data_2QEV # _entry.id 2QEV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2QEV RCSB RCSB043510 WWPDB D_1000043510 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2QEB . unspecified PDB 2QEH . unspecified PDB 2QEO . unspecified # _pdbx_database_status.entry_id 2QEV _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-26 _pdbx_database_status.SG_entry N _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Andersen, J.F.' 1 'Mans, B.J.' 2 'Calvo, E.' 3 'Ribeiro, J.M.' 4 # _citation.id primary _citation.title 'The Crystal Structure of D7r4, a Salivary Biogenic Amine-binding Protein from the Malaria Mosquito Anopheles gambiae' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 36626 _citation.page_last 36633 _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17928288 _citation.pdbx_database_id_DOI 10.1074/jbc.M706410200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Mans, B.J.' 1 primary 'Calvo, E.' 2 primary 'Ribeiro, J.M.' 3 primary 'Andersen, J.F.' 4 # _cell.entry_id 2QEV _cell.length_a 62.651 _cell.length_b 62.651 _cell.length_c 42.773 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2QEV _symmetry.space_group_name_H-M 'P 43' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 78 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'D7R4 Protein' 17099.857 1 ? ? ? ? 2 water nat water 18.015 72 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'D7-related 4 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIG ECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC ; _entity_poly.pdbx_seq_one_letter_code_can ;METVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIG ECVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 THR n 1 4 VAL n 1 5 GLN n 1 6 ASP n 1 7 CYS n 1 8 GLU n 1 9 ASN n 1 10 LYS n 1 11 LEU n 1 12 PRO n 1 13 PRO n 1 14 SER n 1 15 LEU n 1 16 LYS n 1 17 SER n 1 18 ARG n 1 19 LEU n 1 20 CYS n 1 21 GLU n 1 22 ILE n 1 23 ARG n 1 24 ARG n 1 25 TYR n 1 26 GLU n 1 27 ILE n 1 28 ILE n 1 29 GLU n 1 30 GLY n 1 31 PRO n 1 32 GLU n 1 33 MET n 1 34 ASP n 1 35 LYS n 1 36 HIS n 1 37 ILE n 1 38 HIS n 1 39 CYS n 1 40 VAL n 1 41 MET n 1 42 ARG n 1 43 ALA n 1 44 LEU n 1 45 ASP n 1 46 PHE n 1 47 VAL n 1 48 TYR n 1 49 GLU n 1 50 ASP n 1 51 GLY n 1 52 ARG n 1 53 GLY n 1 54 ASP n 1 55 TYR n 1 56 HIS n 1 57 LYS n 1 58 LEU n 1 59 TYR n 1 60 ASP n 1 61 PRO n 1 62 LEU n 1 63 ASN n 1 64 ILE n 1 65 ILE n 1 66 GLU n 1 67 LEU n 1 68 ASP n 1 69 LYS n 1 70 ARG n 1 71 HIS n 1 72 ASP n 1 73 VAL n 1 74 ASN n 1 75 LEU n 1 76 GLU n 1 77 LYS n 1 78 CYS n 1 79 ILE n 1 80 GLY n 1 81 GLU n 1 82 CYS n 1 83 VAL n 1 84 GLN n 1 85 VAL n 1 86 PRO n 1 87 THR n 1 88 SER n 1 89 GLU n 1 90 ARG n 1 91 ALA n 1 92 HIS n 1 93 VAL n 1 94 PHE n 1 95 TYR n 1 96 LYS n 1 97 CYS n 1 98 LEU n 1 99 LEU n 1 100 LYS n 1 101 SER n 1 102 THR n 1 103 THR n 1 104 GLY n 1 105 ARG n 1 106 THR n 1 107 PHE n 1 108 LYS n 1 109 LYS n 1 110 VAL n 1 111 PHE n 1 112 ASP n 1 113 LEU n 1 114 MET n 1 115 GLU n 1 116 LEU n 1 117 LYS n 1 118 LYS n 1 119 ALA n 1 120 GLY n 1 121 LYS n 1 122 VAL n 1 123 PRO n 1 124 GLN n 1 125 HIS n 1 126 GLN n 1 127 ARG n 1 128 TYR n 1 129 THR n 1 130 ALA n 1 131 GLU n 1 132 PHE n 1 133 VAL n 1 134 GLN n 1 135 ILE n 1 136 MET n 1 137 LYS n 1 138 ASP n 1 139 TYR n 1 140 ASP n 1 141 LYS n 1 142 ALA n 1 143 LEU n 1 144 ASN n 1 145 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'African malaria mosquito' _entity_src_gen.gene_src_genus Anopheles _entity_src_gen.pdbx_gene_src_gene D7r4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain G3 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anopheles gambiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7165 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET17B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9BIH3_ANOGA _struct_ref.pdbx_db_accession Q9BIH3 _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_seq_one_letter_code ;ETVQDCENKLPPSLKSRLCEIRRYEIIEGPEMDKHIHCVMRALDFVYEDGRGDYHKLYDPLNIIELDKRHDVNLEKCIGE CVQVPTSERAHVFYKCLLKSTTGRTFKKVFDLMELKKAGKVPQHQRYTAEFVQIMKDYDKALNC ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2QEV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 145 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BIH3 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 165 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 144 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2QEV _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9BIH3 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'INITIATING METHIONINE' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2QEV _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_percent_sol 49.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.pdbx_details '20 % PEG 6000, 0.1 M Tris HCl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100.0 ? 1 2 ? ? 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2005-11-15 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si (111)' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791533 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9791533 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID # _reflns.entry_id 2QEV _reflns.d_resolution_high 1.998 _reflns.d_resolution_low 62.620 _reflns.number_obs 11190 _reflns.pdbx_Rmerge_I_obs 0.039 _reflns.pdbx_netI_over_sigmaI 18.300 _reflns.pdbx_chi_squared 1.341 _reflns.pdbx_redundancy 4.400 _reflns.percent_possible_obs 97.800 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3. _reflns.number_all 11190 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.998 _reflns_shell.d_res_low 2.07 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.303 _reflns_shell.meanI_over_sigI_obs 3.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.905 _reflns_shell.pdbx_redundancy 3.40 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 941 _reflns_shell.percent_possible_all 84.30 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2QEV _refine.ls_d_res_high 1.998 _refine.ls_d_res_low 62.620 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 98.150 _refine.ls_number_reflns_obs 11190 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_obs 0.220 _refine.ls_R_factor_R_work 0.219 _refine.ls_R_factor_R_free 0.237 _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 533 _refine.B_iso_mean 44.093 _refine.aniso_B[1][1] 0.530 _refine.aniso_B[2][2] 0.530 _refine.aniso_B[3][3] -1.070 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.948 _refine.pdbx_overall_ESU_R 0.213 _refine.pdbx_overall_ESU_R_Free 0.167 _refine.overall_SU_ML 0.141 _refine.overall_SU_B 11.100 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.400 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_ls_sigma_I 0 _refine.ls_number_reflns_all 11190 _refine.ls_R_factor_all ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1189 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 72 _refine_hist.number_atoms_total 1261 _refine_hist.d_res_high 1.998 _refine_hist.d_res_low 62.620 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1215 0.009 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1634 1.060 1.977 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 144 5.822 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 60 34.372 24.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 237 14.942 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 9 23.589 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 175 0.095 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 908 0.004 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 591 0.259 0.300 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 849 0.321 0.500 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 104 0.192 0.500 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 23 0.225 0.300 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 7 0.177 0.500 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 740 3.919 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1175 5.006 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 518 7.095 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 459 9.833 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.998 _refine_ls_shell.d_res_low 2.050 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 85.820 _refine_ls_shell.number_reflns_R_work 695 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.317 _refine_ls_shell.R_factor_R_free 0.270 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 31 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 726 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2QEV _struct.title 'Crystal Structure of Anopheles gambiae D7r4' _struct.pdbx_descriptor 'D7R4 Protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2QEV _struct_keywords.pdbx_keywords 'LIGAND BINDING PROTEIN' _struct_keywords.text 'All-helical, Odorant-binding protein, LIGAND BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? GLU A 8 ? THR A 2 GLU A 7 1 ? 6 HELX_P HELX_P2 2 PRO A 12 ? SER A 17 ? PRO A 11 SER A 16 1 ? 6 HELX_P HELX_P3 3 ARG A 18 ? ARG A 24 ? ARG A 17 ARG A 23 1 ? 7 HELX_P HELX_P4 4 PRO A 31 ? LEU A 44 ? PRO A 30 LEU A 43 1 ? 14 HELX_P HELX_P5 5 ASP A 54 ? GLU A 66 ? ASP A 53 GLU A 65 1 ? 13 HELX_P HELX_P6 6 LYS A 69 ? GLN A 84 ? LYS A 68 GLN A 83 1 ? 16 HELX_P HELX_P7 7 GLU A 89 ? SER A 101 ? GLU A 88 SER A 100 1 ? 13 HELX_P HELX_P8 8 THR A 103 ? GLY A 120 ? THR A 102 GLY A 119 1 ? 18 HELX_P HELX_P9 9 THR A 129 ? ALA A 142 ? THR A 128 ALA A 141 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 6 A CYS 38 1_555 ? ? ? ? ? ? ? 2.042 ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 145 SG ? ? A CYS 19 A CYS 144 1_555 ? ? ? ? ? ? ? 2.053 ? disulf3 disulf ? ? A CYS 78 SG ? ? ? 1_555 A CYS 97 SG ? ? A CYS 77 A CYS 96 1_555 ? ? ? ? ? ? ? 2.040 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 30 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 29 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 31 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 30 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.43 # _atom_sites.entry_id 2QEV _atom_sites.fract_transf_matrix[1][1] 0.015961 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015961 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023379 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 GLU 2 1 1 GLU GLU A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 VAL 4 3 3 VAL VAL A . n A 1 5 GLN 5 4 4 GLN GLN A . n A 1 6 ASP 6 5 5 ASP ASP A . n A 1 7 CYS 7 6 6 CYS CYS A . n A 1 8 GLU 8 7 7 GLU GLU A . n A 1 9 ASN 9 8 8 ASN ASN A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 LEU 11 10 10 LEU LEU A . n A 1 12 PRO 12 11 11 PRO PRO A . n A 1 13 PRO 13 12 12 PRO PRO A . n A 1 14 SER 14 13 13 SER SER A . n A 1 15 LEU 15 14 14 LEU LEU A . n A 1 16 LYS 16 15 15 LYS LYS A . n A 1 17 SER 17 16 16 SER SER A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 CYS 20 19 19 CYS CYS A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 ARG 24 23 23 ARG ARG A . n A 1 25 TYR 25 24 24 TYR TYR A . n A 1 26 GLU 26 25 25 GLU GLU A . n A 1 27 ILE 27 26 26 ILE ILE A . n A 1 28 ILE 28 27 27 ILE ILE A . n A 1 29 GLU 29 28 28 GLU GLU A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 PRO 31 30 30 PRO PRO A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 MET 33 32 32 MET MET A . n A 1 34 ASP 34 33 33 ASP ASP A . n A 1 35 LYS 35 34 34 LYS LYS A . n A 1 36 HIS 36 35 35 HIS HIS A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 HIS 38 37 37 HIS HIS A . n A 1 39 CYS 39 38 38 CYS CYS A . n A 1 40 VAL 40 39 39 VAL VAL A . n A 1 41 MET 41 40 40 MET MET A . n A 1 42 ARG 42 41 41 ARG ARG A . n A 1 43 ALA 43 42 42 ALA ALA A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 PHE 46 45 45 PHE PHE A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 TYR 48 47 47 TYR TYR A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 ARG 52 51 51 ARG ARG A . n A 1 53 GLY 53 52 52 GLY GLY A . n A 1 54 ASP 54 53 53 ASP ASP A . n A 1 55 TYR 55 54 54 TYR TYR A . n A 1 56 HIS 56 55 55 HIS HIS A . n A 1 57 LYS 57 56 56 LYS LYS A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 TYR 59 58 58 TYR TYR A . n A 1 60 ASP 60 59 59 ASP ASP A . n A 1 61 PRO 61 60 60 PRO PRO A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 ASN 63 62 62 ASN ASN A . n A 1 64 ILE 64 63 63 ILE ILE A . n A 1 65 ILE 65 64 64 ILE ILE A . n A 1 66 GLU 66 65 65 GLU GLU A . n A 1 67 LEU 67 66 66 LEU LEU A . n A 1 68 ASP 68 67 67 ASP ASP A . n A 1 69 LYS 69 68 68 LYS LYS A . n A 1 70 ARG 70 69 69 ARG ARG A . n A 1 71 HIS 71 70 70 HIS HIS A . n A 1 72 ASP 72 71 71 ASP ASP A . n A 1 73 VAL 73 72 72 VAL VAL A . n A 1 74 ASN 74 73 73 ASN ASN A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 GLU 76 75 75 GLU GLU A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 CYS 78 77 77 CYS CYS A . n A 1 79 ILE 79 78 78 ILE ILE A . n A 1 80 GLY 80 79 79 GLY GLY A . n A 1 81 GLU 81 80 80 GLU GLU A . n A 1 82 CYS 82 81 81 CYS CYS A . n A 1 83 VAL 83 82 82 VAL VAL A . n A 1 84 GLN 84 83 83 GLN GLN A . n A 1 85 VAL 85 84 84 VAL VAL A . n A 1 86 PRO 86 85 85 PRO PRO A . n A 1 87 THR 87 86 86 THR THR A . n A 1 88 SER 88 87 87 SER SER A . n A 1 89 GLU 89 88 88 GLU GLU A . n A 1 90 ARG 90 89 89 ARG ARG A . n A 1 91 ALA 91 90 90 ALA ALA A . n A 1 92 HIS 92 91 91 HIS HIS A . n A 1 93 VAL 93 92 92 VAL VAL A . n A 1 94 PHE 94 93 93 PHE PHE A . n A 1 95 TYR 95 94 94 TYR TYR A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 CYS 97 96 96 CYS CYS A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 LEU 99 98 98 LEU LEU A . n A 1 100 LYS 100 99 99 LYS LYS A . n A 1 101 SER 101 100 100 SER SER A . n A 1 102 THR 102 101 101 THR THR A . n A 1 103 THR 103 102 102 THR THR A . n A 1 104 GLY 104 103 103 GLY GLY A . n A 1 105 ARG 105 104 104 ARG ARG A . n A 1 106 THR 106 105 105 THR THR A . n A 1 107 PHE 107 106 106 PHE PHE A . n A 1 108 LYS 108 107 107 LYS LYS A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 VAL 110 109 109 VAL VAL A . n A 1 111 PHE 111 110 110 PHE PHE A . n A 1 112 ASP 112 111 111 ASP ASP A . n A 1 113 LEU 113 112 112 LEU LEU A . n A 1 114 MET 114 113 113 MET MET A . n A 1 115 GLU 115 114 114 GLU GLU A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 LYS 117 116 116 LYS LYS A . n A 1 118 LYS 118 117 117 LYS LYS A . n A 1 119 ALA 119 118 118 ALA ALA A . n A 1 120 GLY 120 119 119 GLY GLY A . n A 1 121 LYS 121 120 120 LYS LYS A . n A 1 122 VAL 122 121 121 VAL VAL A . n A 1 123 PRO 123 122 122 PRO PRO A . n A 1 124 GLN 124 123 123 GLN GLN A . n A 1 125 HIS 125 124 124 HIS HIS A . n A 1 126 GLN 126 125 125 GLN GLN A . n A 1 127 ARG 127 126 126 ARG ARG A . n A 1 128 TYR 128 127 127 TYR TYR A . n A 1 129 THR 129 128 128 THR THR A . n A 1 130 ALA 130 129 129 ALA ALA A . n A 1 131 GLU 131 130 130 GLU GLU A . n A 1 132 PHE 132 131 131 PHE PHE A . n A 1 133 VAL 133 132 132 VAL VAL A . n A 1 134 GLN 134 133 133 GLN GLN A . n A 1 135 ILE 135 134 134 ILE ILE A . n A 1 136 MET 136 135 135 MET MET A . n A 1 137 LYS 137 136 136 LYS LYS A . n A 1 138 ASP 138 137 137 ASP ASP A . n A 1 139 TYR 139 138 138 TYR TYR A . n A 1 140 ASP 140 139 139 ASP ASP A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 ALA 142 141 141 ALA ALA A . n A 1 143 LEU 143 142 142 LEU LEU A . n A 1 144 ASN 144 143 143 ASN ASN A . n A 1 145 CYS 145 144 144 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 145 1 HOH HOH A . B 2 HOH 2 146 2 HOH HOH A . B 2 HOH 3 147 3 HOH HOH A . B 2 HOH 4 148 4 HOH HOH A . B 2 HOH 5 149 5 HOH HOH A . B 2 HOH 6 150 6 HOH HOH A . B 2 HOH 7 151 8 HOH HOH A . B 2 HOH 8 152 9 HOH HOH A . B 2 HOH 9 153 10 HOH HOH A . B 2 HOH 10 154 11 HOH HOH A . B 2 HOH 11 155 12 HOH HOH A . B 2 HOH 12 156 14 HOH HOH A . B 2 HOH 13 157 15 HOH HOH A . B 2 HOH 14 158 16 HOH HOH A . B 2 HOH 15 159 17 HOH HOH A . B 2 HOH 16 160 18 HOH HOH A . B 2 HOH 17 161 19 HOH HOH A . B 2 HOH 18 162 20 HOH HOH A . B 2 HOH 19 163 21 HOH HOH A . B 2 HOH 20 164 22 HOH HOH A . B 2 HOH 21 165 23 HOH HOH A . B 2 HOH 22 166 25 HOH HOH A . B 2 HOH 23 167 26 HOH HOH A . B 2 HOH 24 168 28 HOH HOH A . B 2 HOH 25 169 30 HOH HOH A . B 2 HOH 26 170 31 HOH HOH A . B 2 HOH 27 171 32 HOH HOH A . B 2 HOH 28 172 34 HOH HOH A . B 2 HOH 29 173 36 HOH HOH A . B 2 HOH 30 174 37 HOH HOH A . B 2 HOH 31 175 38 HOH HOH A . B 2 HOH 32 176 39 HOH HOH A . B 2 HOH 33 177 40 HOH HOH A . B 2 HOH 34 178 41 HOH HOH A . B 2 HOH 35 179 42 HOH HOH A . B 2 HOH 36 180 44 HOH HOH A . B 2 HOH 37 181 47 HOH HOH A . B 2 HOH 38 182 48 HOH HOH A . B 2 HOH 39 183 50 HOH HOH A . B 2 HOH 40 184 51 HOH HOH A . B 2 HOH 41 185 53 HOH HOH A . B 2 HOH 42 186 54 HOH HOH A . B 2 HOH 43 187 56 HOH HOH A . B 2 HOH 44 188 57 HOH HOH A . B 2 HOH 45 189 58 HOH HOH A . B 2 HOH 46 190 59 HOH HOH A . B 2 HOH 47 191 60 HOH HOH A . B 2 HOH 48 192 61 HOH HOH A . B 2 HOH 49 193 63 HOH HOH A . B 2 HOH 50 194 64 HOH HOH A . B 2 HOH 51 195 66 HOH HOH A . B 2 HOH 52 196 67 HOH HOH A . B 2 HOH 53 197 68 HOH HOH A . B 2 HOH 54 198 69 HOH HOH A . B 2 HOH 55 199 70 HOH HOH A . B 2 HOH 56 200 72 HOH HOH A . B 2 HOH 57 201 73 HOH HOH A . B 2 HOH 58 202 74 HOH HOH A . B 2 HOH 59 203 76 HOH HOH A . B 2 HOH 60 204 77 HOH HOH A . B 2 HOH 61 205 78 HOH HOH A . B 2 HOH 62 206 83 HOH HOH A . B 2 HOH 63 207 84 HOH HOH A . B 2 HOH 64 208 85 HOH HOH A . B 2 HOH 65 209 87 HOH HOH A . B 2 HOH 66 210 88 HOH HOH A . B 2 HOH 67 211 89 HOH HOH A . B 2 HOH 68 212 90 HOH HOH A . B 2 HOH 69 213 94 HOH HOH A . B 2 HOH 70 214 95 HOH HOH A . B 2 HOH 71 215 96 HOH HOH A . B 2 HOH 72 216 97 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.contact_author' 3 3 'Structure model' '_software.contact_author_email' 4 3 'Structure model' '_software.date' 5 3 'Structure model' '_software.language' 6 3 'Structure model' '_software.location' 7 3 'Structure model' '_software.name' 8 3 'Structure model' '_software.type' 9 3 'Structure model' '_software.version' # loop_ _diffrn_reflns.diffrn_id _diffrn_reflns.pdbx_d_res_high _diffrn_reflns.pdbx_d_res_low _diffrn_reflns.pdbx_number_obs _diffrn_reflns.pdbx_Rmerge_I_obs _diffrn_reflns.pdbx_Rsym_value _diffrn_reflns.pdbx_chi_squared _diffrn_reflns.av_sigmaI_over_netI _diffrn_reflns.pdbx_redundancy _diffrn_reflns.pdbx_percent_possible_obs _diffrn_reflns.number _diffrn_reflns.pdbx_observed_criterion _diffrn_reflns.limit_h_max _diffrn_reflns.limit_h_min _diffrn_reflns.limit_k_max _diffrn_reflns.limit_k_min _diffrn_reflns.limit_l_max _diffrn_reflns.limit_l_min 1 2.500 30.000 11430 0.039 ? 0.45 7.80 3.00 99.90 34578 ? ? ? ? ? ? ? 2 2.500 30.000 11400 0.071 ? 0.76 6.60 4.90 99.90 56172 ? ? ? ? ? ? ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 5.38 30.00 ? ? 0.026 ? 0.544 2.90 99.30 1 4.27 5.38 ? ? 0.028 ? 0.481 3.00 100.00 1 3.73 4.27 ? ? 0.030 ? 0.440 3.10 99.90 1 3.39 3.73 ? ? 0.036 ? 0.432 3.10 100.00 1 3.15 3.39 ? ? 0.050 ? 0.565 3.10 100.00 1 2.96 3.15 ? ? 0.067 ? 0.363 3.10 100.00 1 2.82 2.96 ? ? 0.109 ? 0.365 3.10 100.00 1 2.69 2.82 ? ? 0.166 ? 0.575 3.10 100.00 1 2.59 2.69 ? ? 0.192 ? 0.356 3.00 100.00 1 2.50 2.59 ? ? 0.259 ? 0.386 2.90 99.80 2 5.38 30.00 ? ? 0.039 ? 1.016 4.80 99.50 2 4.27 5.38 ? ? 0.049 ? 1.151 5.00 100.00 2 3.73 4.27 ? ? 0.059 ? 1.107 5.00 100.00 2 3.39 3.73 ? ? 0.077 ? 1.003 5.10 100.00 2 3.15 3.39 ? ? 0.103 ? 0.755 5.10 100.00 2 2.96 3.15 ? ? 0.136 ? 0.594 5.10 100.00 2 2.82 2.96 ? ? 0.228 ? 0.488 5.10 100.00 2 2.69 2.82 ? ? 0.338 ? 0.547 5.00 100.00 2 2.59 2.69 ? ? 0.396 ? 0.431 4.90 100.00 2 2.50 2.59 ? ? 0.546 ? 0.519 4.30 99.20 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 8.3779 _pdbx_refine_tls.origin_y -22.4167 _pdbx_refine_tls.origin_z 0.7442 _pdbx_refine_tls.T[1][1] -0.0441 _pdbx_refine_tls.T[2][2] 0.0604 _pdbx_refine_tls.T[3][3] -0.0330 _pdbx_refine_tls.T[1][2] 0.0299 _pdbx_refine_tls.T[1][3] -0.0256 _pdbx_refine_tls.T[2][3] -0.0720 _pdbx_refine_tls.L[1][1] 1.8530 _pdbx_refine_tls.L[2][2] 0.5588 _pdbx_refine_tls.L[3][3] 1.7140 _pdbx_refine_tls.L[1][2] 0.0847 _pdbx_refine_tls.L[1][3] 1.1752 _pdbx_refine_tls.L[2][3] 0.3301 _pdbx_refine_tls.S[1][1] -0.2977 _pdbx_refine_tls.S[2][2] 0.1145 _pdbx_refine_tls.S[3][3] 0.1832 _pdbx_refine_tls.S[1][2] -0.0943 _pdbx_refine_tls.S[1][3] 0.2868 _pdbx_refine_tls.S[2][3] -0.0708 _pdbx_refine_tls.S[2][1] -0.0688 _pdbx_refine_tls.S[3][1] -0.2412 _pdbx_refine_tls.S[3][2] -0.2394 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 145 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 0 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 144 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_phasing_MAD_set.id _pdbx_phasing_MAD_set.d_res_high _pdbx_phasing_MAD_set.d_res_low _pdbx_phasing_MAD_set.reflns_acentric _pdbx_phasing_MAD_set.loc_acentric _pdbx_phasing_MAD_set.power_acentric _pdbx_phasing_MAD_set.R_cullis_acentric _pdbx_phasing_MAD_set.reflns_centric _pdbx_phasing_MAD_set.loc_centric _pdbx_phasing_MAD_set.power_centric _pdbx_phasing_MAD_set.R_cullis_centric 1 2.49 50.00 5448 0.000 0.000 1.670 492 0.000 0.000 1.000 2 2.49 50.00 5445 3.400 1.020 0.810 492 4.800 0.890 0.740 # loop_ _pdbx_phasing_MAD_set_shell.id _pdbx_phasing_MAD_set_shell.d_res_high _pdbx_phasing_MAD_set_shell.d_res_low _pdbx_phasing_MAD_set_shell.reflns_acentric _pdbx_phasing_MAD_set_shell.loc_acentric _pdbx_phasing_MAD_set_shell.power_acentric _pdbx_phasing_MAD_set_shell.R_cullis_acentric _pdbx_phasing_MAD_set_shell.reflns_centric _pdbx_phasing_MAD_set_shell.loc_centric _pdbx_phasing_MAD_set_shell.power_centric _pdbx_phasing_MAD_set_shell.R_cullis_centric 1 14.77 50.00 16 0.200 0.000 1.010 10 0.100 0.000 1.000 1 8.67 14.77 95 0.200 0.000 0.980 28 0.100 0.000 1.000 1 6.13 8.67 226 0.200 0.000 1.960 41 0.100 0.000 1.000 1 4.74 6.13 414 0.100 0.000 1.490 55 0.100 0.000 1.000 1 3.87 4.74 675 0.100 0.000 1.220 69 0.000 0.000 1.000 1 3.27 3.87 962 0.000 0.000 1.460 81 0.000 0.000 1.000 1 2.83 3.27 1336 0.000 0.000 7.120 99 0.000 0.000 1.000 1 2.49 2.83 1724 0.000 0.000 2.690 109 0.000 0.000 1.000 2 14.77 50.00 16 6.800 1.990 0.520 10 9.700 1.900 0.700 2 8.67 14.77 95 6.000 2.400 0.610 28 8.500 1.720 0.540 2 6.13 8.67 226 4.400 2.520 0.530 41 4.500 2.180 0.470 2 4.74 6.13 414 4.500 1.850 0.610 55 6.200 1.070 0.630 2 3.87 4.74 675 4.700 1.140 0.780 69 5.800 0.710 0.790 2 3.27 3.87 962 4.000 0.850 0.860 81 4.900 0.530 0.910 2 2.83 3.27 1335 3.000 0.650 0.930 99 3.600 0.390 0.980 2 2.49 2.83 1722 2.300 0.460 0.990 109 3.000 0.300 1.010 # loop_ _pdbx_phasing_MAD_set_site.id _pdbx_phasing_MAD_set_site.atom_type_symbol _pdbx_phasing_MAD_set_site.fract_x _pdbx_phasing_MAD_set_site.fract_y _pdbx_phasing_MAD_set_site.fract_z _pdbx_phasing_MAD_set_site.b_iso _pdbx_phasing_MAD_set_site.occupancy 1 Se 0.735 0.596 0.048 65.35519 0.000 2 Se 0.885 0.677 0.274 61.07232 0.000 3 Se 0.763 0.562 0.338 141.81461 0.000 4 Se 0.883 0.816 0.094 83.95700 0.000 5 Se 0.735 0.597 0.057 59.45215 0.157 6 Se 0.886 0.677 0.277 72.06138 0.149 7 Se 0.763 0.563 0.341 117.02042 0.164 8 Se 0.883 0.819 0.093 84.49219 0.120 # loop_ _pdbx_phasing_MAD_shell.d_res_high _pdbx_phasing_MAD_shell.d_res_low _pdbx_phasing_MAD_shell.reflns _pdbx_phasing_MAD_shell.fom _pdbx_phasing_MAD_shell.reflns_centric _pdbx_phasing_MAD_shell.fom_centric _pdbx_phasing_MAD_shell.reflns_acentric _pdbx_phasing_MAD_shell.fom_acentric 14.77 50.00 26 0.781 10 0.737 16 0.808 8.67 14.77 123 0.805 28 0.723 95 0.828 6.13 8.67 267 0.818 41 0.634 226 0.851 4.74 6.13 469 0.773 55 0.599 414 0.797 3.87 4.74 744 0.634 69 0.396 675 0.658 3.27 3.87 1043 0.492 81 0.263 962 0.512 2.83 3.27 1435 0.310 99 0.125 1336 0.324 2.49 2.83 1833 0.134 109 0.047 1724 0.140 # _pdbx_phasing_dm.entry_id 2QEV _pdbx_phasing_dm.method 'Solvent flattening and Histogram matching' _pdbx_phasing_dm.reflns 5940 # loop_ _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.delta_phi_final _pdbx_phasing_dm_shell.delta_phi_initial _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 5.770 100.000 47.700 ? ? ? 0.887 ? ? 501 4.560 5.770 38.900 ? ? ? 0.927 ? ? 506 3.960 4.560 47.200 ? ? ? 0.903 ? ? 505 3.590 3.960 46.200 ? ? ? 0.902 ? ? 504 3.330 3.590 50.300 ? ? ? 0.888 ? ? 502 3.130 3.330 54.300 ? ? ? 0.864 ? ? 502 2.980 3.130 53.400 ? ? ? 0.886 ? ? 503 2.840 2.980 60.200 ? ? ? 0.869 ? ? 515 2.730 2.840 68.700 ? ? ? 0.856 ? ? 502 2.640 2.730 72.500 ? ? ? 0.827 ? ? 512 2.490 2.640 76.800 ? ? ? 0.799 ? ? 888 # _phasing.method MAD # _phasing_MAD.entry_id 2QEV _phasing_MAD.pdbx_d_res_high 2.49 _phasing_MAD.pdbx_d_res_low 50.00 _phasing_MAD.pdbx_reflns 5940 _phasing_MAD.pdbx_fom 0.400 _phasing_MAD.pdbx_reflns_centric 492 _phasing_MAD.pdbx_fom_centric 0.310 _phasing_MAD.pdbx_reflns_acentric 5448 _phasing_MAD.pdbx_fom_acentric 0.408 # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 MLPHARE . ? other 'Z.Otwinowski or E.Dodson' 'ccp4@dl.ac.uk, ccp4@yorvic.york.ac.uk' phasing http://www.ccp4.ac.uk/main.html Fortran_77 ? 3 DM 5.0 ? program 'K. Cowtan' ccp4@dl.ac.uk phasing http://www.ccp4.ac.uk/main.html Fortran_77 ? 4 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 5 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 6 EPICS-based 'data aquisition system' ? ? ? ? 'data collection' ? ? ? 7 HKL-3000 . ? ? ? ? 'data reduction' ? ? ? 8 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 89 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.290 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 0 ? CB ? A MET 1 CB 2 1 Y 1 A MET 0 ? CG ? A MET 1 CG 3 1 Y 1 A MET 0 ? SD ? A MET 1 SD 4 1 Y 1 A MET 0 ? CE ? A MET 1 CE # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #