data_3CPK # _entry.id 3CPK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3CPK RCSB RCSB047059 WWPDB D_1000047059 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id BeR31 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3CPK _pdbx_database_status.recvd_initial_deposition_date 2008-03-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vorobiev, S.M.' 1 'Abashidze, M.' 2 'Seetharaman, J.' 3 'Zhao, L.' 4 'Janjua, H.' 5 'Xiao, R.' 6 'Acton, T.B.' 7 'Montelione, G.T.' 8 'Tong, L.' 9 'Hunt, J.F.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title 'Crystal structure of the Q7W7N7_BORPA protein from Bordetella parapertussis.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vorobiev, S.M.' 1 primary 'Abashidze, M.' 2 primary 'Seetharaman, J.' 3 primary 'Zhao, L.' 4 primary 'Janjua, H.' 5 primary 'Acton, T.B.' 6 primary 'Montelione, G.T.' 7 primary 'Tong, L.' 8 primary 'Hunt, J.F.' 9 # _cell.entry_id 3CPK _cell.length_a 43.510 _cell.length_b 43.510 _cell.length_c 118.224 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3CPK _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein Q7W7N7_BORPA' 15990.487 1 ? ? ? ? 2 water nat water 18.015 44 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)KLHTDPATALNTVTAYGDGYIEVNQVRFSHAIAFAPEGPVASWPVQRPADITASLLQQAAGLAEVVRDPLAFLDE PEAGAGARPANAPEVLLVGTGRRQHLLGPEQVRPLLA(MSE)GVGVEA(MSE)DTQAAARTYNIL(MSE)AEGRRVVVAL LPDGDS ; _entity_poly.pdbx_seq_one_letter_code_can ;MKLHTDPATALNTVTAYGDGYIEVNQVRFSHAIAFAPEGPVASWPVQRPADITASLLQQAAGLAEVVRDPLAFLDEPEAG AGARPANAPEVLLVGTGRRQHLLGPEQVRPLLAMGVGVEAMDTQAAARTYNILMAEGRRVVVALLPDGDS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BeR31 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 LYS n 1 3 LEU n 1 4 HIS n 1 5 THR n 1 6 ASP n 1 7 PRO n 1 8 ALA n 1 9 THR n 1 10 ALA n 1 11 LEU n 1 12 ASN n 1 13 THR n 1 14 VAL n 1 15 THR n 1 16 ALA n 1 17 TYR n 1 18 GLY n 1 19 ASP n 1 20 GLY n 1 21 TYR n 1 22 ILE n 1 23 GLU n 1 24 VAL n 1 25 ASN n 1 26 GLN n 1 27 VAL n 1 28 ARG n 1 29 PHE n 1 30 SER n 1 31 HIS n 1 32 ALA n 1 33 ILE n 1 34 ALA n 1 35 PHE n 1 36 ALA n 1 37 PRO n 1 38 GLU n 1 39 GLY n 1 40 PRO n 1 41 VAL n 1 42 ALA n 1 43 SER n 1 44 TRP n 1 45 PRO n 1 46 VAL n 1 47 GLN n 1 48 ARG n 1 49 PRO n 1 50 ALA n 1 51 ASP n 1 52 ILE n 1 53 THR n 1 54 ALA n 1 55 SER n 1 56 LEU n 1 57 LEU n 1 58 GLN n 1 59 GLN n 1 60 ALA n 1 61 ALA n 1 62 GLY n 1 63 LEU n 1 64 ALA n 1 65 GLU n 1 66 VAL n 1 67 VAL n 1 68 ARG n 1 69 ASP n 1 70 PRO n 1 71 LEU n 1 72 ALA n 1 73 PHE n 1 74 LEU n 1 75 ASP n 1 76 GLU n 1 77 PRO n 1 78 GLU n 1 79 ALA n 1 80 GLY n 1 81 ALA n 1 82 GLY n 1 83 ALA n 1 84 ARG n 1 85 PRO n 1 86 ALA n 1 87 ASN n 1 88 ALA n 1 89 PRO n 1 90 GLU n 1 91 VAL n 1 92 LEU n 1 93 LEU n 1 94 VAL n 1 95 GLY n 1 96 THR n 1 97 GLY n 1 98 ARG n 1 99 ARG n 1 100 GLN n 1 101 HIS n 1 102 LEU n 1 103 LEU n 1 104 GLY n 1 105 PRO n 1 106 GLU n 1 107 GLN n 1 108 VAL n 1 109 ARG n 1 110 PRO n 1 111 LEU n 1 112 LEU n 1 113 ALA n 1 114 MSE n 1 115 GLY n 1 116 VAL n 1 117 GLY n 1 118 VAL n 1 119 GLU n 1 120 ALA n 1 121 MSE n 1 122 ASP n 1 123 THR n 1 124 GLN n 1 125 ALA n 1 126 ALA n 1 127 ALA n 1 128 ARG n 1 129 THR n 1 130 TYR n 1 131 ASN n 1 132 ILE n 1 133 LEU n 1 134 MSE n 1 135 ALA n 1 136 GLU n 1 137 GLY n 1 138 ARG n 1 139 ARG n 1 140 VAL n 1 141 VAL n 1 142 VAL n 1 143 ALA n 1 144 LEU n 1 145 LEU n 1 146 PRO n 1 147 ASP n 1 148 GLY n 1 149 ASP n 1 150 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bordetella _entity_src_gen.pdbx_gene_src_gene BPP2477 _entity_src_gen.gene_src_species 'Bordetella parapertussis' _entity_src_gen.gene_src_strain '12822 / NCTC 13253' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bordetella parapertussis 12822' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 257311 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc BAA-587 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector SUMO _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7W7N7_BORPA _struct_ref.pdbx_db_accession Q7W7N7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKLHTDPATALNTVTAYGDGYIEVNQVRFSHAIAFAPEGPVASWPVQRPADITASLLQQAAGLAEVVRDPLAFLDEPEAG AGARPANAPEVLLVGTGRRQHLLGPEQVRPLLAMGVGVEAMDTQAAARTYNILMAEGRRVVVALLPDGDS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3CPK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 150 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7W7N7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 150 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3CPK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.750 _exptl_crystal.density_percent_sol 29.70 _exptl_crystal.description 'The structure factor file contains Friedel pairs' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '15-20% PEG 8000, 0.1M Manganese chloride, 0.1M MOPS pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2008-01-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97901 1.0 2 0.97928 1.0 3 0.96785 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97901, 0.97928, 0.96785' # _reflns.entry_id 3CPK _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.50 _reflns.number_obs 15148 _reflns.number_all 15148 _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.120 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 20.4 _reflns.B_iso_Wilson_estimate 28.1 _reflns.pdbx_redundancy 5.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all 96.6 _reflns_shell.Rmerge_I_obs 0.565 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.95 _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1546 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3CPK _refine.ls_number_reflns_obs 6408 _refine.ls_number_reflns_all 7502 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 372303.38 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.83 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 85.4 _refine.ls_R_factor_obs 0.209 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.209 _refine.ls_R_factor_R_free 0.253 _refine.ls_R_factor_R_free_error 0.014 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.4 _refine.ls_number_reflns_R_free 345 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 44.3 _refine.aniso_B[1][1] 11.08 _refine.aniso_B[2][2] 11.08 _refine.aniso_B[3][3] -22.17 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.351461 _refine.solvent_model_param_bsol 57.2715 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'The Bijvoet differences were used in phasing' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3CPK _refine_analyze.Luzzati_coordinate_error_obs 0.28 _refine_analyze.Luzzati_sigma_a_obs 0.31 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.37 _refine_analyze.Luzzati_sigma_a_free 0.27 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 852 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 44 _refine_hist.number_atoms_total 896 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 40.83 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.7 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 26.3 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.27 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.50 _refine_ls_shell.d_res_low 2.66 _refine_ls_shell.number_reflns_R_work 775 _refine_ls_shell.R_factor_R_work 0.261 _refine_ls_shell.percent_reflns_obs 66.0 _refine_ls_shell.R_factor_R_free 0.281 _refine_ls_shell.R_factor_R_free_error 0.042 _refine_ls_shell.percent_reflns_R_free 5.4 _refine_ls_shell.number_reflns_R_free 44 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 3CPK _struct.title 'Crystal structure of the Q7W7N7_BORPA protein from Bordetella parapertussis. Northeast Structural Genomics Consortium target BeR31' _struct.pdbx_descriptor 'Uncharacterized protein Q7W7N7_BORPA' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3CPK _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;Q7W7N7_BORPA, BPP2477, BeR31, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'AUTHORS STATE THAT THE BIOLOGICAL UNIT IS A MONOMER ACCORDING TO AGGREGATION SCREENING' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 48 ? ILE A 52 ? ARG A 48 ILE A 52 5 ? 5 HELX_P HELX_P2 2 THR A 53 ? GLY A 62 ? THR A 53 GLY A 62 1 ? 10 HELX_P HELX_P3 3 GLY A 104 ? ALA A 113 ? GLY A 104 ALA A 113 1 ? 10 HELX_P HELX_P4 4 ASP A 122 ? GLU A 136 ? ASP A 122 GLU A 136 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ALA 113 C ? ? ? 1_555 A MSE 114 N ? ? A ALA 113 A MSE 114 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A MSE 114 C ? ? ? 1_555 A GLY 115 N ? ? A MSE 114 A GLY 115 1_555 ? ? ? ? ? ? ? 1.326 ? covale3 covale ? ? A ALA 120 C ? ? ? 1_555 A MSE 121 N ? ? A ALA 120 A MSE 121 1_555 ? ? ? ? ? ? ? 1.324 ? covale4 covale ? ? A MSE 121 C ? ? ? 1_555 A ASP 122 N ? ? A MSE 121 A ASP 122 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale ? ? A LEU 133 C ? ? ? 1_555 A MSE 134 N ? ? A LEU 133 A MSE 134 1_555 ? ? ? ? ? ? ? 1.325 ? covale6 covale ? ? A MSE 134 C ? ? ? 1_555 A ALA 135 N ? ? A MSE 134 A ALA 135 1_555 ? ? ? ? ? ? ? 1.328 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 14 ? GLY A 18 ? VAL A 14 GLY A 18 A 2 TYR A 21 ? VAL A 24 ? TYR A 21 VAL A 24 A 3 VAL A 27 ? PHE A 29 ? VAL A 27 PHE A 29 B 1 ALA A 42 ? SER A 43 ? ALA A 42 SER A 43 B 2 ILE A 33 ? PHE A 35 ? ILE A 33 PHE A 35 B 3 VAL A 140 ? LEU A 144 ? VAL A 140 LEU A 144 B 4 VAL A 91 ? GLY A 95 ? VAL A 91 GLY A 95 B 5 GLY A 117 ? MSE A 121 ? GLY A 117 MSE A 121 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 18 ? N GLY A 18 O TYR A 21 ? O TYR A 21 A 2 3 N VAL A 24 ? N VAL A 24 O VAL A 27 ? O VAL A 27 B 1 2 O ALA A 42 ? O ALA A 42 N ALA A 34 ? N ALA A 34 B 2 3 N ILE A 33 ? N ILE A 33 O LEU A 144 ? O LEU A 144 B 3 4 O ALA A 143 ? O ALA A 143 N GLY A 95 ? N GLY A 95 B 4 5 N VAL A 94 ? N VAL A 94 O GLU A 119 ? O GLU A 119 # _database_PDB_matrix.entry_id 3CPK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3CPK _atom_sites.fract_transf_matrix[1][1] 0.022983 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022983 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008459 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ARG 48 48 48 ARG ALA A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LEU 63 63 63 LEU ALA A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLU 65 65 ? ? ? A . n A 1 66 VAL 66 66 ? ? ? A . n A 1 67 VAL 67 67 ? ? ? A . n A 1 68 ARG 68 68 ? ? ? A . n A 1 69 ASP 69 69 ? ? ? A . n A 1 70 PRO 70 70 ? ? ? A . n A 1 71 LEU 71 71 ? ? ? A . n A 1 72 ALA 72 72 ? ? ? A . n A 1 73 PHE 73 73 ? ? ? A . n A 1 74 LEU 74 74 ? ? ? A . n A 1 75 ASP 75 75 ? ? ? A . n A 1 76 GLU 76 76 ? ? ? A . n A 1 77 PRO 77 77 ? ? ? A . n A 1 78 GLU 78 78 ? ? ? A . n A 1 79 ALA 79 79 ? ? ? A . n A 1 80 GLY 80 80 ? ? ? A . n A 1 81 ALA 81 81 ? ? ? A . n A 1 82 GLY 82 82 ? ? ? A . n A 1 83 ALA 83 83 ? ? ? A . n A 1 84 ARG 84 84 ? ? ? A . n A 1 85 PRO 85 85 ? ? ? A . n A 1 86 ALA 86 86 ? ? ? A . n A 1 87 ASN 87 87 ? ? ? A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 GLU 106 106 106 GLU ALA A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 MSE 114 114 114 MSE MSE A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 MSE 121 121 121 MSE MSE A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 MSE 134 134 134 MSE MSE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 ARG 139 139 139 ARG ALA A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 ASP 147 147 147 ASP ALA A . n A 1 148 GLY 148 148 ? ? ? A . n A 1 149 ASP 149 149 ? ? ? A . n A 1 150 SER 150 150 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 201 HOH WAT A . B 2 HOH 2 202 202 HOH WAT A . B 2 HOH 3 203 203 HOH WAT A . B 2 HOH 4 204 204 HOH WAT A . B 2 HOH 5 205 205 HOH WAT A . B 2 HOH 6 206 206 HOH WAT A . B 2 HOH 7 207 207 HOH WAT A . B 2 HOH 8 208 208 HOH WAT A . B 2 HOH 9 209 209 HOH WAT A . B 2 HOH 10 210 210 HOH WAT A . B 2 HOH 11 211 211 HOH WAT A . B 2 HOH 12 212 212 HOH WAT A . B 2 HOH 13 213 213 HOH WAT A . B 2 HOH 14 214 214 HOH WAT A . B 2 HOH 15 215 215 HOH WAT A . B 2 HOH 16 216 216 HOH WAT A . B 2 HOH 17 217 217 HOH WAT A . B 2 HOH 18 218 218 HOH WAT A . B 2 HOH 19 219 219 HOH WAT A . B 2 HOH 20 220 220 HOH WAT A . B 2 HOH 21 221 221 HOH WAT A . B 2 HOH 22 222 222 HOH WAT A . B 2 HOH 23 223 223 HOH WAT A . B 2 HOH 24 224 224 HOH WAT A . B 2 HOH 25 225 225 HOH WAT A . B 2 HOH 26 226 226 HOH WAT A . B 2 HOH 27 227 227 HOH WAT A . B 2 HOH 28 228 228 HOH WAT A . B 2 HOH 29 229 229 HOH WAT A . B 2 HOH 30 230 230 HOH WAT A . B 2 HOH 31 231 231 HOH WAT A . B 2 HOH 32 232 232 HOH WAT A . B 2 HOH 33 233 233 HOH WAT A . B 2 HOH 34 234 234 HOH WAT A . B 2 HOH 35 235 235 HOH WAT A . B 2 HOH 36 236 236 HOH WAT A . B 2 HOH 37 237 237 HOH WAT A . B 2 HOH 38 238 238 HOH WAT A . B 2 HOH 39 239 239 HOH WAT A . B 2 HOH 40 240 240 HOH WAT A . B 2 HOH 41 241 241 HOH WAT A . B 2 HOH 42 242 242 HOH WAT A . B 2 HOH 43 243 243 HOH WAT A . B 2 HOH 44 244 244 HOH WAT A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 114 A MSE 114 ? MET SELENOMETHIONINE 2 A MSE 121 A MSE 121 ? MET SELENOMETHIONINE 3 A MSE 134 A MSE 134 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Author supporting evidence' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category pdbx_struct_assembly_auth_evidence # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 HKL-2000 'data collection' . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 SOLVE phasing . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 8 ? ? -105.07 67.87 2 1 PRO A 45 ? ? -60.39 65.60 3 1 GLN A 47 ? ? -143.48 -23.37 4 1 PRO A 49 ? ? -45.42 -17.04 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 48 ? CG ? A ARG 48 CG 2 1 Y 1 A ARG 48 ? CD ? A ARG 48 CD 3 1 Y 1 A ARG 48 ? NE ? A ARG 48 NE 4 1 Y 1 A ARG 48 ? CZ ? A ARG 48 CZ 5 1 Y 1 A ARG 48 ? NH1 ? A ARG 48 NH1 6 1 Y 1 A ARG 48 ? NH2 ? A ARG 48 NH2 7 1 Y 1 A LEU 63 ? CG ? A LEU 63 CG 8 1 Y 1 A LEU 63 ? CD1 ? A LEU 63 CD1 9 1 Y 1 A LEU 63 ? CD2 ? A LEU 63 CD2 10 1 Y 1 A GLU 106 ? CG ? A GLU 106 CG 11 1 Y 1 A GLU 106 ? CD ? A GLU 106 CD 12 1 Y 1 A GLU 106 ? OE1 ? A GLU 106 OE1 13 1 Y 1 A GLU 106 ? OE2 ? A GLU 106 OE2 14 1 Y 1 A ARG 139 ? CG ? A ARG 139 CG 15 1 Y 1 A ARG 139 ? CD ? A ARG 139 CD 16 1 Y 1 A ARG 139 ? NE ? A ARG 139 NE 17 1 Y 1 A ARG 139 ? CZ ? A ARG 139 CZ 18 1 Y 1 A ARG 139 ? NH1 ? A ARG 139 NH1 19 1 Y 1 A ARG 139 ? NH2 ? A ARG 139 NH2 20 1 Y 1 A ASP 147 ? CG ? A ASP 147 CG 21 1 Y 1 A ASP 147 ? OD1 ? A ASP 147 OD1 22 1 Y 1 A ASP 147 ? OD2 ? A ASP 147 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A GLU 65 ? A GLU 65 8 1 Y 1 A VAL 66 ? A VAL 66 9 1 Y 1 A VAL 67 ? A VAL 67 10 1 Y 1 A ARG 68 ? A ARG 68 11 1 Y 1 A ASP 69 ? A ASP 69 12 1 Y 1 A PRO 70 ? A PRO 70 13 1 Y 1 A LEU 71 ? A LEU 71 14 1 Y 1 A ALA 72 ? A ALA 72 15 1 Y 1 A PHE 73 ? A PHE 73 16 1 Y 1 A LEU 74 ? A LEU 74 17 1 Y 1 A ASP 75 ? A ASP 75 18 1 Y 1 A GLU 76 ? A GLU 76 19 1 Y 1 A PRO 77 ? A PRO 77 20 1 Y 1 A GLU 78 ? A GLU 78 21 1 Y 1 A ALA 79 ? A ALA 79 22 1 Y 1 A GLY 80 ? A GLY 80 23 1 Y 1 A ALA 81 ? A ALA 81 24 1 Y 1 A GLY 82 ? A GLY 82 25 1 Y 1 A ALA 83 ? A ALA 83 26 1 Y 1 A ARG 84 ? A ARG 84 27 1 Y 1 A PRO 85 ? A PRO 85 28 1 Y 1 A ALA 86 ? A ALA 86 29 1 Y 1 A ASN 87 ? A ASN 87 30 1 Y 1 A GLY 148 ? A GLY 148 31 1 Y 1 A ASP 149 ? A ASP 149 32 1 Y 1 A SER 150 ? A SER 150 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'assay for oligomerization' _pdbx_struct_assembly_auth_evidence.details ? #