data_2N35 # _entry.id 2N35 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104362 RCSB ? ? 2N35 PDB pdb_00002n35 10.2210/pdb2n35/pdb 25634 BMRB ? 10.13018/BMR25634 D_1000104362 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-02 2 'Structure model' 1 1 2015-10-21 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N35 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-05-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1GAB PDB . unspecified 2FS1 PDB . unspecified 25634 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gibbs, A.C.' 1 'Jacobs, S.A.' 2 # _citation.id primary _citation.title 'Fusion to a highly stable consensus albumin binding domain allows for tunable pharmacokinetics.' _citation.journal_abbrev 'Protein Eng.Des.Sel.' _citation.journal_volume 28 _citation.page_first 385 _citation.page_last 393 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1741-0126 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26275855 _citation.pdbx_database_id_DOI 10.1093/protein/gzv040 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jacobs, S.A.' 1 ? primary 'Gibbs, A.C.' 2 ? primary 'Conk, M.' 3 ? primary 'Yi, F.' 4 ? primary 'Maguire, D.' 5 ? primary 'Kane, C.' 6 ? primary ;O'Neil, K.T. ; 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Albumin binding protein' _entity.formula_weight 5863.725 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALKDEILKA _entity_poly.pdbx_seq_one_letter_code_can GTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALKDEILKA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 ILE n 1 4 ASP n 1 5 GLU n 1 6 TRP n 1 7 LEU n 1 8 LEU n 1 9 LYS n 1 10 GLU n 1 11 ALA n 1 12 LYS n 1 13 GLU n 1 14 LYS n 1 15 ALA n 1 16 ILE n 1 17 GLU n 1 18 GLU n 1 19 LEU n 1 20 LYS n 1 21 LYS n 1 22 ALA n 1 23 GLY n 1 24 ILE n 1 25 THR n 1 26 SER n 1 27 ASP n 1 28 TYR n 1 29 TYR n 1 30 PHE n 1 31 ASP n 1 32 LEU n 1 33 ILE n 1 34 ASN n 1 35 LYS n 1 36 ALA n 1 37 LYS n 1 38 THR n 1 39 VAL n 1 40 GLU n 1 41 GLY n 1 42 VAL n 1 43 ASN n 1 44 ALA n 1 45 LEU n 1 46 LYS n 1 47 ASP n 1 48 GLU n 1 49 ILE n 1 50 LEU n 1 51 LYS n 1 52 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET26 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ALA 52 52 52 ALA ALA A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.entry_id 2N35 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N35 _struct.title 'Fusion to a Highly Stable Consensus Albumin Binding Domain Allows for Tunable Pharmacokinetics' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N35 _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'albumin binding domain, three-helix bundle, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2N35 _struct_ref.pdbx_db_accession 2N35 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N35 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2N35 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 52 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 52 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 2 ? GLY A 23 ? THR A 2 GLY A 23 1 ? 22 HELX_P HELX_P2 2 SER A 26 ? ALA A 36 ? SER A 26 ALA A 36 1 ? 11 HELX_P HELX_P3 3 THR A 38 ? LYS A 51 ? THR A 38 LYS A 51 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 7 O A LYS 46 ? ? H A LEU 50 ? ? 1.58 2 13 O A LYS 46 ? ? H A LEU 50 ? ? 1.56 3 14 O A LYS 46 ? ? H A LEU 50 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 26 ? ? -59.08 107.95 2 3 SER A 26 ? ? -54.98 108.07 3 7 TRP A 6 ? ? -95.03 -70.84 4 9 SER A 26 ? ? -58.52 107.27 5 12 SER A 26 ? ? -56.83 107.67 6 13 ILE A 3 ? ? -100.55 79.64 7 15 SER A 26 ? ? -58.71 107.84 8 19 SER A 26 ? ? -59.73 107.84 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N35 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N35 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.8 mM [U-100% 13C; U-100% 15N] ABD, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.8 mM [U-10% 13C; U-100% 15N] ABD, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ABD-1 0.8 ? mM '[U-100% 13C; U-100% 15N]' 1 ABD-2 0.8 ? mM '[U-10% 13C; U-100% 15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCA' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-15N TOCSY' 1 9 2 '2D 1H-13C HSQC' # _pdbx_nmr_refine.entry_id 2N35 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Yang Shen, Oliver Lange, Frank Delaglio, et al.' refinement CS-ROSETTA ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLU N N N N 47 GLU CA C N S 48 GLU C C N N 49 GLU O O N N 50 GLU CB C N N 51 GLU CG C N N 52 GLU CD C N N 53 GLU OE1 O N N 54 GLU OE2 O N N 55 GLU OXT O N N 56 GLU H H N N 57 GLU H2 H N N 58 GLU HA H N N 59 GLU HB2 H N N 60 GLU HB3 H N N 61 GLU HG2 H N N 62 GLU HG3 H N N 63 GLU HE2 H N N 64 GLU HXT H N N 65 GLY N N N N 66 GLY CA C N N 67 GLY C C N N 68 GLY O O N N 69 GLY OXT O N N 70 GLY H H N N 71 GLY H2 H N N 72 GLY HA2 H N N 73 GLY HA3 H N N 74 GLY HXT H N N 75 ILE N N N N 76 ILE CA C N S 77 ILE C C N N 78 ILE O O N N 79 ILE CB C N S 80 ILE CG1 C N N 81 ILE CG2 C N N 82 ILE CD1 C N N 83 ILE OXT O N N 84 ILE H H N N 85 ILE H2 H N N 86 ILE HA H N N 87 ILE HB H N N 88 ILE HG12 H N N 89 ILE HG13 H N N 90 ILE HG21 H N N 91 ILE HG22 H N N 92 ILE HG23 H N N 93 ILE HD11 H N N 94 ILE HD12 H N N 95 ILE HD13 H N N 96 ILE HXT H N N 97 LEU N N N N 98 LEU CA C N S 99 LEU C C N N 100 LEU O O N N 101 LEU CB C N N 102 LEU CG C N N 103 LEU CD1 C N N 104 LEU CD2 C N N 105 LEU OXT O N N 106 LEU H H N N 107 LEU H2 H N N 108 LEU HA H N N 109 LEU HB2 H N N 110 LEU HB3 H N N 111 LEU HG H N N 112 LEU HD11 H N N 113 LEU HD12 H N N 114 LEU HD13 H N N 115 LEU HD21 H N N 116 LEU HD22 H N N 117 LEU HD23 H N N 118 LEU HXT H N N 119 LYS N N N N 120 LYS CA C N S 121 LYS C C N N 122 LYS O O N N 123 LYS CB C N N 124 LYS CG C N N 125 LYS CD C N N 126 LYS CE C N N 127 LYS NZ N N N 128 LYS OXT O N N 129 LYS H H N N 130 LYS H2 H N N 131 LYS HA H N N 132 LYS HB2 H N N 133 LYS HB3 H N N 134 LYS HG2 H N N 135 LYS HG3 H N N 136 LYS HD2 H N N 137 LYS HD3 H N N 138 LYS HE2 H N N 139 LYS HE3 H N N 140 LYS HZ1 H N N 141 LYS HZ2 H N N 142 LYS HZ3 H N N 143 LYS HXT H N N 144 PHE N N N N 145 PHE CA C N S 146 PHE C C N N 147 PHE O O N N 148 PHE CB C N N 149 PHE CG C Y N 150 PHE CD1 C Y N 151 PHE CD2 C Y N 152 PHE CE1 C Y N 153 PHE CE2 C Y N 154 PHE CZ C Y N 155 PHE OXT O N N 156 PHE H H N N 157 PHE H2 H N N 158 PHE HA H N N 159 PHE HB2 H N N 160 PHE HB3 H N N 161 PHE HD1 H N N 162 PHE HD2 H N N 163 PHE HE1 H N N 164 PHE HE2 H N N 165 PHE HZ H N N 166 PHE HXT H N N 167 SER N N N N 168 SER CA C N S 169 SER C C N N 170 SER O O N N 171 SER CB C N N 172 SER OG O N N 173 SER OXT O N N 174 SER H H N N 175 SER H2 H N N 176 SER HA H N N 177 SER HB2 H N N 178 SER HB3 H N N 179 SER HG H N N 180 SER HXT H N N 181 THR N N N N 182 THR CA C N S 183 THR C C N N 184 THR O O N N 185 THR CB C N R 186 THR OG1 O N N 187 THR CG2 C N N 188 THR OXT O N N 189 THR H H N N 190 THR H2 H N N 191 THR HA H N N 192 THR HB H N N 193 THR HG1 H N N 194 THR HG21 H N N 195 THR HG22 H N N 196 THR HG23 H N N 197 THR HXT H N N 198 TRP N N N N 199 TRP CA C N S 200 TRP C C N N 201 TRP O O N N 202 TRP CB C N N 203 TRP CG C Y N 204 TRP CD1 C Y N 205 TRP CD2 C Y N 206 TRP NE1 N Y N 207 TRP CE2 C Y N 208 TRP CE3 C Y N 209 TRP CZ2 C Y N 210 TRP CZ3 C Y N 211 TRP CH2 C Y N 212 TRP OXT O N N 213 TRP H H N N 214 TRP H2 H N N 215 TRP HA H N N 216 TRP HB2 H N N 217 TRP HB3 H N N 218 TRP HD1 H N N 219 TRP HE1 H N N 220 TRP HE3 H N N 221 TRP HZ2 H N N 222 TRP HZ3 H N N 223 TRP HH2 H N N 224 TRP HXT H N N 225 TYR N N N N 226 TYR CA C N S 227 TYR C C N N 228 TYR O O N N 229 TYR CB C N N 230 TYR CG C Y N 231 TYR CD1 C Y N 232 TYR CD2 C Y N 233 TYR CE1 C Y N 234 TYR CE2 C Y N 235 TYR CZ C Y N 236 TYR OH O N N 237 TYR OXT O N N 238 TYR H H N N 239 TYR H2 H N N 240 TYR HA H N N 241 TYR HB2 H N N 242 TYR HB3 H N N 243 TYR HD1 H N N 244 TYR HD2 H N N 245 TYR HE1 H N N 246 TYR HE2 H N N 247 TYR HH H N N 248 TYR HXT H N N 249 VAL N N N N 250 VAL CA C N S 251 VAL C C N N 252 VAL O O N N 253 VAL CB C N N 254 VAL CG1 C N N 255 VAL CG2 C N N 256 VAL OXT O N N 257 VAL H H N N 258 VAL H2 H N N 259 VAL HA H N N 260 VAL HB H N N 261 VAL HG11 H N N 262 VAL HG12 H N N 263 VAL HG13 H N N 264 VAL HG21 H N N 265 VAL HG22 H N N 266 VAL HG23 H N N 267 VAL HXT H N N 268 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLU N CA sing N N 44 GLU N H sing N N 45 GLU N H2 sing N N 46 GLU CA C sing N N 47 GLU CA CB sing N N 48 GLU CA HA sing N N 49 GLU C O doub N N 50 GLU C OXT sing N N 51 GLU CB CG sing N N 52 GLU CB HB2 sing N N 53 GLU CB HB3 sing N N 54 GLU CG CD sing N N 55 GLU CG HG2 sing N N 56 GLU CG HG3 sing N N 57 GLU CD OE1 doub N N 58 GLU CD OE2 sing N N 59 GLU OE2 HE2 sing N N 60 GLU OXT HXT sing N N 61 GLY N CA sing N N 62 GLY N H sing N N 63 GLY N H2 sing N N 64 GLY CA C sing N N 65 GLY CA HA2 sing N N 66 GLY CA HA3 sing N N 67 GLY C O doub N N 68 GLY C OXT sing N N 69 GLY OXT HXT sing N N 70 ILE N CA sing N N 71 ILE N H sing N N 72 ILE N H2 sing N N 73 ILE CA C sing N N 74 ILE CA CB sing N N 75 ILE CA HA sing N N 76 ILE C O doub N N 77 ILE C OXT sing N N 78 ILE CB CG1 sing N N 79 ILE CB CG2 sing N N 80 ILE CB HB sing N N 81 ILE CG1 CD1 sing N N 82 ILE CG1 HG12 sing N N 83 ILE CG1 HG13 sing N N 84 ILE CG2 HG21 sing N N 85 ILE CG2 HG22 sing N N 86 ILE CG2 HG23 sing N N 87 ILE CD1 HD11 sing N N 88 ILE CD1 HD12 sing N N 89 ILE CD1 HD13 sing N N 90 ILE OXT HXT sing N N 91 LEU N CA sing N N 92 LEU N H sing N N 93 LEU N H2 sing N N 94 LEU CA C sing N N 95 LEU CA CB sing N N 96 LEU CA HA sing N N 97 LEU C O doub N N 98 LEU C OXT sing N N 99 LEU CB CG sing N N 100 LEU CB HB2 sing N N 101 LEU CB HB3 sing N N 102 LEU CG CD1 sing N N 103 LEU CG CD2 sing N N 104 LEU CG HG sing N N 105 LEU CD1 HD11 sing N N 106 LEU CD1 HD12 sing N N 107 LEU CD1 HD13 sing N N 108 LEU CD2 HD21 sing N N 109 LEU CD2 HD22 sing N N 110 LEU CD2 HD23 sing N N 111 LEU OXT HXT sing N N 112 LYS N CA sing N N 113 LYS N H sing N N 114 LYS N H2 sing N N 115 LYS CA C sing N N 116 LYS CA CB sing N N 117 LYS CA HA sing N N 118 LYS C O doub N N 119 LYS C OXT sing N N 120 LYS CB CG sing N N 121 LYS CB HB2 sing N N 122 LYS CB HB3 sing N N 123 LYS CG CD sing N N 124 LYS CG HG2 sing N N 125 LYS CG HG3 sing N N 126 LYS CD CE sing N N 127 LYS CD HD2 sing N N 128 LYS CD HD3 sing N N 129 LYS CE NZ sing N N 130 LYS CE HE2 sing N N 131 LYS CE HE3 sing N N 132 LYS NZ HZ1 sing N N 133 LYS NZ HZ2 sing N N 134 LYS NZ HZ3 sing N N 135 LYS OXT HXT sing N N 136 PHE N CA sing N N 137 PHE N H sing N N 138 PHE N H2 sing N N 139 PHE CA C sing N N 140 PHE CA CB sing N N 141 PHE CA HA sing N N 142 PHE C O doub N N 143 PHE C OXT sing N N 144 PHE CB CG sing N N 145 PHE CB HB2 sing N N 146 PHE CB HB3 sing N N 147 PHE CG CD1 doub Y N 148 PHE CG CD2 sing Y N 149 PHE CD1 CE1 sing Y N 150 PHE CD1 HD1 sing N N 151 PHE CD2 CE2 doub Y N 152 PHE CD2 HD2 sing N N 153 PHE CE1 CZ doub Y N 154 PHE CE1 HE1 sing N N 155 PHE CE2 CZ sing Y N 156 PHE CE2 HE2 sing N N 157 PHE CZ HZ sing N N 158 PHE OXT HXT sing N N 159 SER N CA sing N N 160 SER N H sing N N 161 SER N H2 sing N N 162 SER CA C sing N N 163 SER CA CB sing N N 164 SER CA HA sing N N 165 SER C O doub N N 166 SER C OXT sing N N 167 SER CB OG sing N N 168 SER CB HB2 sing N N 169 SER CB HB3 sing N N 170 SER OG HG sing N N 171 SER OXT HXT sing N N 172 THR N CA sing N N 173 THR N H sing N N 174 THR N H2 sing N N 175 THR CA C sing N N 176 THR CA CB sing N N 177 THR CA HA sing N N 178 THR C O doub N N 179 THR C OXT sing N N 180 THR CB OG1 sing N N 181 THR CB CG2 sing N N 182 THR CB HB sing N N 183 THR OG1 HG1 sing N N 184 THR CG2 HG21 sing N N 185 THR CG2 HG22 sing N N 186 THR CG2 HG23 sing N N 187 THR OXT HXT sing N N 188 TRP N CA sing N N 189 TRP N H sing N N 190 TRP N H2 sing N N 191 TRP CA C sing N N 192 TRP CA CB sing N N 193 TRP CA HA sing N N 194 TRP C O doub N N 195 TRP C OXT sing N N 196 TRP CB CG sing N N 197 TRP CB HB2 sing N N 198 TRP CB HB3 sing N N 199 TRP CG CD1 doub Y N 200 TRP CG CD2 sing Y N 201 TRP CD1 NE1 sing Y N 202 TRP CD1 HD1 sing N N 203 TRP CD2 CE2 doub Y N 204 TRP CD2 CE3 sing Y N 205 TRP NE1 CE2 sing Y N 206 TRP NE1 HE1 sing N N 207 TRP CE2 CZ2 sing Y N 208 TRP CE3 CZ3 doub Y N 209 TRP CE3 HE3 sing N N 210 TRP CZ2 CH2 doub Y N 211 TRP CZ2 HZ2 sing N N 212 TRP CZ3 CH2 sing Y N 213 TRP CZ3 HZ3 sing N N 214 TRP CH2 HH2 sing N N 215 TRP OXT HXT sing N N 216 TYR N CA sing N N 217 TYR N H sing N N 218 TYR N H2 sing N N 219 TYR CA C sing N N 220 TYR CA CB sing N N 221 TYR CA HA sing N N 222 TYR C O doub N N 223 TYR C OXT sing N N 224 TYR CB CG sing N N 225 TYR CB HB2 sing N N 226 TYR CB HB3 sing N N 227 TYR CG CD1 doub Y N 228 TYR CG CD2 sing Y N 229 TYR CD1 CE1 sing Y N 230 TYR CD1 HD1 sing N N 231 TYR CD2 CE2 doub Y N 232 TYR CD2 HD2 sing N N 233 TYR CE1 CZ doub Y N 234 TYR CE1 HE1 sing N N 235 TYR CE2 CZ sing Y N 236 TYR CE2 HE2 sing N N 237 TYR CZ OH sing N N 238 TYR OH HH sing N N 239 TYR OXT HXT sing N N 240 VAL N CA sing N N 241 VAL N H sing N N 242 VAL N H2 sing N N 243 VAL CA C sing N N 244 VAL CA CB sing N N 245 VAL CA HA sing N N 246 VAL C O doub N N 247 VAL C OXT sing N N 248 VAL CB CG1 sing N N 249 VAL CB CG2 sing N N 250 VAL CB HB sing N N 251 VAL CG1 HG11 sing N N 252 VAL CG1 HG12 sing N N 253 VAL CG1 HG13 sing N N 254 VAL CG2 HG21 sing N N 255 VAL CG2 HG22 sing N N 256 VAL CG2 HG23 sing N N 257 VAL OXT HXT sing N N 258 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' 800 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2N35 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_