data_3BZ6 # _entry.id 3BZ6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3BZ6 RCSB RCSB046139 WWPDB D_1000046139 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2008-02-05 _pdbx_database_PDB_obs_spr.pdb_id 3BZ6 _pdbx_database_PDB_obs_spr.replace_pdb_id 2NR3 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC84902 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3BZ6 _pdbx_database_status.recvd_initial_deposition_date 2008-01-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tan, K.' 1 'Duggan, E.' 2 'Clancy, S.' 3 'Joachimiak, A.' 4 'Midwest Center for Structural Genomics (MCSG)' 5 # _citation.id primary _citation.title 'The crystal structure of a conserved protein of unknown function from Pseudomonas syringae pv. tomato str. DC3000.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Tan, K.' 1 primary 'Duggan, E.' 2 primary 'Clancy, S.' 3 primary 'Joachimiak, A.' 4 # _cell.entry_id 3BZ6 _cell.length_a 72.025 _cell.length_b 72.025 _cell.length_c 73.119 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3BZ6 _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UPF0502 protein PSPTO_2686' 20532.506 1 ? ? 'Residues 1-180' ? 2 water nat water 18.015 26 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)SIESSATPTTPNAEALQLNSTEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPV(MSE)NLTQGQV GQSLRALEGRGLTRLV(MSE)GSRADRWEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNR(MSE)HDFEDSEQV VHQLERLIARGLATLVPRQSGQREDRY(MSE)HLIGDPEDLQD ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMSIESSATPTTPNAEALQLNSTEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPVMNLTQGQVGQSLRALE GRGLTRLVMGSRADRWEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRMHDFEDSEQVVHQLERLIARGLATLV PRQSGQREDRYMHLIGDPEDLQD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC84902 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 SER n 1 6 ILE n 1 7 GLU n 1 8 SER n 1 9 SER n 1 10 ALA n 1 11 THR n 1 12 PRO n 1 13 THR n 1 14 THR n 1 15 PRO n 1 16 ASN n 1 17 ALA n 1 18 GLU n 1 19 ALA n 1 20 LEU n 1 21 GLN n 1 22 LEU n 1 23 ASN n 1 24 SER n 1 25 THR n 1 26 GLU n 1 27 VAL n 1 28 ARG n 1 29 ILE n 1 30 LEU n 1 31 GLY n 1 32 CYS n 1 33 LEU n 1 34 ILE n 1 35 GLU n 1 36 LYS n 1 37 GLN n 1 38 ALA n 1 39 THR n 1 40 ASN n 1 41 PRO n 1 42 GLU n 1 43 THR n 1 44 TYR n 1 45 PRO n 1 46 LEU n 1 47 THR n 1 48 LEU n 1 49 ASN n 1 50 ALA n 1 51 LEU n 1 52 VAL n 1 53 ILE n 1 54 ALA n 1 55 CYS n 1 56 ASN n 1 57 GLN n 1 58 LYS n 1 59 THR n 1 60 SER n 1 61 ARG n 1 62 ASP n 1 63 PRO n 1 64 VAL n 1 65 MSE n 1 66 ASN n 1 67 LEU n 1 68 THR n 1 69 GLN n 1 70 GLY n 1 71 GLN n 1 72 VAL n 1 73 GLY n 1 74 GLN n 1 75 SER n 1 76 LEU n 1 77 ARG n 1 78 ALA n 1 79 LEU n 1 80 GLU n 1 81 GLY n 1 82 ARG n 1 83 GLY n 1 84 LEU n 1 85 THR n 1 86 ARG n 1 87 LEU n 1 88 VAL n 1 89 MSE n 1 90 GLY n 1 91 SER n 1 92 ARG n 1 93 ALA n 1 94 ASP n 1 95 ARG n 1 96 TRP n 1 97 GLU n 1 98 HIS n 1 99 LYS n 1 100 VAL n 1 101 ASP n 1 102 LYS n 1 103 GLY n 1 104 LEU n 1 105 GLU n 1 106 LEU n 1 107 VAL n 1 108 PRO n 1 109 ALA n 1 110 GLN n 1 111 VAL n 1 112 ILE n 1 113 LEU n 1 114 THR n 1 115 GLY n 1 116 LEU n 1 117 LEU n 1 118 LEU n 1 119 LEU n 1 120 ARG n 1 121 GLY n 1 122 PRO n 1 123 GLN n 1 124 THR n 1 125 VAL n 1 126 SER n 1 127 GLU n 1 128 LEU n 1 129 LEU n 1 130 THR n 1 131 ARG n 1 132 SER n 1 133 ASN n 1 134 ARG n 1 135 MSE n 1 136 HIS n 1 137 ASP n 1 138 PHE n 1 139 GLU n 1 140 ASP n 1 141 SER n 1 142 GLU n 1 143 GLN n 1 144 VAL n 1 145 VAL n 1 146 HIS n 1 147 GLN n 1 148 LEU n 1 149 GLU n 1 150 ARG n 1 151 LEU n 1 152 ILE n 1 153 ALA n 1 154 ARG n 1 155 GLY n 1 156 LEU n 1 157 ALA n 1 158 THR n 1 159 LEU n 1 160 VAL n 1 161 PRO n 1 162 ARG n 1 163 GLN n 1 164 SER n 1 165 GLY n 1 166 GLN n 1 167 ARG n 1 168 GLU n 1 169 ASP n 1 170 ARG n 1 171 TYR n 1 172 MSE n 1 173 HIS n 1 174 LEU n 1 175 ILE n 1 176 GLY n 1 177 ASP n 1 178 PRO n 1 179 GLU n 1 180 ASP n 1 181 LEU n 1 182 GLN n 1 183 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene PSPTO_2686 _entity_src_gen.gene_src_species 'Pseudomonas syringae group genomosp. 3' _entity_src_gen.gene_src_strain DC3000 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas syringae pv. tomato' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 223283 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y2686_PSESM _struct_ref.pdbx_db_accession Q882E2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSIESSATPTTPNAEALQLNSTEVRILGCLIEKQATNPETYPLTLNALVIACNQKTSRDPVMNLTQGQVGQSLRALEGRG LTRLVMGSRADRWEHKVDKGLELVPAQVILTGLLLLRGPQTVSELLTRSNRMHDFEDSEQVVHQLERLIARGLATLVPRQ SGQREDRYMHLIGDPEDLQD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3BZ6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q882E2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 180 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 180 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3BZ6 SER A 1 ? UNP Q882E2 ? ? 'EXPRESSION TAG' -2 1 1 3BZ6 ASN A 2 ? UNP Q882E2 ? ? 'EXPRESSION TAG' -1 2 1 3BZ6 ALA A 3 ? UNP Q882E2 ? ? 'EXPRESSION TAG' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3BZ6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_percent_sol 53.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_details '0.1M Sodium acetate, 20% Isopropanol, 20% PEG 4000, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2006-08-13 _diffrn_detector.details Mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 Crystal' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97929 1.0 2 0.97943 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97929, 0.97943' # _reflns.entry_id 3BZ6 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 31.54 _reflns.number_all 10229 _reflns.number_obs 10229 _reflns.percent_possible_obs 93.1 _reflns.pdbx_Rmerge_I_obs 0.091 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 46.0 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 13.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.25 _reflns_shell.percent_possible_all 58.5 _reflns_shell.Rmerge_I_obs 0.391 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.59 _reflns_shell.pdbx_redundancy 9.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 426 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3BZ6 _refine.ls_number_reflns_obs 9680 _refine.ls_number_reflns_all 9680 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 31.54 _refine.ls_d_res_high 2.21 _refine.ls_percent_reflns_obs 92.94 _refine.ls_R_factor_obs 0.19788 _refine.ls_R_factor_all 0.19788 _refine.ls_R_factor_R_work 0.19574 _refine.ls_R_factor_R_free 0.24085 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 492 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.963 _refine.correlation_coeff_Fo_to_Fc_free 0.955 _refine.B_iso_mean 58.166 _refine.aniso_B[1][1] 0.64 _refine.aniso_B[2][2] 0.64 _refine.aniso_B[3][3] -0.96 _refine.aniso_B[1][2] 0.32 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.252 _refine.pdbx_overall_ESU_R_Free 0.207 _refine.overall_SU_ML 0.195 _refine.overall_SU_B 17.474 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1316 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 1342 _refine_hist.d_res_high 2.21 _refine_hist.d_res_low 31.54 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.021 ? 1331 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.630 1.986 ? 1801 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.078 5.000 ? 167 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.297 24.154 ? 65 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.962 15.000 ? 248 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 19.255 15.000 ? 15 'X-RAY DIFFRACTION' ? r_chiral_restr 0.114 0.200 ? 212 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 996 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.223 0.200 ? 574 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.306 0.200 ? 905 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.135 0.200 ? 59 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.262 0.200 ? 19 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.194 0.200 ? 3 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.416 2.000 ? 862 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.247 3.000 ? 1345 'X-RAY DIFFRACTION' ? r_scbond_it 1.293 2.000 ? 515 'X-RAY DIFFRACTION' ? r_scangle_it 1.865 3.000 ? 456 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.21 _refine_ls_shell.d_res_low 2.26 _refine_ls_shell.number_reflns_R_work 454 _refine_ls_shell.R_factor_R_work 0.318 _refine_ls_shell.percent_reflns_obs 58.96 _refine_ls_shell.R_factor_R_free 0.466 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 477 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3BZ6 _struct.title 'Crystal structure of a conserved protein of unknown function from Pseudomonas syringae pv. tomato str. DC3000' _struct.pdbx_descriptor 'UPF0502 protein PSPTO_2686' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3BZ6 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;APC84902, conserved domain, Pseudomonas syringae pv. tomato str. DC3000, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'AUTHORS STATE THAT THE BIOLOGICAL UNIT OF THIS PROTEIN IS EXPERIMENTALLY UNKNOWN. IT IS LIKELY A MONOMER.' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 23 ? ASN A 40 ? ASN A 20 ASN A 37 1 ? 18 HELX_P HELX_P2 2 PRO A 41 ? TYR A 44 ? PRO A 38 TYR A 41 5 ? 4 HELX_P HELX_P3 3 LEU A 48 ? ASN A 56 ? LEU A 45 ASN A 53 1 ? 9 HELX_P HELX_P4 4 THR A 68 ? ARG A 82 ? THR A 65 ARG A 79 1 ? 15 HELX_P HELX_P5 5 LYS A 99 ? GLU A 105 ? LYS A 96 GLU A 102 1 ? 7 HELX_P HELX_P6 6 VAL A 107 ? GLY A 121 ? VAL A 104 GLY A 118 1 ? 15 HELX_P HELX_P7 7 THR A 124 ? ASN A 133 ? THR A 121 ASN A 130 1 ? 10 HELX_P HELX_P8 8 ASP A 140 ? ARG A 154 ? ASP A 137 ARG A 151 1 ? 15 HELX_P HELX_P9 9 ASP A 177 ? GLN A 182 ? ASP A 174 GLN A 179 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A VAL 64 C ? ? ? 1_555 A MSE 65 N ? ? A VAL 61 A MSE 62 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale ? ? A MSE 65 C ? ? ? 1_555 A ASN 66 N ? ? A MSE 62 A ASN 63 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A VAL 88 C ? ? ? 1_555 A MSE 89 N ? ? A VAL 85 A MSE 86 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale ? ? A MSE 89 C ? ? ? 1_555 A GLY 90 N ? ? A MSE 86 A GLY 87 1_555 ? ? ? ? ? ? ? 1.320 ? covale5 covale ? ? A ARG 134 C ? ? ? 1_555 A MSE 135 N ? ? A ARG 131 A MSE 132 1_555 ? ? ? ? ? ? ? 1.336 ? covale6 covale ? ? A MSE 135 C ? ? ? 1_555 A HIS 136 N ? ? A MSE 132 A HIS 133 1_555 ? ? ? ? ? ? ? 1.327 ? covale7 covale ? ? A TYR 171 C ? ? ? 1_555 A MSE 172 N ? ? A TYR 168 A MSE 169 1_555 ? ? ? ? ? ? ? 1.326 ? covale8 covale ? ? A MSE 172 C ? ? ? 1_555 A HIS 173 N ? ? A MSE 169 A HIS 170 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 44 A . ? TYR 41 A PRO 45 A ? PRO 42 A 1 4.02 2 ASP 62 A . ? ASP 59 A PRO 63 A ? PRO 60 A 1 6.17 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 46 ? THR A 47 ? LEU A 43 THR A 44 A 2 ARG A 95 ? HIS A 98 ? ARG A 92 HIS A 95 A 3 THR A 85 ? VAL A 88 ? THR A 82 VAL A 85 B 1 ALA A 157 ? VAL A 160 ? ALA A 154 VAL A 157 B 2 ARG A 170 ? HIS A 173 ? ARG A 167 HIS A 170 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 46 ? N LEU A 43 O TRP A 96 ? O TRP A 93 A 2 3 O ARG A 95 ? O ARG A 92 N VAL A 88 ? N VAL A 85 B 1 2 N VAL A 160 ? N VAL A 157 O ARG A 170 ? O ARG A 167 # _database_PDB_matrix.entry_id 3BZ6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3BZ6 _atom_sites.fract_transf_matrix[1][1] 0.013884 _atom_sites.fract_transf_matrix[1][2] 0.008016 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016032 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013676 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MSE 4 1 ? ? ? A . n A 1 5 SER 5 2 ? ? ? A . n A 1 6 ILE 6 3 ? ? ? A . n A 1 7 GLU 7 4 ? ? ? A . n A 1 8 SER 8 5 ? ? ? A . n A 1 9 SER 9 6 ? ? ? A . n A 1 10 ALA 10 7 ? ? ? A . n A 1 11 THR 11 8 ? ? ? A . n A 1 12 PRO 12 9 ? ? ? A . n A 1 13 THR 13 10 ? ? ? A . n A 1 14 THR 14 11 ? ? ? A . n A 1 15 PRO 15 12 ? ? ? A . n A 1 16 ASN 16 13 13 ASN ASN A . n A 1 17 ALA 17 14 14 ALA ALA A . n A 1 18 GLU 18 15 15 GLU GLU A . n A 1 19 ALA 19 16 16 ALA ALA A . n A 1 20 LEU 20 17 17 LEU LEU A . n A 1 21 GLN 21 18 18 GLN GLN A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ASN 23 20 20 ASN ASN A . n A 1 24 SER 24 21 21 SER SER A . n A 1 25 THR 25 22 22 THR THR A . n A 1 26 GLU 26 23 23 GLU GLU A . n A 1 27 VAL 27 24 24 VAL VAL A . n A 1 28 ARG 28 25 25 ARG ARG A . n A 1 29 ILE 29 26 26 ILE ILE A . n A 1 30 LEU 30 27 27 LEU LEU A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 CYS 32 29 29 CYS CYS A . n A 1 33 LEU 33 30 30 LEU LEU A . n A 1 34 ILE 34 31 31 ILE ILE A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 LYS 36 33 33 LYS LYS A . n A 1 37 GLN 37 34 34 GLN GLN A . n A 1 38 ALA 38 35 35 ALA ALA A . n A 1 39 THR 39 36 36 THR THR A . n A 1 40 ASN 40 37 37 ASN ASN A . n A 1 41 PRO 41 38 38 PRO PRO A . n A 1 42 GLU 42 39 39 GLU GLU A . n A 1 43 THR 43 40 40 THR THR A . n A 1 44 TYR 44 41 41 TYR TYR A . n A 1 45 PRO 45 42 42 PRO PRO A . n A 1 46 LEU 46 43 43 LEU LEU A . n A 1 47 THR 47 44 44 THR THR A . n A 1 48 LEU 48 45 45 LEU LEU A . n A 1 49 ASN 49 46 46 ASN ASN A . n A 1 50 ALA 50 47 47 ALA ALA A . n A 1 51 LEU 51 48 48 LEU LEU A . n A 1 52 VAL 52 49 49 VAL VAL A . n A 1 53 ILE 53 50 50 ILE ILE A . n A 1 54 ALA 54 51 51 ALA ALA A . n A 1 55 CYS 55 52 52 CYS CYS A . n A 1 56 ASN 56 53 53 ASN ASN A . n A 1 57 GLN 57 54 54 GLN GLN A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 THR 59 56 56 THR THR A . n A 1 60 SER 60 57 57 SER SER A . n A 1 61 ARG 61 58 58 ARG ARG A . n A 1 62 ASP 62 59 59 ASP ASP A . n A 1 63 PRO 63 60 60 PRO PRO A . n A 1 64 VAL 64 61 61 VAL VAL A . n A 1 65 MSE 65 62 62 MSE MSE A . n A 1 66 ASN 66 63 63 ASN ASN A . n A 1 67 LEU 67 64 64 LEU LEU A . n A 1 68 THR 68 65 65 THR THR A . n A 1 69 GLN 69 66 66 GLN GLN A . n A 1 70 GLY 70 67 67 GLY GLY A . n A 1 71 GLN 71 68 68 GLN GLN A . n A 1 72 VAL 72 69 69 VAL VAL A . n A 1 73 GLY 73 70 70 GLY GLY A . n A 1 74 GLN 74 71 71 GLN GLN A . n A 1 75 SER 75 72 72 SER SER A . n A 1 76 LEU 76 73 73 LEU LEU A . n A 1 77 ARG 77 74 74 ARG ARG A . n A 1 78 ALA 78 75 75 ALA ALA A . n A 1 79 LEU 79 76 76 LEU LEU A . n A 1 80 GLU 80 77 77 GLU GLU A . n A 1 81 GLY 81 78 78 GLY GLY A . n A 1 82 ARG 82 79 79 ARG ARG A . n A 1 83 GLY 83 80 80 GLY GLY A . n A 1 84 LEU 84 81 81 LEU LEU A . n A 1 85 THR 85 82 82 THR THR A . n A 1 86 ARG 86 83 83 ARG ARG A . n A 1 87 LEU 87 84 84 LEU LEU A . n A 1 88 VAL 88 85 85 VAL VAL A . n A 1 89 MSE 89 86 86 MSE MSE A . n A 1 90 GLY 90 87 87 GLY GLY A . n A 1 91 SER 91 88 88 SER SER A . n A 1 92 ARG 92 89 89 ARG ARG A . n A 1 93 ALA 93 90 90 ALA ALA A . n A 1 94 ASP 94 91 91 ASP ASP A . n A 1 95 ARG 95 92 92 ARG ARG A . n A 1 96 TRP 96 93 93 TRP TRP A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 HIS 98 95 95 HIS HIS A . n A 1 99 LYS 99 96 96 LYS LYS A . n A 1 100 VAL 100 97 97 VAL VAL A . n A 1 101 ASP 101 98 98 ASP ASP A . n A 1 102 LYS 102 99 99 LYS LYS A . n A 1 103 GLY 103 100 100 GLY GLY A . n A 1 104 LEU 104 101 101 LEU LEU A . n A 1 105 GLU 105 102 102 GLU GLU A . n A 1 106 LEU 106 103 103 LEU LEU A . n A 1 107 VAL 107 104 104 VAL VAL A . n A 1 108 PRO 108 105 105 PRO PRO A . n A 1 109 ALA 109 106 106 ALA ALA A . n A 1 110 GLN 110 107 107 GLN GLN A . n A 1 111 VAL 111 108 108 VAL VAL A . n A 1 112 ILE 112 109 109 ILE ILE A . n A 1 113 LEU 113 110 110 LEU LEU A . n A 1 114 THR 114 111 111 THR THR A . n A 1 115 GLY 115 112 112 GLY GLY A . n A 1 116 LEU 116 113 113 LEU LEU A . n A 1 117 LEU 117 114 114 LEU LEU A . n A 1 118 LEU 118 115 115 LEU LEU A . n A 1 119 LEU 119 116 116 LEU LEU A . n A 1 120 ARG 120 117 117 ARG ARG A . n A 1 121 GLY 121 118 118 GLY GLY A . n A 1 122 PRO 122 119 119 PRO PRO A . n A 1 123 GLN 123 120 120 GLN GLN A . n A 1 124 THR 124 121 121 THR THR A . n A 1 125 VAL 125 122 122 VAL VAL A . n A 1 126 SER 126 123 123 SER SER A . n A 1 127 GLU 127 124 124 GLU GLU A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 THR 130 127 127 THR THR A . n A 1 131 ARG 131 128 128 ARG ARG A . n A 1 132 SER 132 129 129 SER SER A . n A 1 133 ASN 133 130 130 ASN ASN A . n A 1 134 ARG 134 131 131 ARG ARG A . n A 1 135 MSE 135 132 132 MSE MSE A . n A 1 136 HIS 136 133 133 HIS HIS A . n A 1 137 ASP 137 134 134 ASP ASP A . n A 1 138 PHE 138 135 135 PHE PHE A . n A 1 139 GLU 139 136 136 GLU GLU A . n A 1 140 ASP 140 137 137 ASP ASP A . n A 1 141 SER 141 138 138 SER SER A . n A 1 142 GLU 142 139 139 GLU GLU A . n A 1 143 GLN 143 140 140 GLN GLN A . n A 1 144 VAL 144 141 141 VAL VAL A . n A 1 145 VAL 145 142 142 VAL VAL A . n A 1 146 HIS 146 143 143 HIS HIS A . n A 1 147 GLN 147 144 144 GLN GLN A . n A 1 148 LEU 148 145 145 LEU LEU A . n A 1 149 GLU 149 146 146 GLU GLU A . n A 1 150 ARG 150 147 147 ARG ARG A . n A 1 151 LEU 151 148 148 LEU LEU A . n A 1 152 ILE 152 149 149 ILE ILE A . n A 1 153 ALA 153 150 150 ALA ALA A . n A 1 154 ARG 154 151 151 ARG ARG A . n A 1 155 GLY 155 152 152 GLY GLY A . n A 1 156 LEU 156 153 153 LEU LEU A . n A 1 157 ALA 157 154 154 ALA ALA A . n A 1 158 THR 158 155 155 THR THR A . n A 1 159 LEU 159 156 156 LEU LEU A . n A 1 160 VAL 160 157 157 VAL VAL A . n A 1 161 PRO 161 158 158 PRO PRO A . n A 1 162 ARG 162 159 159 ARG ARG A . n A 1 163 GLN 163 160 160 GLN GLN A . n A 1 164 SER 164 161 161 SER SER A . n A 1 165 GLY 165 162 162 GLY GLY A . n A 1 166 GLN 166 163 163 GLN GLN A . n A 1 167 ARG 167 164 164 ARG ARG A . n A 1 168 GLU 168 165 165 GLU GLU A . n A 1 169 ASP 169 166 166 ASP ASP A . n A 1 170 ARG 170 167 167 ARG ARG A . n A 1 171 TYR 171 168 168 TYR TYR A . n A 1 172 MSE 172 169 169 MSE MSE A . n A 1 173 HIS 173 170 170 HIS HIS A . n A 1 174 LEU 174 171 171 LEU LEU A . n A 1 175 ILE 175 172 172 ILE ILE A . n A 1 176 GLY 176 173 173 GLY GLY A . n A 1 177 ASP 177 174 174 ASP ASP A . n A 1 178 PRO 178 175 175 PRO PRO A . n A 1 179 GLU 179 176 176 GLU GLU A . n A 1 180 ASP 180 177 177 ASP ASP A . n A 1 181 LEU 181 178 178 LEU LEU A . n A 1 182 GLN 182 179 179 GLN GLN A . n A 1 183 ASP 183 180 180 ASP ASP A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 181 1 HOH HOH A . B 2 HOH 2 182 2 HOH HOH A . B 2 HOH 3 183 3 HOH HOH A . B 2 HOH 4 184 4 HOH HOH A . B 2 HOH 5 185 5 HOH HOH A . B 2 HOH 6 186 6 HOH HOH A . B 2 HOH 7 187 7 HOH HOH A . B 2 HOH 8 188 8 HOH HOH A . B 2 HOH 9 189 9 HOH HOH A . B 2 HOH 10 190 10 HOH HOH A . B 2 HOH 11 191 11 HOH HOH A . B 2 HOH 12 192 12 HOH HOH A . B 2 HOH 13 193 13 HOH HOH A . B 2 HOH 14 194 14 HOH HOH A . B 2 HOH 15 195 15 HOH HOH A . B 2 HOH 16 196 16 HOH HOH A . B 2 HOH 17 197 17 HOH HOH A . B 2 HOH 18 198 18 HOH HOH A . B 2 HOH 19 199 19 HOH HOH A . B 2 HOH 20 200 20 HOH HOH A . B 2 HOH 21 201 21 HOH HOH A . B 2 HOH 22 202 22 HOH HOH A . B 2 HOH 23 203 23 HOH HOH A . B 2 HOH 24 204 24 HOH HOH A . B 2 HOH 25 205 25 HOH HOH A . B 2 HOH 26 206 26 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 65 A MSE 62 ? MET SELENOMETHIONINE 2 A MSE 89 A MSE 86 ? MET SELENOMETHIONINE 3 A MSE 135 A MSE 132 ? MET SELENOMETHIONINE 4 A MSE 172 A MSE 169 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-05 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Source and taxonomy' 3 2 'Structure model' 'Version format compliance' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -9.3850 _pdbx_refine_tls.origin_y 32.1110 _pdbx_refine_tls.origin_z 6.3250 _pdbx_refine_tls.T[1][1] -0.2744 _pdbx_refine_tls.T[2][2] -0.3008 _pdbx_refine_tls.T[3][3] 0.0356 _pdbx_refine_tls.T[1][2] -0.0241 _pdbx_refine_tls.T[1][3] 0.0066 _pdbx_refine_tls.T[2][3] 0.0163 _pdbx_refine_tls.L[1][1] 5.2695 _pdbx_refine_tls.L[2][2] 2.4448 _pdbx_refine_tls.L[3][3] 5.6473 _pdbx_refine_tls.L[1][2] 0.3501 _pdbx_refine_tls.L[1][3] 1.2784 _pdbx_refine_tls.L[2][3] 1.9780 _pdbx_refine_tls.S[1][1] 0.0817 _pdbx_refine_tls.S[1][2] -0.1377 _pdbx_refine_tls.S[1][3] 0.0590 _pdbx_refine_tls.S[2][1] -0.0383 _pdbx_refine_tls.S[2][2] -0.1175 _pdbx_refine_tls.S[2][3] 0.1038 _pdbx_refine_tls.S[3][1] 0.1379 _pdbx_refine_tls.S[3][2] 0.2373 _pdbx_refine_tls.S[3][3] 0.0358 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 13 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 16 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 180 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 183 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 SBC-Collect 'data collection' . ? 2 HKL-3000 'data reduction' . ? 3 HKL-3000 'data scaling' . ? 4 SHELXD phasing . ? 5 MLPHARE phasing . ? 6 DM phasing . ? 7 RESOLVE phasing . ? 8 HKL-3000 phasing . ? 9 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 102 ? ? 45.73 71.13 2 1 SER A 161 ? ? -37.32 123.19 3 1 ARG A 164 ? ? -102.91 43.52 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MSE 1 ? A MSE 4 5 1 Y 1 A SER 2 ? A SER 5 6 1 Y 1 A ILE 3 ? A ILE 6 7 1 Y 1 A GLU 4 ? A GLU 7 8 1 Y 1 A SER 5 ? A SER 8 9 1 Y 1 A SER 6 ? A SER 9 10 1 Y 1 A ALA 7 ? A ALA 10 11 1 Y 1 A THR 8 ? A THR 11 12 1 Y 1 A PRO 9 ? A PRO 12 13 1 Y 1 A THR 10 ? A THR 13 14 1 Y 1 A THR 11 ? A THR 14 15 1 Y 1 A PRO 12 ? A PRO 15 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #