data_3BDR # _entry.id 3BDR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3BDR RCSB RCSB045392 WWPDB D_1000045392 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id TeR13 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3BDR _pdbx_database_status.recvd_initial_deposition_date 2007-11-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kuzin, A.P.' 1 'Su, M.' 2 'Seetharaman, J.' 3 'Forouhar, F.' 4 'Wang, D.' 5 'Janjua, H.' 6 'Cunningham, K.' 7 'Ma, L.-C.' 8 'Xiao, R.' 9 'Liu, J.' 10 'Baran, M.C.' 11 'Acton, T.B.' 12 'Rost, B.' 13 'Montelione, G.T.' 14 'Tong, L.' 15 'Hunt, J.F.' 16 'Northeast Structural Genomics Consortium (NESG)' 17 # _citation.id primary _citation.title 'The crystal structure of fatty acid-binding protein-like Ycf58 from Thermosynecoccus elongatus.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kuzin, A.P.' 1 primary 'Su, M.' 2 primary 'Seetharaman, J.' 3 primary 'Forouhar, F.' 4 primary 'Wang, D.' 5 primary 'Janjua, H.' 6 primary 'Cunningham, K.' 7 primary 'Ma, L.-C.' 8 primary 'Xiao, R.' 9 primary 'Liu, J.' 10 primary 'Baran, M.C.' 11 primary 'Acton, T.B.' 12 primary 'Rost, B.' 13 primary 'Montelione, G.T.' 14 primary 'Tong, L.' 15 primary 'Hunt, J.F.' 16 # _cell.entry_id 3BDR _cell.length_a 75.014 _cell.length_b 75.014 _cell.length_c 83.359 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3BDR _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ycf58 protein' 21877.332 1 ? ? ? ? 2 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)CIG(MSE)DIRDFFAQSAGRWFSQRTSHHLAFKQTESGKSQLTIELLSVDDPAVIALCQQYD(MSE)DPAWAVCG ARVSWDGT(MSE)EWDNEKHEGSTVLVPI(MSE)DQGSR(MSE)EGKLLRE(MSE)GYAEKAPVAGRFS(MSE)GSDGAL TLITEYETIYSEERLWFASPNLRLRTSILKRFGGFS(MSE)ASFCSEIRLGVTQPANSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MCIGMDIRDFFAQSAGRWFSQRTSHHLAFKQTESGKSQLTIELLSVDDPAVIALCQQYDMDPAWAVCGARVSWDGTMEWD NEKHEGSTVLVPIMDQGSRMEGKLLREMGYAEKAPVAGRFSMGSDGALTLITEYETIYSEERLWFASPNLRLRTSILKRF GGFSMASFCSEIRLGVTQPANSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier TeR13 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 CYS n 1 3 ILE n 1 4 GLY n 1 5 MSE n 1 6 ASP n 1 7 ILE n 1 8 ARG n 1 9 ASP n 1 10 PHE n 1 11 PHE n 1 12 ALA n 1 13 GLN n 1 14 SER n 1 15 ALA n 1 16 GLY n 1 17 ARG n 1 18 TRP n 1 19 PHE n 1 20 SER n 1 21 GLN n 1 22 ARG n 1 23 THR n 1 24 SER n 1 25 HIS n 1 26 HIS n 1 27 LEU n 1 28 ALA n 1 29 PHE n 1 30 LYS n 1 31 GLN n 1 32 THR n 1 33 GLU n 1 34 SER n 1 35 GLY n 1 36 LYS n 1 37 SER n 1 38 GLN n 1 39 LEU n 1 40 THR n 1 41 ILE n 1 42 GLU n 1 43 LEU n 1 44 LEU n 1 45 SER n 1 46 VAL n 1 47 ASP n 1 48 ASP n 1 49 PRO n 1 50 ALA n 1 51 VAL n 1 52 ILE n 1 53 ALA n 1 54 LEU n 1 55 CYS n 1 56 GLN n 1 57 GLN n 1 58 TYR n 1 59 ASP n 1 60 MSE n 1 61 ASP n 1 62 PRO n 1 63 ALA n 1 64 TRP n 1 65 ALA n 1 66 VAL n 1 67 CYS n 1 68 GLY n 1 69 ALA n 1 70 ARG n 1 71 VAL n 1 72 SER n 1 73 TRP n 1 74 ASP n 1 75 GLY n 1 76 THR n 1 77 MSE n 1 78 GLU n 1 79 TRP n 1 80 ASP n 1 81 ASN n 1 82 GLU n 1 83 LYS n 1 84 HIS n 1 85 GLU n 1 86 GLY n 1 87 SER n 1 88 THR n 1 89 VAL n 1 90 LEU n 1 91 VAL n 1 92 PRO n 1 93 ILE n 1 94 MSE n 1 95 ASP n 1 96 GLN n 1 97 GLY n 1 98 SER n 1 99 ARG n 1 100 MSE n 1 101 GLU n 1 102 GLY n 1 103 LYS n 1 104 LEU n 1 105 LEU n 1 106 ARG n 1 107 GLU n 1 108 MSE n 1 109 GLY n 1 110 TYR n 1 111 ALA n 1 112 GLU n 1 113 LYS n 1 114 ALA n 1 115 PRO n 1 116 VAL n 1 117 ALA n 1 118 GLY n 1 119 ARG n 1 120 PHE n 1 121 SER n 1 122 MSE n 1 123 GLY n 1 124 SER n 1 125 ASP n 1 126 GLY n 1 127 ALA n 1 128 LEU n 1 129 THR n 1 130 LEU n 1 131 ILE n 1 132 THR n 1 133 GLU n 1 134 TYR n 1 135 GLU n 1 136 THR n 1 137 ILE n 1 138 TYR n 1 139 SER n 1 140 GLU n 1 141 GLU n 1 142 ARG n 1 143 LEU n 1 144 TRP n 1 145 PHE n 1 146 ALA n 1 147 SER n 1 148 PRO n 1 149 ASN n 1 150 LEU n 1 151 ARG n 1 152 LEU n 1 153 ARG n 1 154 THR n 1 155 SER n 1 156 ILE n 1 157 LEU n 1 158 LYS n 1 159 ARG n 1 160 PHE n 1 161 GLY n 1 162 GLY n 1 163 PHE n 1 164 SER n 1 165 MSE n 1 166 ALA n 1 167 SER n 1 168 PHE n 1 169 CYS n 1 170 SER n 1 171 GLU n 1 172 ILE n 1 173 ARG n 1 174 LEU n 1 175 GLY n 1 176 VAL n 1 177 THR n 1 178 GLN n 1 179 PRO n 1 180 ALA n 1 181 ASN n 1 182 SER n 1 183 LEU n 1 184 GLU n 1 185 HIS n 1 186 HIS n 1 187 HIS n 1 188 HIS n 1 189 HIS n 1 190 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Synechococcus _entity_src_gen.pdbx_gene_src_gene 'ycf58, tll1699' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain BP-1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Synechococcus elongatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32046 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8DI91_SYNEL _struct_ref.pdbx_db_accession Q8DI91 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MCIGMDIRDFFAQSAGRWFSQRTSHHLAFKQTESGKSQLTIELLSVDDPAVIALCQQYDMDPAWAVCGARVSWDGTMEWD NEKHEGSTVLVPIMDQGSRMEGKLLREMGYAEKAPVAGRFSMGSDGALTLITEYETIYSEERLWFASPNLRLRTSILKRF GGFSMASFCSEIRLGVTQPANS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3BDR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 182 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8DI91 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 182 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 182 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3BDR LEU A 183 ? UNP Q8DI91 ? ? 'EXPRESSION TAG' 183 1 1 3BDR GLU A 184 ? UNP Q8DI91 ? ? 'EXPRESSION TAG' 184 2 1 3BDR HIS A 185 ? UNP Q8DI91 ? ? 'EXPRESSION TAG' 185 3 1 3BDR HIS A 186 ? UNP Q8DI91 ? ? 'EXPRESSION TAG' 186 4 1 3BDR HIS A 187 ? UNP Q8DI91 ? ? 'EXPRESSION TAG' 187 5 1 3BDR HIS A 188 ? UNP Q8DI91 ? ? 'EXPRESSION TAG' 188 6 1 3BDR HIS A 189 ? UNP Q8DI91 ? ? 'EXPRESSION TAG' 189 7 1 3BDR HIS A 190 ? UNP Q8DI91 ? ? 'EXPRESSION TAG' 190 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3BDR _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_percent_sol 54.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 10.0 _exptl_crystal_grow.pdbx_details '18% PEG 20000, 0.1M NH4H2PO4, 0.1M CAPS, 20% Glycerol, pH 10.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2007-07-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97900 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97900 # _reflns.entry_id 3BDR _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.8 _reflns.number_obs 11252 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 28.2 _reflns.B_iso_Wilson_estimate 47.3 _reflns.pdbx_redundancy 10.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.80 _reflns_shell.d_res_low 2.90 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.691 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.6 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1113 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3BDR _refine.ls_number_reflns_obs 10246 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.0 _refine.pdbx_data_cutoff_high_absF 105173.90 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.40 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 91.7 _refine.ls_R_factor_obs 0.236 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.236 _refine.ls_R_factor_R_free 0.262 _refine.ls_R_factor_R_free_error 0.011 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 522 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 66.6 _refine.aniso_B[1][1] -2.62 _refine.aniso_B[2][2] -2.62 _refine.aniso_B[3][3] 5.24 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.35 _refine.solvent_model_param_bsol 46.7207 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'The Friedel pairs were used in phasing. BULK SOLVENT MODEL USED in refinement' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3BDR _refine_analyze.Luzzati_coordinate_error_obs 0.37 _refine_analyze.Luzzati_sigma_a_obs 0.41 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.44 _refine_analyze.Luzzati_sigma_a_free 0.58 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1225 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 1231 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 19.40 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 26.7 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.78 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 2.97 _refine_ls_shell.number_reflns_R_work 1410 _refine_ls_shell.R_factor_R_work 0.312 _refine_ls_shell.percent_reflns_obs 79.9 _refine_ls_shell.R_factor_R_free 0.395 _refine_ls_shell.R_factor_R_free_error 0.044 _refine_ls_shell.percent_reflns_R_free 5.3 _refine_ls_shell.number_reflns_R_free 79 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 3BDR _struct.title ;Crystal structure of fatty acid-binding protein-like Ycf58 from Thermosynecoccus elongatus. Northeast Structural Genomics Consortium target TeR13. ; _struct.pdbx_descriptor 'Ycf58 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3BDR _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;NESG, Ycf58, Q8DI91, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 6 ? ALA A 15 ? ASP A 6 ALA A 15 1 ? 10 HELX_P HELX_P2 2 ASP A 48 ? TYR A 58 ? ASP A 48 TYR A 58 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLY 4 C ? ? ? 1_555 A MSE 5 N ? ? A GLY 4 A MSE 5 1_555 ? ? ? ? ? ? ? 1.336 ? covale2 covale ? ? A MSE 5 C ? ? ? 1_555 A ASP 6 N ? ? A MSE 5 A ASP 6 1_555 ? ? ? ? ? ? ? 1.337 ? covale3 covale ? ? A ASP 59 C ? ? ? 1_555 A MSE 60 N ? ? A ASP 59 A MSE 60 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale ? ? A MSE 60 C ? ? ? 1_555 A ASP 61 N ? ? A MSE 60 A ASP 61 1_555 ? ? ? ? ? ? ? 1.328 ? covale5 covale ? ? A ILE 93 C ? ? ? 1_555 A MSE 94 N ? ? A ILE 93 A MSE 94 1_555 ? ? ? ? ? ? ? 1.327 ? covale6 covale ? ? A MSE 94 C ? ? ? 1_555 A ASP 95 N ? ? A MSE 94 A ASP 95 1_555 ? ? ? ? ? ? ? 1.327 ? covale7 covale ? ? A ARG 99 C ? ? ? 1_555 A MSE 100 N ? ? A ARG 99 A MSE 100 1_555 ? ? ? ? ? ? ? 1.331 ? covale8 covale ? ? A MSE 100 C ? ? ? 1_555 A GLU 101 N ? ? A MSE 100 A GLU 101 1_555 ? ? ? ? ? ? ? 1.324 ? covale9 covale ? ? A SER 121 C ? ? ? 1_555 A MSE 122 N ? ? A SER 121 A MSE 122 1_555 ? ? ? ? ? ? ? 1.324 ? covale10 covale ? ? A MSE 122 C ? ? ? 1_555 A GLY 123 N ? ? A MSE 122 A GLY 123 1_555 ? ? ? ? ? ? ? 1.322 ? covale11 covale ? ? A SER 164 C ? ? ? 1_555 A MSE 165 N ? ? A SER 164 A MSE 165 1_555 ? ? ? ? ? ? ? 1.323 ? covale12 covale ? ? A MSE 165 C ? ? ? 1_555 A ALA 166 N ? ? A MSE 165 A ALA 166 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 11 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel A 10 11 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 16 ? HIS A 26 ? GLY A 16 HIS A 26 A 2 GLN A 31 ? LEU A 44 ? GLN A 31 LEU A 44 A 3 GLY A 68 ? ASP A 74 ? GLY A 68 ASP A 74 A 4 GLU A 85 ? MSE A 94 ? GLU A 85 MSE A 94 A 5 GLU A 101 ? ARG A 106 ? GLU A 101 ARG A 106 A 6 ARG A 119 ? MSE A 122 ? ARG A 119 MSE A 122 A 7 LEU A 128 ? GLU A 133 ? LEU A 128 GLU A 133 A 8 TYR A 138 ? SER A 147 ? TYR A 138 SER A 147 A 9 LEU A 150 ? ARG A 159 ? LEU A 150 ARG A 159 A 10 GLY A 162 ? ARG A 173 ? GLY A 162 ARG A 173 A 11 GLY A 16 ? HIS A 26 ? GLY A 16 HIS A 26 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 20 ? N SER A 20 O SER A 37 ? O SER A 37 A 2 3 N THR A 40 ? N THR A 40 O SER A 72 ? O SER A 72 A 3 4 N VAL A 71 ? N VAL A 71 O THR A 88 ? O THR A 88 A 4 5 N ILE A 93 ? N ILE A 93 O LYS A 103 ? O LYS A 103 A 5 6 N GLY A 102 ? N GLY A 102 O PHE A 120 ? O PHE A 120 A 6 7 N ARG A 119 ? N ARG A 119 O ILE A 131 ? O ILE A 131 A 7 8 N LEU A 130 ? N LEU A 130 O GLU A 141 ? O GLU A 141 A 8 9 N TRP A 144 ? N TRP A 144 O LEU A 152 ? O LEU A 152 A 9 10 N LEU A 157 ? N LEU A 157 O SER A 164 ? O SER A 164 A 10 11 O ALA A 166 ? O ALA A 166 N HIS A 25 ? N HIS A 25 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE PO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 SER A 14 ? SER A 14 . ? 1_555 ? 2 AC1 2 ARG A 151 ? ARG A 151 . ? 1_555 ? # _database_PDB_matrix.entry_id 3BDR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3BDR _atom_sites.fract_transf_matrix[1][1] 0.013331 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013331 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011996 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 CYS 2 2 ? ? ? A . n A 1 3 ILE 3 3 ? ? ? A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 MSE 5 5 5 MSE MSE A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 MSE 60 60 60 MSE MSE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 TRP 64 64 64 TRP TRP A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 MSE 77 77 ? ? ? A . n A 1 78 GLU 78 78 ? ? ? A . n A 1 79 TRP 79 79 ? ? ? A . n A 1 80 ASP 80 80 ? ? ? A . n A 1 81 ASN 81 81 ? ? ? A . n A 1 82 GLU 82 82 ? ? ? A . n A 1 83 LYS 83 83 ? ? ? A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 MSE 94 94 94 MSE MSE A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 MSE 100 100 100 MSE MSE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 MSE 108 108 ? ? ? A . n A 1 109 GLY 109 109 ? ? ? A . n A 1 110 TYR 110 110 ? ? ? A . n A 1 111 ALA 111 111 ? ? ? A . n A 1 112 GLU 112 112 ? ? ? A . n A 1 113 LYS 113 113 ? ? ? A . n A 1 114 ALA 114 114 ? ? ? A . n A 1 115 PRO 115 115 ? ? ? A . n A 1 116 VAL 116 116 ? ? ? A . n A 1 117 ALA 117 117 ? ? ? A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 MSE 122 122 122 MSE MSE A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 TRP 144 144 144 TRP TRP A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 MSE 165 165 165 MSE MSE A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 THR 177 177 ? ? ? A . n A 1 178 GLN 178 178 ? ? ? A . n A 1 179 PRO 179 179 ? ? ? A . n A 1 180 ALA 180 180 ? ? ? A . n A 1 181 ASN 181 181 ? ? ? A . n A 1 182 SER 182 182 ? ? ? A . n A 1 183 LEU 183 183 ? ? ? A . n A 1 184 GLU 184 184 ? ? ? A . n A 1 185 HIS 185 185 ? ? ? A . n A 1 186 HIS 186 186 ? ? ? A . n A 1 187 HIS 187 187 ? ? ? A . n A 1 188 HIS 188 188 ? ? ? A . n A 1 189 HIS 189 189 ? ? ? A . n A 1 190 HIS 190 190 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PO4 1 201 201 PO4 PO4 A . C 3 HOH 1 202 202 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 5 A MSE 5 ? MET SELENOMETHIONINE 2 A MSE 60 A MSE 60 ? MET SELENOMETHIONINE 3 A MSE 94 A MSE 94 ? MET SELENOMETHIONINE 4 A MSE 100 A MSE 100 ? MET SELENOMETHIONINE 5 A MSE 122 A MSE 122 ? MET SELENOMETHIONINE 6 A MSE 165 A MSE 165 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_prop.biol_id 1 _pdbx_struct_assembly_prop.type 'ABSA (A^2)' _pdbx_struct_assembly_prop.value 1980 _pdbx_struct_assembly_prop.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 83.3590000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-11-27 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 4 'Structure model' 1 3 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' audit_author 3 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.name' 2 4 'Structure model' '_audit_author.name' 3 4 'Structure model' '_citation_author.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.2 ? 1 ADSC 'data collection' Quantum ? 2 HKL-2000 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 SnB phasing . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 67 ? ? 175.22 178.95 2 1 ASP A 74 ? ? -171.58 120.78 3 1 TYR A 134 ? ? -90.23 -83.92 4 1 GLU A 135 ? ? -127.39 -62.71 5 1 LEU A 174 ? ? -86.12 -73.72 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A CYS 2 ? A CYS 2 3 1 Y 1 A ILE 3 ? A ILE 3 4 1 Y 1 A MSE 77 ? A MSE 77 5 1 Y 1 A GLU 78 ? A GLU 78 6 1 Y 1 A TRP 79 ? A TRP 79 7 1 Y 1 A ASP 80 ? A ASP 80 8 1 Y 1 A ASN 81 ? A ASN 81 9 1 Y 1 A GLU 82 ? A GLU 82 10 1 Y 1 A LYS 83 ? A LYS 83 11 1 Y 1 A MSE 108 ? A MSE 108 12 1 Y 1 A GLY 109 ? A GLY 109 13 1 Y 1 A TYR 110 ? A TYR 110 14 1 Y 1 A ALA 111 ? A ALA 111 15 1 Y 1 A GLU 112 ? A GLU 112 16 1 Y 1 A LYS 113 ? A LYS 113 17 1 Y 1 A ALA 114 ? A ALA 114 18 1 Y 1 A PRO 115 ? A PRO 115 19 1 Y 1 A VAL 116 ? A VAL 116 20 1 Y 1 A ALA 117 ? A ALA 117 21 1 Y 1 A THR 177 ? A THR 177 22 1 Y 1 A GLN 178 ? A GLN 178 23 1 Y 1 A PRO 179 ? A PRO 179 24 1 Y 1 A ALA 180 ? A ALA 180 25 1 Y 1 A ASN 181 ? A ASN 181 26 1 Y 1 A SER 182 ? A SER 182 27 1 Y 1 A LEU 183 ? A LEU 183 28 1 Y 1 A GLU 184 ? A GLU 184 29 1 Y 1 A HIS 185 ? A HIS 185 30 1 Y 1 A HIS 186 ? A HIS 186 31 1 Y 1 A HIS 187 ? A HIS 187 32 1 Y 1 A HIS 188 ? A HIS 188 33 1 Y 1 A HIS 189 ? A HIS 189 34 1 Y 1 A HIS 190 ? A HIS 190 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHATE ION' PO4 3 water HOH #