data_2PH1 # _entry.id 2PH1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2PH1 RCSB RCSB042367 WWPDB D_1000042367 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id GR165 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2PH1 _pdbx_database_status.recvd_initial_deposition_date 2007-04-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Abashidze, M.' 2 'Seetharaman, J.' 3 'Janjua, H.' 4 'Fang, Y.' 5 'Xiao, R.' 6 'Liu, J.' 7 'Baran, M.C.' 8 'Acton, T.B.' 9 'Montelione, G.T.' 10 'Hunt, J.F.' 11 'Tong, L.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Crystal structure of nucleotide-binding protein AF2382 from Archaeoglobus fulgidus.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Forouhar, F.' 1 primary 'Abashidze, M.' 2 primary 'Seetharaman, J.' 3 primary 'Janjua, H.' 4 primary 'Fang, Y.' 5 primary 'Xiao, R.' 6 primary 'Liu, J.' 7 primary 'Baran, M.C.' 8 primary 'Acton, T.B.' 9 primary 'Montelione, G.T.' 10 primary 'Hunt, J.F.' 11 primary 'Tong, L.' 12 # _cell.entry_id 2PH1 _cell.length_a 66.937 _cell.length_b 78.186 _cell.length_c 49.597 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2PH1 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Nucleotide-binding protein' 29273.631 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 37 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)QKRVTDEEIKERLGKIKSRIAV(MSE)SGKGGVGKSTVTALLAVHYARQGKKVGILDADFLGPSIPILFGLRNAR IAVSAEGLEPVLTQKYGIKV(MSE)S(MSE)QFLLPKENTPVIWRGPLIAG(MSE)IREFLGRVAWGELDHLLIDLPPGT GDAPLTV(MSE)QDAKPTGVVVVSTPQELTAVIVEKAIN(MSE)AEETNTSVLGLVEN(MSE)SYFVCPNCGHKSYIFGE GKGESLAKKYNIGFFTSIPIEEELIKLADSGRIEEYEKDWFESAPFLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MQKRVTDEEIKERLGKIKSRIAVMSGKGGVGKSTVTALLAVHYARQGKKVGILDADFLGPSIPILFGLRNARIAVSAEGL EPVLTQKYGIKVMSMQFLLPKENTPVIWRGPLIAGMIREFLGRVAWGELDHLLIDLPPGTGDAPLTVMQDAKPTGVVVVS TPQELTAVIVEKAINMAEETNTSVLGLVENMSYFVCPNCGHKSYIFGEGKGESLAKKYNIGFFTSIPIEEELIKLADSGR IEEYEKDWFESAPFLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GR165 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLN n 1 3 LYS n 1 4 ARG n 1 5 VAL n 1 6 THR n 1 7 ASP n 1 8 GLU n 1 9 GLU n 1 10 ILE n 1 11 LYS n 1 12 GLU n 1 13 ARG n 1 14 LEU n 1 15 GLY n 1 16 LYS n 1 17 ILE n 1 18 LYS n 1 19 SER n 1 20 ARG n 1 21 ILE n 1 22 ALA n 1 23 VAL n 1 24 MSE n 1 25 SER n 1 26 GLY n 1 27 LYS n 1 28 GLY n 1 29 GLY n 1 30 VAL n 1 31 GLY n 1 32 LYS n 1 33 SER n 1 34 THR n 1 35 VAL n 1 36 THR n 1 37 ALA n 1 38 LEU n 1 39 LEU n 1 40 ALA n 1 41 VAL n 1 42 HIS n 1 43 TYR n 1 44 ALA n 1 45 ARG n 1 46 GLN n 1 47 GLY n 1 48 LYS n 1 49 LYS n 1 50 VAL n 1 51 GLY n 1 52 ILE n 1 53 LEU n 1 54 ASP n 1 55 ALA n 1 56 ASP n 1 57 PHE n 1 58 LEU n 1 59 GLY n 1 60 PRO n 1 61 SER n 1 62 ILE n 1 63 PRO n 1 64 ILE n 1 65 LEU n 1 66 PHE n 1 67 GLY n 1 68 LEU n 1 69 ARG n 1 70 ASN n 1 71 ALA n 1 72 ARG n 1 73 ILE n 1 74 ALA n 1 75 VAL n 1 76 SER n 1 77 ALA n 1 78 GLU n 1 79 GLY n 1 80 LEU n 1 81 GLU n 1 82 PRO n 1 83 VAL n 1 84 LEU n 1 85 THR n 1 86 GLN n 1 87 LYS n 1 88 TYR n 1 89 GLY n 1 90 ILE n 1 91 LYS n 1 92 VAL n 1 93 MSE n 1 94 SER n 1 95 MSE n 1 96 GLN n 1 97 PHE n 1 98 LEU n 1 99 LEU n 1 100 PRO n 1 101 LYS n 1 102 GLU n 1 103 ASN n 1 104 THR n 1 105 PRO n 1 106 VAL n 1 107 ILE n 1 108 TRP n 1 109 ARG n 1 110 GLY n 1 111 PRO n 1 112 LEU n 1 113 ILE n 1 114 ALA n 1 115 GLY n 1 116 MSE n 1 117 ILE n 1 118 ARG n 1 119 GLU n 1 120 PHE n 1 121 LEU n 1 122 GLY n 1 123 ARG n 1 124 VAL n 1 125 ALA n 1 126 TRP n 1 127 GLY n 1 128 GLU n 1 129 LEU n 1 130 ASP n 1 131 HIS n 1 132 LEU n 1 133 LEU n 1 134 ILE n 1 135 ASP n 1 136 LEU n 1 137 PRO n 1 138 PRO n 1 139 GLY n 1 140 THR n 1 141 GLY n 1 142 ASP n 1 143 ALA n 1 144 PRO n 1 145 LEU n 1 146 THR n 1 147 VAL n 1 148 MSE n 1 149 GLN n 1 150 ASP n 1 151 ALA n 1 152 LYS n 1 153 PRO n 1 154 THR n 1 155 GLY n 1 156 VAL n 1 157 VAL n 1 158 VAL n 1 159 VAL n 1 160 SER n 1 161 THR n 1 162 PRO n 1 163 GLN n 1 164 GLU n 1 165 LEU n 1 166 THR n 1 167 ALA n 1 168 VAL n 1 169 ILE n 1 170 VAL n 1 171 GLU n 1 172 LYS n 1 173 ALA n 1 174 ILE n 1 175 ASN n 1 176 MSE n 1 177 ALA n 1 178 GLU n 1 179 GLU n 1 180 THR n 1 181 ASN n 1 182 THR n 1 183 SER n 1 184 VAL n 1 185 LEU n 1 186 GLY n 1 187 LEU n 1 188 VAL n 1 189 GLU n 1 190 ASN n 1 191 MSE n 1 192 SER n 1 193 TYR n 1 194 PHE n 1 195 VAL n 1 196 CYS n 1 197 PRO n 1 198 ASN n 1 199 CYS n 1 200 GLY n 1 201 HIS n 1 202 LYS n 1 203 SER n 1 204 TYR n 1 205 ILE n 1 206 PHE n 1 207 GLY n 1 208 GLU n 1 209 GLY n 1 210 LYS n 1 211 GLY n 1 212 GLU n 1 213 SER n 1 214 LEU n 1 215 ALA n 1 216 LYS n 1 217 LYS n 1 218 TYR n 1 219 ASN n 1 220 ILE n 1 221 GLY n 1 222 PHE n 1 223 PHE n 1 224 THR n 1 225 SER n 1 226 ILE n 1 227 PRO n 1 228 ILE n 1 229 GLU n 1 230 GLU n 1 231 GLU n 1 232 LEU n 1 233 ILE n 1 234 LYS n 1 235 LEU n 1 236 ALA n 1 237 ASP n 1 238 SER n 1 239 GLY n 1 240 ARG n 1 241 ILE n 1 242 GLU n 1 243 GLU n 1 244 TYR n 1 245 GLU n 1 246 LYS n 1 247 ASP n 1 248 TRP n 1 249 PHE n 1 250 GLU n 1 251 SER n 1 252 ALA n 1 253 PRO n 1 254 PHE n 1 255 LEU n 1 256 GLU n 1 257 HIS n 1 258 HIS n 1 259 HIS n 1 260 HIS n 1 261 HIS n 1 262 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Archaeoglobus _entity_src_gen.pdbx_gene_src_gene AF_2382 _entity_src_gen.gene_src_species 'Archaeoglobus fulgidus' _entity_src_gen.gene_src_strain 'DSM 4304, VC-16, JCM 9628, NBRC 100126' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Archaeoglobus fulgidus DSM 4304' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224325 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 49558 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector BL21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O30288_ARCFU _struct_ref.pdbx_db_accession O30288 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQKRVTDEEIKERLGKIKSRIAVMSGKGGVGKSTVTALLAVHYARQGKKVGILDADFLGPSIPILFGLRNARIAVSAEGL EPVLTQKYGIKVMSMQFLLPKENTPVIWRGPLIAGMIREFLGRVAWGELDHLLIDLPPGTGDAPLTVMQDAKPTGVVVVS TPQELTAVIVEKAINMAEETNTSVLGLVENMSYFVCPNCGHKSYIFGEGKGESLAKKYNIGFFTSIPIEEELIKLADSGR IEEYEKDWFESAPF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2PH1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 254 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O30288 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 254 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 254 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2PH1 MSE A 1 ? UNP O30288 MET 1 'MODIFIED RESIDUE' 1 1 1 2PH1 MSE A 24 ? UNP O30288 MET 24 'MODIFIED RESIDUE' 24 2 1 2PH1 MSE A 93 ? UNP O30288 MET 93 'MODIFIED RESIDUE' 93 3 1 2PH1 MSE A 95 ? UNP O30288 MET 95 'MODIFIED RESIDUE' 95 4 1 2PH1 MSE A 116 ? UNP O30288 MET 116 'MODIFIED RESIDUE' 116 5 1 2PH1 MSE A 148 ? UNP O30288 MET 148 'MODIFIED RESIDUE' 148 6 1 2PH1 MSE A 176 ? UNP O30288 MET 176 'MODIFIED RESIDUE' 176 7 1 2PH1 MSE A 191 ? UNP O30288 MET 191 'MODIFIED RESIDUE' 191 8 1 2PH1 LEU A 255 ? UNP O30288 ? ? 'CLONING ARTIFACT' 255 9 1 2PH1 GLU A 256 ? UNP O30288 ? ? 'CLONING ARTIFACT' 256 10 1 2PH1 HIS A 257 ? UNP O30288 ? ? 'CLONING ARTIFACT' 257 11 1 2PH1 HIS A 258 ? UNP O30288 ? ? 'CLONING ARTIFACT' 258 12 1 2PH1 HIS A 259 ? UNP O30288 ? ? 'CLONING ARTIFACT' 259 13 1 2PH1 HIS A 260 ? UNP O30288 ? ? 'CLONING ARTIFACT' 260 14 1 2PH1 HIS A 261 ? UNP O30288 ? ? 'CLONING ARTIFACT' 261 15 1 2PH1 HIS A 262 ? UNP O30288 ? ? 'CLONING ARTIFACT' 262 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2PH1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_percent_sol 44.49 _exptl_crystal.description 'THE STRUCTURE FACTOR FILE CONTAINS FRIEDEL PAIRS' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'MICROBATCH UNDER OIL' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details ;Protein solution: 20 mM Tris-HCl pH 7.5, 100 mM Sodium chloride, 5 mM DTT. Precipitant solution: 100 mM HEPES pH 7.5, 55% MPD, MICROBATCH UNDER OIL, temperature 293K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2007-03-27 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97950 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97950 # _reflns.entry_id 2PH1 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 49.60 _reflns.d_resolution_high 2.7 _reflns.number_obs 13903 _reflns.number_all 13903 _reflns.percent_possible_obs 100 _reflns.pdbx_Rmerge_I_obs 0.086 _reflns.pdbx_Rsym_value 0.079 _reflns.pdbx_netI_over_sigmaI 18.54 _reflns.B_iso_Wilson_estimate 35.1 _reflns.pdbx_redundancy 5.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.80 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.413 _reflns_shell.pdbx_Rsym_value 0.344 _reflns_shell.meanI_over_sigI_obs 5.08 _reflns_shell.pdbx_redundancy 5.0 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1539 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2PH1 _refine.ls_number_reflns_obs 12442 _refine.ls_number_reflns_all 13903 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 112851.27 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 49.60 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 90.1 _refine.ls_R_factor_obs 0.217 _refine.ls_R_factor_all 0.218 _refine.ls_R_factor_R_work 0.217 _refine.ls_R_factor_R_free 0.278 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.7 _refine.ls_number_reflns_R_free 1211 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 39.0 _refine.aniso_B[1][1] -15.84 _refine.aniso_B[2][2] 14.77 _refine.aniso_B[3][3] 1.07 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.296708 _refine.solvent_model_param_bsol 24.7637 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'XtalView has also been used in the refinement. THE FRIEDEL PAIRS WERE USED FOR PHASING' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model OVERALL _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2PH1 _refine_analyze.Luzzati_coordinate_error_obs 0.31 _refine_analyze.Luzzati_sigma_a_obs 0.33 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.46 _refine_analyze.Luzzati_sigma_a_free 0.51 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1898 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 37 _refine_hist.number_atoms_total 1936 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 49.60 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.95 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 2.80 _refine_ls_shell.number_reflns_R_work 948 _refine_ls_shell.R_factor_R_work 0.271 _refine_ls_shell.percent_reflns_obs 76.4 _refine_ls_shell.R_factor_R_free 0.357 _refine_ls_shell.R_factor_R_free_error 0.035 _refine_ls_shell.percent_reflns_R_free 9.9 _refine_ls_shell.number_reflns_R_free 104 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 948 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2PH1 _struct.title 'Crystal structure of nucleotide-binding protein AF2382 from Archaeoglobus fulgidus, Northeast Structural Genomics Target GR165' _struct.pdbx_descriptor 'Nucleotide-binding protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2PH1 _struct_keywords.pdbx_keywords 'LIGAND BINDING PROTEIN' _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, LIGAND BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? GLY A 15 ? THR A 6 GLY A 15 1 ? 10 HELX_P HELX_P2 2 GLY A 31 ? GLN A 46 ? GLY A 31 GLN A 46 1 ? 16 HELX_P HELX_P3 3 PRO A 60 ? PHE A 66 ? PRO A 60 PHE A 66 1 ? 7 HELX_P HELX_P4 4 SER A 94 ? LEU A 99 ? SER A 94 LEU A 99 5 ? 6 HELX_P HELX_P5 5 GLY A 110 ? ARG A 123 ? GLY A 110 ARG A 123 1 ? 14 HELX_P HELX_P6 6 ASP A 142 ? LYS A 152 ? ASP A 142 LYS A 152 1 ? 11 HELX_P HELX_P7 7 THR A 166 ? GLU A 179 ? THR A 166 GLU A 179 1 ? 14 HELX_P HELX_P8 8 LYS A 210 ? TYR A 218 ? LYS A 210 TYR A 218 1 ? 9 HELX_P HELX_P9 9 GLU A 229 ? SER A 238 ? GLU A 229 SER A 238 1 ? 10 HELX_P HELX_P10 10 ARG A 240 ? TYR A 244 ? ARG A 240 TYR A 244 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A VAL 23 C ? ? ? 1_555 A MSE 24 N ? ? A VAL 23 A MSE 24 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? A MSE 24 C ? ? ? 1_555 A SER 25 N ? ? A MSE 24 A SER 25 1_555 ? ? ? ? ? ? ? 1.331 ? covale3 covale ? ? A VAL 92 C ? ? ? 1_555 A MSE 93 N ? ? A VAL 92 A MSE 93 1_555 ? ? ? ? ? ? ? 1.321 ? covale4 covale ? ? A MSE 93 C ? ? ? 1_555 A SER 94 N ? ? A MSE 93 A SER 94 1_555 ? ? ? ? ? ? ? 1.333 ? covale5 covale ? ? A SER 94 C ? ? ? 1_555 A MSE 95 N ? ? A SER 94 A MSE 95 1_555 ? ? ? ? ? ? ? 1.328 ? covale6 covale ? ? A MSE 95 C ? ? ? 1_555 A GLN 96 N ? ? A MSE 95 A GLN 96 1_555 ? ? ? ? ? ? ? 1.329 ? covale7 covale ? ? A GLY 115 C ? ? ? 1_555 A MSE 116 N ? ? A GLY 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.330 ? covale8 covale ? ? A MSE 116 C ? ? ? 1_555 A ILE 117 N ? ? A MSE 116 A ILE 117 1_555 ? ? ? ? ? ? ? 1.324 ? covale9 covale ? ? A VAL 147 C ? ? ? 1_555 A MSE 148 N ? ? A VAL 147 A MSE 148 1_555 ? ? ? ? ? ? ? 1.322 ? covale10 covale ? ? A MSE 148 C ? ? ? 1_555 A GLN 149 N ? ? A MSE 148 A GLN 149 1_555 ? ? ? ? ? ? ? 1.328 ? covale11 covale ? ? A ASN 175 C ? ? ? 1_555 A MSE 176 N ? ? A ASN 175 A MSE 176 1_555 ? ? ? ? ? ? ? 1.326 ? covale12 covale ? ? A MSE 176 C ? ? ? 1_555 A ALA 177 N ? ? A MSE 176 A ALA 177 1_555 ? ? ? ? ? ? ? 1.333 ? covale13 covale ? ? A ASN 190 C ? ? ? 1_555 A MSE 191 N ? ? A ASN 190 A MSE 191 1_555 ? ? ? ? ? ? ? 1.330 ? covale14 covale ? ? A MSE 191 C ? ? ? 1_555 A SER 192 N ? ? A MSE 191 A SER 192 1_555 ? ? ? ? ? ? ? 1.323 ? metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 199 SG ? ? A ZN 301 A CYS 199 1_555 ? ? ? ? ? ? ? 2.550 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 196 SG ? ? A ZN 301 A CYS 196 1_555 ? ? ? ? ? ? ? 2.535 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 199 SG ? ? A ZN 301 A CYS 199 2_655 ? ? ? ? ? ? ? 2.526 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 196 SG ? ? A ZN 301 A CYS 196 2_655 ? ? ? ? ? ? ? 2.616 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel A 7 8 ? parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 83 ? LEU A 84 ? VAL A 83 LEU A 84 A 2 LYS A 91 ? MSE A 93 ? LYS A 91 MSE A 93 A 3 VAL A 50 ? ASP A 54 ? VAL A 50 ASP A 54 A 4 HIS A 131 ? ASP A 135 ? HIS A 131 ASP A 135 A 5 ARG A 20 ? MSE A 24 ? ARG A 20 MSE A 24 A 6 GLY A 155 ? SER A 160 ? GLY A 155 SER A 160 A 7 VAL A 184 ? GLU A 189 ? VAL A 184 GLU A 189 A 8 PHE A 222 ? SER A 225 ? PHE A 222 SER A 225 B 1 ALA A 74 ? SER A 76 ? ALA A 74 SER A 76 B 2 GLY A 79 ? GLU A 81 ? GLY A 79 GLU A 81 C 1 PHE A 194 ? VAL A 195 ? PHE A 194 VAL A 195 C 2 LYS A 202 ? SER A 203 ? LYS A 202 SER A 203 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 83 ? N VAL A 83 O VAL A 92 ? O VAL A 92 A 2 3 O MSE A 93 ? O MSE A 93 N ASP A 54 ? N ASP A 54 A 3 4 N GLY A 51 ? N GLY A 51 O LEU A 133 ? O LEU A 133 A 4 5 O ILE A 134 ? O ILE A 134 N VAL A 23 ? N VAL A 23 A 5 6 N ALA A 22 ? N ALA A 22 O VAL A 157 ? O VAL A 157 A 6 7 N VAL A 156 ? N VAL A 156 O LEU A 185 ? O LEU A 185 A 7 8 N GLU A 189 ? N GLU A 189 O THR A 224 ? O THR A 224 B 1 2 N ALA A 74 ? N ALA A 74 O GLU A 81 ? O GLU A 81 C 1 2 N PHE A 194 ? N PHE A 194 O SER A 203 ? O SER A 203 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 196 ? CYS A 196 . ? 1_555 ? 2 AC1 4 CYS A 196 ? CYS A 196 . ? 2_655 ? 3 AC1 4 CYS A 199 ? CYS A 199 . ? 1_555 ? 4 AC1 4 CYS A 199 ? CYS A 199 . ? 2_655 ? # _database_PDB_matrix.entry_id 2PH1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2PH1 _atom_sites.fract_transf_matrix[1][1] 0.014939 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012790 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020163 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLN 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 MSE 24 24 24 MSE MSE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 MSE 93 93 93 MSE MSE A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 MSE 95 95 95 MSE MSE A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 MSE 116 116 116 MSE MSE A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 MSE 148 148 148 MSE MSE A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 MSE 176 176 176 MSE MSE A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 MSE 191 191 191 MSE MSE A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 CYS 196 196 196 CYS CYS A . n A 1 197 PRO 197 197 197 PRO PRO A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 CYS 199 199 199 CYS CYS A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 HIS 201 201 201 HIS HIS A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 TYR 204 204 204 TYR TYR A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 PHE 206 206 206 PHE PHE A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 ASN 219 219 219 ASN ASN A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 PHE 222 222 222 PHE PHE A . n A 1 223 PHE 223 223 223 PHE PHE A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 SER 225 225 225 SER SER A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 LYS 234 234 234 LYS LYS A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 ARG 240 240 240 ARG ARG A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 TYR 244 244 244 TYR TYR A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 ASP 247 247 247 ASP ASP A . n A 1 248 TRP 248 248 248 TRP TRP A . n A 1 249 PHE 249 249 249 PHE PHE A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 SER 251 251 ? ? ? A . n A 1 252 ALA 252 252 ? ? ? A . n A 1 253 PRO 253 253 ? ? ? A . n A 1 254 PHE 254 254 ? ? ? A . n A 1 255 LEU 255 255 ? ? ? A . n A 1 256 GLU 256 256 ? ? ? A . n A 1 257 HIS 257 257 ? ? ? A . n A 1 258 HIS 258 258 ? ? ? A . n A 1 259 HIS 259 259 ? ? ? A . n A 1 260 HIS 260 260 ? ? ? A . n A 1 261 HIS 261 261 ? ? ? A . n A 1 262 HIS 262 262 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 301 ZN ZN A . C 3 HOH 1 302 1 HOH HOH A . C 3 HOH 2 303 2 HOH HOH A . C 3 HOH 3 304 3 HOH HOH A . C 3 HOH 4 305 4 HOH HOH A . C 3 HOH 5 306 5 HOH HOH A . C 3 HOH 6 307 6 HOH HOH A . C 3 HOH 7 308 7 HOH HOH A . C 3 HOH 8 309 8 HOH HOH A . C 3 HOH 9 310 9 HOH HOH A . C 3 HOH 10 311 10 HOH HOH A . C 3 HOH 11 312 11 HOH HOH A . C 3 HOH 12 313 12 HOH HOH A . C 3 HOH 13 314 13 HOH HOH A . C 3 HOH 14 315 14 HOH HOH A . C 3 HOH 15 316 15 HOH HOH A . C 3 HOH 16 317 16 HOH HOH A . C 3 HOH 17 318 17 HOH HOH A . C 3 HOH 18 319 18 HOH HOH A . C 3 HOH 19 320 19 HOH HOH A . C 3 HOH 20 321 20 HOH HOH A . C 3 HOH 21 322 21 HOH HOH A . C 3 HOH 22 323 22 HOH HOH A . C 3 HOH 23 324 23 HOH HOH A . C 3 HOH 24 325 24 HOH HOH A . C 3 HOH 25 326 25 HOH HOH A . C 3 HOH 26 327 26 HOH HOH A . C 3 HOH 27 328 27 HOH HOH A . C 3 HOH 28 329 28 HOH HOH A . C 3 HOH 29 330 29 HOH HOH A . C 3 HOH 30 331 30 HOH HOH A . C 3 HOH 31 332 31 HOH HOH A . C 3 HOH 32 333 32 HOH HOH A . C 3 HOH 33 334 33 HOH HOH A . C 3 HOH 34 335 34 HOH HOH A . C 3 HOH 35 336 35 HOH HOH A . C 3 HOH 36 337 36 HOH HOH A . C 3 HOH 37 338 37 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 24 A MSE 24 ? MET SELENOMETHIONINE 2 A MSE 93 A MSE 93 ? MET SELENOMETHIONINE 3 A MSE 95 A MSE 95 ? MET SELENOMETHIONINE 4 A MSE 116 A MSE 116 ? MET SELENOMETHIONINE 5 A MSE 148 A MSE 148 ? MET SELENOMETHIONINE 6 A MSE 176 A MSE 176 ? MET SELENOMETHIONINE 7 A MSE 191 A MSE 191 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PQS monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C 2 1 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1500 ? 1 MORE -73 ? 1 'SSA (A^2)' 22390 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 66.9370000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id ZN _pdbx_struct_special_symmetry.auth_seq_id 301 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id ZN _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 199 ? A CYS 199 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 196 ? A CYS 196 ? 1_555 113.3 ? 2 SG ? A CYS 199 ? A CYS 199 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 199 ? A CYS 199 ? 2_655 98.3 ? 3 SG ? A CYS 196 ? A CYS 196 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 199 ? A CYS 199 ? 2_655 119.3 ? 4 SG ? A CYS 199 ? A CYS 199 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 196 ? A CYS 196 ? 2_655 115.4 ? 5 SG ? A CYS 196 ? A CYS 196 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 196 ? A CYS 196 ? 2_655 100.0 ? 6 SG ? A CYS 199 ? A CYS 199 ? 2_655 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 196 ? A CYS 196 ? 2_655 111.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-24 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 ADSC 'data collection' QUANTUM ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 SnB phasing . ? 5 RESOLVE phasing . ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 109 ? ? -64.62 -155.04 2 1 LEU A 112 ? ? -77.69 23.28 3 1 GLU A 128 ? ? -93.06 35.92 4 1 GLU A 164 ? ? -99.24 41.57 5 1 THR A 180 ? ? -150.10 21.94 6 1 ASN A 219 ? ? 35.27 65.69 7 1 GLU A 245 ? ? -83.30 42.45 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLN 2 ? A GLN 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A SER 251 ? A SER 251 5 1 Y 1 A ALA 252 ? A ALA 252 6 1 Y 1 A PRO 253 ? A PRO 253 7 1 Y 1 A PHE 254 ? A PHE 254 8 1 Y 1 A LEU 255 ? A LEU 255 9 1 Y 1 A GLU 256 ? A GLU 256 10 1 Y 1 A HIS 257 ? A HIS 257 11 1 Y 1 A HIS 258 ? A HIS 258 12 1 Y 1 A HIS 259 ? A HIS 259 13 1 Y 1 A HIS 260 ? A HIS 260 14 1 Y 1 A HIS 261 ? A HIS 261 15 1 Y 1 A HIS 262 ? A HIS 262 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH #