data_2PTA # _entry.id 2PTA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2PTA WWPDB D_1000178507 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2PTA _pdbx_database_status.recvd_initial_deposition_date 1996-11-26 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tenenholz, T.C.' 1 'Rogowski, R.S.' 2 'Collins, J.H.' 3 'Blaustein, M.P.' 4 'Weber, D.J.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure for Pandinus toxin K-alpha (PiTX-K alpha), a selective blocker of A-type potassium channels.' Biochemistry 36 2763 2771 1997 BICHAW US 0006-2960 0033 ? 9062103 10.1021/bi9628432 1 'Three New Toxins from the Scorpion Pandinus Imperator Selectively Block Certain Voltage-Gated K+ Channels' Mol.Pharmacol. 50 1167 ? 1996 MOPMA3 US 0026-895X 0197 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Tenenholz, T.C.' 1 primary 'Rogowski, R.S.' 2 primary 'Collins, J.H.' 3 primary 'Blaustein, M.P.' 4 primary 'Weber, D.J.' 5 1 'Rogowski, R.S.' 6 1 'Collins, J.H.' 7 1 ;O'Neill, T.J. ; 8 1 'Gustafson, T.A.' 9 1 'Werkman, T.R.' 10 1 'Rogawski, M.A.' 11 1 'Tenenholz, T.C.' 12 1 'Weber, D.J.' 13 1 'Blaustein, M.P.' 14 # _cell.entry_id 2PTA _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2PTA _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PANDINUS TOXIN K-ALPHA' _entity.formula_weight 4048.825 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'COMPLETE PEPTIDE' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PITX-KA, A-KTX5.1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR _entity_poly.pdbx_seq_one_letter_code_can TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ILE n 1 3 SER n 1 4 CYS n 1 5 THR n 1 6 ASN n 1 7 PRO n 1 8 LYS n 1 9 GLN n 1 10 CYS n 1 11 TYR n 1 12 PRO n 1 13 HIS n 1 14 CYS n 1 15 LYS n 1 16 LYS n 1 17 GLU n 1 18 THR n 1 19 GLY n 1 20 TYR n 1 21 PRO n 1 22 ASN n 1 23 ALA n 1 24 LYS n 1 25 CYS n 1 26 MET n 1 27 ASN n 1 28 ARG n 1 29 LYS n 1 30 CYS n 1 31 LYS n 1 32 CYS n 1 33 PHE n 1 34 GLY n 1 35 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'emperor scorpion' _entity_src_gen.gene_src_genus Pandinus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pandinus imperator' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 55084 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PSR9 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCKA_PANIM _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P55927 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code RGSVDYKDDDDKTISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2PTA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55927 _struct_ref_seq.db_align_beg 13 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 47 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 38 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 ROESY 1 3 1 TOCSY 1 4 1 DQF-COSY 1 5 1 'AND P.E.COSY' 1 6 1 Y 1 7 1 TOCSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 3.45 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX-600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600.13 # _pdbx_nmr_refine.entry_id 2PTA _pdbx_nmr_refine.method 'DISTANCE GEOMETRY SIMULATED ANNEALING' _pdbx_nmr_refine.details '295 NOE DISTANCE CONSTRAINTS, 9 H-BONDS, 9 CHI ANGLE CONSTRAINTS.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2PTA _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'NO DISTANCE VIOLATIONS GREATER THAN 0.30 ANGSTROMS, NO ANGULAR VIOLATIONS > 5 DEG, TOTAL ENERGY < 120 KCAL/MOL' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 2PTA _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2PTA _struct.title 'PANDINUS TOXIN K-A (PITX-KA) FROM PANDINUS IMPERATOR, NMR, 20 STRUCTURES' _struct.pdbx_descriptor 'PANDINUS TOXIN K-ALPHA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2PTA _struct_keywords.pdbx_keywords NEUROTOXIN _struct_keywords.text 'NEUROTOXIN, POTASSIUM CHANNEL BLOCKERS, NMR SOLUTION STRUCTURE, ALPHA-K TOXIN FAMILY, SCORPION TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 18 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 11 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 21 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 7 A CYS 28 1_555 ? ? ? ? ? ? ? 2.021 ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 13 A CYS 33 1_555 ? ? ? ? ? ? ? 2.021 ? disulf3 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 17 A CYS 35 1_555 ? ? ? ? ? ? ? 2.017 ? hydrog1 hydrog ? ? A GLN 9 O ? ? ? 1_555 A HIS 13 N ? ? A GLN 12 A HIS 16 1_555 ? ? ? ? ? ? ? ? ? hydrog2 hydrog ? ? A CYS 10 O ? ? ? 1_555 A CYS 14 N ? ? A CYS 13 A CYS 17 1_555 ? ? ? ? ? ? ? ? ? hydrog3 hydrog ? ? A TYR 11 O ? ? ? 1_555 A LYS 15 N ? ? A TYR 14 A LYS 18 1_555 ? ? ? ? ? ? ? ? ? hydrog4 hydrog ? ? A CYS 14 O ? ? ? 1_555 A THR 18 N ? ? A CYS 17 A THR 21 1_555 ? ? ? ? ? ? ? ? ? hydrog5 hydrog ? ? A LYS 31 O ? ? ? 1_555 A LYS 24 N ? ? A LYS 34 A LYS 27 1_555 ? ? ? ? ? ? ? ? ? hydrog6 hydrog ? ? A LYS 24 O ? ? ? 1_555 A LYS 31 N ? ? A LYS 27 A LYS 34 1_555 ? ? ? ? ? ? ? ? ? hydrog7 hydrog ? ? A LYS 29 O ? ? ? 1_555 A MET 26 N ? ? A LYS 32 A MET 29 1_555 ? ? ? ? ? ? ? ? ? hydrog8 hydrog ? ? A MET 26 O ? ? ? 1_555 A LYS 29 N ? ? A MET 29 A LYS 32 1_555 ? ? ? ? ? ? ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? hydrog ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 23 ? CYS A 25 ? ALA A 26 CYS A 28 A 2 CYS A 30 ? CYS A 32 ? CYS A 33 CYS A 35 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 31 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 34 # _database_PDB_matrix.entry_id 2PTA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2PTA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 4 4 THR THR A . n A 1 2 ILE 2 5 5 ILE ILE A . n A 1 3 SER 3 6 6 SER SER A . n A 1 4 CYS 4 7 7 CYS CYS A . n A 1 5 THR 5 8 8 THR THR A . n A 1 6 ASN 6 9 9 ASN ASN A . n A 1 7 PRO 7 10 10 PRO PRO A . n A 1 8 LYS 8 11 11 LYS LYS A . n A 1 9 GLN 9 12 12 GLN GLN A . n A 1 10 CYS 10 13 13 CYS CYS A . n A 1 11 TYR 11 14 14 TYR TYR A . n A 1 12 PRO 12 15 15 PRO PRO A . n A 1 13 HIS 13 16 16 HIS HIS A . n A 1 14 CYS 14 17 17 CYS CYS A . n A 1 15 LYS 15 18 18 LYS LYS A . n A 1 16 LYS 16 19 19 LYS LYS A . n A 1 17 GLU 17 20 20 GLU GLU A . n A 1 18 THR 18 21 21 THR THR A . n A 1 19 GLY 19 22 22 GLY GLY A . n A 1 20 TYR 20 23 23 TYR TYR A . n A 1 21 PRO 21 24 24 PRO PRO A . n A 1 22 ASN 22 25 25 ASN ASN A . n A 1 23 ALA 23 26 26 ALA ALA A . n A 1 24 LYS 24 27 27 LYS LYS A . n A 1 25 CYS 25 28 28 CYS CYS A . n A 1 26 MET 26 29 29 MET MET A . n A 1 27 ASN 27 30 30 ASN ASN A . n A 1 28 ARG 28 31 31 ARG ARG A . n A 1 29 LYS 29 32 32 LYS LYS A . n A 1 30 CYS 30 33 33 CYS CYS A . n A 1 31 LYS 31 34 34 LYS LYS A . n A 1 32 CYS 32 35 35 CYS CYS A . n A 1 33 PHE 33 36 36 PHE PHE A . n A 1 34 GLY 34 37 37 GLY GLY A . n A 1 35 ARG 35 38 38 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-12-10 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 25 ? ? -62.11 89.93 2 1 ASN A 30 ? ? -50.32 90.92 3 1 PHE A 36 ? ? -96.41 43.70 4 2 ASN A 30 ? ? -52.33 89.94 5 3 CYS A 7 ? ? 175.95 100.84 6 3 ASN A 30 ? ? 39.40 52.28 7 3 PHE A 36 ? ? -152.97 79.52 8 4 ILE A 5 ? ? -56.97 171.09 9 4 ALA A 26 ? ? 174.62 161.64 10 4 PHE A 36 ? ? -105.60 55.56 11 5 CYS A 35 ? ? -47.14 150.22 12 5 PHE A 36 ? ? -96.69 43.00 13 6 GLU A 20 ? ? -128.93 -64.81 14 6 ASN A 30 ? ? 38.18 55.45 15 7 PHE A 36 ? ? -88.44 47.42 16 8 ASN A 30 ? ? 38.37 53.17 17 8 ARG A 31 ? ? 83.36 29.84 18 8 PHE A 36 ? ? -94.51 49.07 19 9 CYS A 7 ? ? -164.22 -44.67 20 9 THR A 8 ? ? 59.00 17.22 21 9 GLU A 20 ? ? -121.49 -63.53 22 9 ASN A 30 ? ? 38.88 71.22 23 9 PHE A 36 ? ? -87.50 45.33 24 11 ASN A 30 ? ? -47.94 90.36 25 12 CYS A 7 ? ? -131.33 -43.76 26 12 ASN A 9 ? ? 174.82 165.32 27 12 ASN A 30 ? ? 40.77 80.73 28 12 PHE A 36 ? ? -119.72 62.77 29 13 ASN A 25 ? ? -63.98 87.95 30 13 ASN A 30 ? ? 37.82 45.97 31 13 ARG A 31 ? ? 78.48 40.63 32 14 SER A 6 ? ? -117.04 75.15 33 14 MET A 29 ? ? -176.17 116.50 34 14 ASN A 30 ? ? 38.67 59.45 35 14 PHE A 36 ? ? -100.07 55.48 36 15 CYS A 33 ? ? -49.18 155.42 37 15 PHE A 36 ? ? -96.24 51.38 38 16 THR A 21 ? ? -126.70 -50.88 39 16 ALA A 26 ? ? 177.86 143.80 40 16 ASN A 30 ? ? 37.21 70.48 41 16 PHE A 36 ? ? -87.18 48.84 42 17 ASN A 30 ? ? -51.43 91.61 43 17 CYS A 33 ? ? -173.58 138.91 44 17 PHE A 36 ? ? -106.24 55.01 45 18 THR A 21 ? ? -142.72 12.03 46 18 ALA A 26 ? ? -170.49 149.09 47 18 ARG A 31 ? ? 78.39 31.89 48 18 PHE A 36 ? ? -87.61 47.32 49 20 ILE A 5 ? ? 56.09 168.32 50 20 ASN A 25 ? ? -58.24 99.04 51 20 PHE A 36 ? ? -96.46 44.42 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 31 ? ? 0.315 'SIDE CHAIN' 2 2 ARG A 31 ? ? 0.266 'SIDE CHAIN' 3 2 ARG A 38 ? ? 0.317 'SIDE CHAIN' 4 3 ARG A 31 ? ? 0.304 'SIDE CHAIN' 5 3 ARG A 38 ? ? 0.313 'SIDE CHAIN' 6 4 ARG A 38 ? ? 0.273 'SIDE CHAIN' 7 5 ARG A 38 ? ? 0.194 'SIDE CHAIN' 8 6 ARG A 31 ? ? 0.186 'SIDE CHAIN' 9 6 ARG A 38 ? ? 0.284 'SIDE CHAIN' 10 7 ARG A 31 ? ? 0.289 'SIDE CHAIN' 11 7 ARG A 38 ? ? 0.255 'SIDE CHAIN' 12 8 ARG A 31 ? ? 0.091 'SIDE CHAIN' 13 8 ARG A 38 ? ? 0.307 'SIDE CHAIN' 14 9 ARG A 31 ? ? 0.305 'SIDE CHAIN' 15 9 ARG A 38 ? ? 0.123 'SIDE CHAIN' 16 10 ARG A 31 ? ? 0.096 'SIDE CHAIN' 17 10 ARG A 38 ? ? 0.318 'SIDE CHAIN' 18 11 ARG A 31 ? ? 0.258 'SIDE CHAIN' 19 11 ARG A 38 ? ? 0.272 'SIDE CHAIN' 20 12 ARG A 31 ? ? 0.283 'SIDE CHAIN' 21 12 ARG A 38 ? ? 0.250 'SIDE CHAIN' 22 13 ARG A 31 ? ? 0.310 'SIDE CHAIN' 23 13 ARG A 38 ? ? 0.230 'SIDE CHAIN' 24 14 ARG A 38 ? ? 0.295 'SIDE CHAIN' 25 15 ARG A 31 ? ? 0.302 'SIDE CHAIN' 26 15 ARG A 38 ? ? 0.313 'SIDE CHAIN' 27 16 ARG A 31 ? ? 0.130 'SIDE CHAIN' 28 16 ARG A 38 ? ? 0.317 'SIDE CHAIN' 29 17 ARG A 31 ? ? 0.317 'SIDE CHAIN' 30 17 ARG A 38 ? ? 0.301 'SIDE CHAIN' 31 18 ARG A 31 ? ? 0.283 'SIDE CHAIN' 32 18 ARG A 38 ? ? 0.204 'SIDE CHAIN' 33 19 ARG A 31 ? ? 0.302 'SIDE CHAIN' 34 19 ARG A 38 ? ? 0.306 'SIDE CHAIN' 35 20 ARG A 31 ? ? 0.271 'SIDE CHAIN' 36 20 ARG A 38 ? ? 0.195 'SIDE CHAIN' #