-15N] entity, 100 mM sodium chloride, 8 mM sodium phosphate, 2 mM potassium phosphate, 2.7 mM potassium chloride, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' 800 Bruker AVANCE 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MZJ _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MZJ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MZJ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Herrmann 'structure solution' UNIO ? 1 'Luginbuhl P, Guntert P, Billeter M, Wuthrich K.' refinement OPAL ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'NMR-structure of the Nop6-RBD from S. cerevisiae' _exptl.entry_id 2MZJ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MZJ _struct.title 'NMR-structure of the Nop6-RBD from S. cerevisiae' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MZJ _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RNA binding domain, RBD, RRM, RNA binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 16 ? LYS A 25 ? THR A 16 LYS A 25 1 ? 10 HELX_P HELX_P2 2 ALA A 36 ? LYS A 38 ? ALA A 36 LYS A 38 5 ? 3 HELX_P HELX_P3 3 ASP A 48 ? ASP A 50 ? ASP A 48 ASP A 50 5 ? 3 HELX_P HELX_P4 4 GLY A 53 ? LEU A 63 ? GLY A 53 LEU A 63 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 33 ? ARG A 35 ? ARG A 33 ARG A 35 A 2 ILE A 40 ? ASP A 46 ? ILE A 40 ASP A 46 A 3 ARG A 3 ? GLY A 9 ? ARG A 3 GLY A 9 A 4 ASN A 75 ? THR A 79 ? ASN A 75 THR A 79 B 1 LEU A 68 ? LEU A 69 ? LEU A 68 LEU A 69 B 2 LYS A 72 ? LYS A 73 ? LYS A 72 LYS A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 35 ? N ARG A 35 O ILE A 40 ? O ILE A 40 A 2 3 O PHE A 45 ? O PHE A 45 N PHE A 4 ? N PHE A 4 A 3 4 N PHE A 7 ? N PHE A 7 O GLU A 77 ? O GLU A 77 B 1 2 N LEU A 69 ? N LEU A 69 O LYS A 72 ? O LYS A 72 # _atom_sites.entry_id 2MZJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLY 82 82 82 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-04-13 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-15N]' 1 'sodium chloride-2' 100 ? mM ? 1 'sodium phosphate-3' 8 ? mM ? 1 'potassium phosphate-4' 2 ? mM ? 1 'potassium chloride-5' 2.7 ? mM ? 1 entity-6 1 ? mM '[U-13C; U-15N]' 2 'sodium chloride-7' 100 ? mM ? 2 'sodium phosphate-8' 8 ? mM ? 2 'potassium phosphate-9' 2 ? mM ? 2 'potassium chloride-10' 2.7 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MZJ _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 4 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1438 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 8 NE A ARG 3 ? ? CZ A ARG 3 ? ? NH1 A ARG 3 ? ? 123.62 120.30 3.32 0.50 N 2 9 NE A ARG 51 ? ? CZ A ARG 51 ? ? NH2 A ARG 51 ? ? 117.23 120.30 -3.07 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 2 ? ? -73.72 40.76 2 1 SER A 28 ? ? 49.78 71.42 3 1 VAL A 80 ? ? 160.60 -65.93 4 2 GLU A 71 ? ? 59.12 14.43 5 2 VAL A 80 ? ? 57.52 86.19 6 3 SER A 28 ? ? 56.59 81.41 7 3 ASP A 50 ? ? -166.01 96.95 8 4 SER A 10 ? ? 82.90 17.09 9 4 SER A 28 ? ? 47.55 77.14 10 4 ASP A 50 ? ? -157.00 84.02 11 4 VAL A 80 ? ? -166.82 -39.34 12 5 ASN A 2 ? ? -151.54 45.31 13 5 SER A 28 ? ? 48.58 70.44 14 5 VAL A 80 ? ? 38.94 77.77 15 6 VAL A 80 ? ? 59.49 79.13 16 7 SER A 28 ? ? 62.81 75.21 17 7 ASP A 50 ? ? -150.14 86.71 18 7 VAL A 80 ? ? 68.15 113.03 19 8 SER A 10 ? ? 84.99 6.30 20 8 SER A 28 ? ? 60.69 72.35 21 8 LEU A 63 ? ? -58.41 -6.82 22 8 VAL A 80 ? ? 48.93 90.59 23 9 VAL A 80 ? ? 70.53 160.40 24 10 ASN A 2 ? ? -67.06 1.26 25 10 SER A 28 ? ? 49.15 73.53 26 10 ASP A 50 ? ? -158.45 86.13 27 11 SER A 28 ? ? 37.32 79.78 28 11 ASP A 50 ? ? -168.42 85.04 29 11 THR A 79 ? ? -153.54 82.42 30 12 SER A 28 ? ? 63.74 69.54 31 12 ASP A 50 ? ? -162.22 96.29 32 12 VAL A 80 ? ? 68.70 -49.38 33 13 ASN A 2 ? ? -141.74 37.50 34 13 ASP A 50 ? ? -163.81 90.40 35 13 VAL A 80 ? ? 64.54 95.24 36 14 SER A 28 ? ? 41.68 77.33 37 14 ASP A 50 ? ? -108.57 71.91 38 14 VAL A 80 ? ? -167.89 -44.89 39 15 ASN A 2 ? ? -152.12 52.18 40 15 SER A 28 ? ? 49.17 74.15 41 15 ASP A 50 ? ? -166.03 90.33 42 15 VAL A 80 ? ? 53.27 86.65 43 16 ASN A 2 ? ? -77.35 40.49 44 16 SER A 28 ? ? 54.40 79.95 45 16 ARG A 35 ? ? -115.17 79.40 46 16 ASP A 50 ? ? -161.35 88.48 47 16 VAL A 80 ? ? 46.01 91.42 48 17 ASP A 50 ? ? -116.34 73.84 49 17 VAL A 80 ? ? 50.07 85.58 50 18 ASN A 2 ? ? -60.35 5.57 51 18 SER A 28 ? ? 50.41 78.26 52 18 ASP A 50 ? ? -168.02 101.52 53 18 VAL A 80 ? ? 64.53 -67.65 54 19 SER A 28 ? ? 39.50 78.20 55 19 ARG A 35 ? ? -116.96 75.07 56 19 VAL A 80 ? ? 57.87 -164.92 57 20 SER A 28 ? ? 54.43 72.95 58 20 VAL A 80 ? ? -167.37 -62.33 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 51 ? ? 0.125 'SIDE CHAIN' 2 4 ARG A 57 ? ? 0.114 'SIDE CHAIN' 3 7 ARG A 13 ? ? 0.086 'SIDE CHAIN' 4 8 ARG A 3 ? ? 0.121 'SIDE CHAIN' 5 9 ARG A 57 ? ? 0.103 'SIDE CHAIN' 6 10 ARG A 57 ? ? 0.092 'SIDE CHAIN' 7 11 ARG A 33 ? ? 0.081 'SIDE CHAIN' 8 12 ARG A 57 ? ? 0.083 'SIDE CHAIN' 9 18 ARG A 3 ? ? 0.081 'SIDE CHAIN' 10 18 ARG A 51 ? ? 0.085 'SIDE CHAIN' 11 18 ARG A 56 ? ? 0.085 'SIDE CHAIN' 12 19 ARG A 51 ? ? 0.087 'SIDE CHAIN' 13 20 ARG A 57 ? ? 0.080 'SIDE CHAIN' #