data_3CS1 # _entry.id 3CS1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3CS1 RCSB RCSB047142 WWPDB D_1000047142 # _pdbx_database_status.entry_id 3CS1 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-04-08 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ames, J.B.' 1 'Ladner, J.E.' 2 'Wingard, J.N.' 3 'Robinson, H.' 4 'Fisher, A.' 5 # _citation.id primary _citation.title ;Structural Insights into Membrane Targeting by the Flagellar Calcium-binding Protein (FCaBP), a Myristoylated and Palmitoylated Calcium Sensor in Trypanosoma cruzi. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 23388 _citation.page_last 23396 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18559337 _citation.pdbx_database_id_DOI 10.1074/jbc.M803178200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wingard, J.N.' 1 primary 'Ladner, J.' 2 primary 'Vanarotti, M.' 3 primary 'Fisher, A.J.' 4 primary 'Robinson, H.' 5 primary 'Buchanan, K.T.' 6 primary 'Engman, D.M.' 7 primary 'Ames, J.B.' 8 # _cell.entry_id 3CS1 _cell.length_a 32.910 _cell.length_b 37.670 _cell.length_c 141.330 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3CS1 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Flagellar calcium-binding protein' 24955.055 1 ? ? ? ? 2 water nat water 18.015 65 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FCABP, 1F8 protein, P24, 29 kDa flagella protein, F29, 24 kDa antigen, ALC-1 antigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGACGSKGSTSDKGLASDKDGKKAKDRKEAWERIRQAIPREKTAEAKQRRIELFKKFDKNETGKL(CSX)YDEVYSGCLE VLKLDEFTSRVRDITKRAFDKSRTLGSKLENKGSEDFVEFLEFRLMLCYIYDFFELTVMFDEIDASGNMLVDEEEFKRAV PKLEAWGAKVEDPAALFKELDKNGTGSVTFDEFAAWASAVKLDADGDPDNVPESALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGACGSKGSTSDKGLASDKDGKKAKDRKEAWERIRQAIPREKTAEAKQRRIELFKKFDKNETGKLCYDEVYSGCLEVLKL DEFTSRVRDITKRAFDKSRTLGSKLENKGSEDFVEFLEFRLMLCYIYDFFELTVMFDEIDASGNMLVDEEEFKRAVPKLE AWGAKVEDPAALFKELDKNGTGSVTFDEFAAWASAVKLDADGDPDNVPESALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ALA n 1 4 CYS n 1 5 GLY n 1 6 SER n 1 7 LYS n 1 8 GLY n 1 9 SER n 1 10 THR n 1 11 SER n 1 12 ASP n 1 13 LYS n 1 14 GLY n 1 15 LEU n 1 16 ALA n 1 17 SER n 1 18 ASP n 1 19 LYS n 1 20 ASP n 1 21 GLY n 1 22 LYS n 1 23 LYS n 1 24 ALA n 1 25 LYS n 1 26 ASP n 1 27 ARG n 1 28 LYS n 1 29 GLU n 1 30 ALA n 1 31 TRP n 1 32 GLU n 1 33 ARG n 1 34 ILE n 1 35 ARG n 1 36 GLN n 1 37 ALA n 1 38 ILE n 1 39 PRO n 1 40 ARG n 1 41 GLU n 1 42 LYS n 1 43 THR n 1 44 ALA n 1 45 GLU n 1 46 ALA n 1 47 LYS n 1 48 GLN n 1 49 ARG n 1 50 ARG n 1 51 ILE n 1 52 GLU n 1 53 LEU n 1 54 PHE n 1 55 LYS n 1 56 LYS n 1 57 PHE n 1 58 ASP n 1 59 LYS n 1 60 ASN n 1 61 GLU n 1 62 THR n 1 63 GLY n 1 64 LYS n 1 65 LEU n 1 66 CSX n 1 67 TYR n 1 68 ASP n 1 69 GLU n 1 70 VAL n 1 71 TYR n 1 72 SER n 1 73 GLY n 1 74 CYS n 1 75 LEU n 1 76 GLU n 1 77 VAL n 1 78 LEU n 1 79 LYS n 1 80 LEU n 1 81 ASP n 1 82 GLU n 1 83 PHE n 1 84 THR n 1 85 SER n 1 86 ARG n 1 87 VAL n 1 88 ARG n 1 89 ASP n 1 90 ILE n 1 91 THR n 1 92 LYS n 1 93 ARG n 1 94 ALA n 1 95 PHE n 1 96 ASP n 1 97 LYS n 1 98 SER n 1 99 ARG n 1 100 THR n 1 101 LEU n 1 102 GLY n 1 103 SER n 1 104 LYS n 1 105 LEU n 1 106 GLU n 1 107 ASN n 1 108 LYS n 1 109 GLY n 1 110 SER n 1 111 GLU n 1 112 ASP n 1 113 PHE n 1 114 VAL n 1 115 GLU n 1 116 PHE n 1 117 LEU n 1 118 GLU n 1 119 PHE n 1 120 ARG n 1 121 LEU n 1 122 MET n 1 123 LEU n 1 124 CYS n 1 125 TYR n 1 126 ILE n 1 127 TYR n 1 128 ASP n 1 129 PHE n 1 130 PHE n 1 131 GLU n 1 132 LEU n 1 133 THR n 1 134 VAL n 1 135 MET n 1 136 PHE n 1 137 ASP n 1 138 GLU n 1 139 ILE n 1 140 ASP n 1 141 ALA n 1 142 SER n 1 143 GLY n 1 144 ASN n 1 145 MET n 1 146 LEU n 1 147 VAL n 1 148 ASP n 1 149 GLU n 1 150 GLU n 1 151 GLU n 1 152 PHE n 1 153 LYS n 1 154 ARG n 1 155 ALA n 1 156 VAL n 1 157 PRO n 1 158 LYS n 1 159 LEU n 1 160 GLU n 1 161 ALA n 1 162 TRP n 1 163 GLY n 1 164 ALA n 1 165 LYS n 1 166 VAL n 1 167 GLU n 1 168 ASP n 1 169 PRO n 1 170 ALA n 1 171 ALA n 1 172 LEU n 1 173 PHE n 1 174 LYS n 1 175 GLU n 1 176 LEU n 1 177 ASP n 1 178 LYS n 1 179 ASN n 1 180 GLY n 1 181 THR n 1 182 GLY n 1 183 SER n 1 184 VAL n 1 185 THR n 1 186 PHE n 1 187 ASP n 1 188 GLU n 1 189 PHE n 1 190 ALA n 1 191 ALA n 1 192 TRP n 1 193 ALA n 1 194 SER n 1 195 ALA n 1 196 VAL n 1 197 LYS n 1 198 LEU n 1 199 ASP n 1 200 ALA n 1 201 ASP n 1 202 GLY n 1 203 ASP n 1 204 PRO n 1 205 ASP n 1 206 ASN n 1 207 VAL n 1 208 PRO n 1 209 GLU n 1 210 SER n 1 211 ALA n 1 212 LEU n 1 213 GLU n 1 214 HIS n 1 215 HIS n 1 216 HIS n 1 217 HIS n 1 218 HIS n 1 219 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FCABP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Trypanosoma cruzi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET23d _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FCA1_TRYCR _struct_ref.pdbx_db_accession P07749 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGACGSKGSTSDKGLASDKDGKKAKDRKEAWERIRQAIPREKTAEAKQRRIELFKKFDKNETGKLCYDEVHSGCLEVLKL DEFTPRVRDITKRAFDKARALGSKLENKGSEDFVEFLEFRLMLCYIYDFFELTVMFDEIDASGNMLVDEEELKRAVPKLE AWGAKVEDPAALFKELDKNGTGSVTFDEFAAWASAVKLDADGDPDNVPESA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3CS1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 211 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07749 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 211 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 211 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3CS1 TYR A 71 ? UNP P07749 HIS 71 VARIANT 71 1 1 3CS1 SER A 85 ? UNP P07749 PRO 85 VARIANT 85 2 1 3CS1 SER A 98 ? UNP P07749 ALA 98 VARIANT 98 3 1 3CS1 THR A 100 ? UNP P07749 ALA 100 VARIANT 100 4 1 3CS1 PHE A 152 ? UNP P07749 LEU 152 VARIANT 152 5 1 3CS1 LEU A 212 ? UNP P07749 ? ? 'EXPRESSION TAG' 212 6 1 3CS1 GLU A 213 ? UNP P07749 ? ? 'EXPRESSION TAG' 213 7 1 3CS1 HIS A 214 ? UNP P07749 ? ? 'EXPRESSION TAG' 214 8 1 3CS1 HIS A 215 ? UNP P07749 ? ? 'EXPRESSION TAG' 215 9 1 3CS1 HIS A 216 ? UNP P07749 ? ? 'EXPRESSION TAG' 216 10 1 3CS1 HIS A 217 ? UNP P07749 ? ? 'EXPRESSION TAG' 217 11 1 3CS1 HIS A 218 ? UNP P07749 ? ? 'EXPRESSION TAG' 218 12 1 3CS1 HIS A 219 ? UNP P07749 ? ? 'EXPRESSION TAG' 219 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSX 'L-peptide linking' n 'S-OXY CYSTEINE' ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3CS1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.76 _exptl_crystal.density_percent_sol 29.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.00 _exptl_crystal_grow.pdbx_details ;well solution: 2.88M ammonium sulfate, 0.09M MES pH 6.0, 0.075 magnesium chloride, 0.01M sodium acetate pH 4.6., hanging drop vapor diffusion, temperature 298K, pH 6.00 ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 105.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2005-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'MSC BLUE CONFOCAL OPTICS' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU MICROMAX-007' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 3CS1 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 29.840 _reflns.d_resolution_high 2.000 _reflns.number_obs 12558 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 97.9 _reflns_shell.Rmerge_I_obs 0.30800 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.100 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3CS1 _refine.ls_number_reflns_obs 12496 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 99.8 _refine.ls_R_factor_obs 0.216 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.212 _refine.ls_R_factor_R_free 0.288 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 600 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.949 _refine.correlation_coeff_Fo_to_Fc_free 0.904 _refine.B_iso_mean 31.00 _refine.aniso_B[1][1] -0.59000 _refine.aniso_B[2][2] 2.05000 _refine.aniso_B[3][3] -1.46000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.179 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 12.718 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1556 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 65 _refine_hist.number_atoms_total 1621 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.019 0.022 ? 1665 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.741 1.973 ? 2246 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.188 5.000 ? 211 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.730 24.396 ? 91 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.151 15.000 ? 328 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 19.374 15.000 ? 15 'X-RAY DIFFRACTION' ? r_chiral_restr 0.113 0.200 ? 234 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1283 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.218 0.200 ? 812 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.311 0.200 ? 1152 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.188 0.200 ? 99 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.228 0.200 ? 52 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.274 0.200 ? 20 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.971 1.500 ? 1018 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.434 2.000 ? 1592 'X-RAY DIFFRACTION' ? r_scbond_it 2.497 3.000 ? 729 'X-RAY DIFFRACTION' ? r_scangle_it 3.652 4.500 ? 643 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.11 _refine_ls_shell.number_reflns_R_work 1683 _refine_ls_shell.R_factor_R_work 0.2510 _refine_ls_shell.percent_reflns_obs 99.83 _refine_ls_shell.R_factor_R_free 0.3310 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 96 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3CS1 _struct.title 'Flagellar Calcium-binding Protein (FCaBP) from T. cruzi' _struct.pdbx_descriptor 'Flagellar calcium-binding protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3CS1 _struct_keywords.text ;flagella, calcium-binding, myristoylated, palmitoylated, sensor, membrane targeting, EF-hand, Cell projection, Cilium, Flagellum, METAL BINDING PROTEIN ; _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 23 ? ILE A 38 ? LYS A 23 ILE A 38 1 ? 16 HELX_P HELX_P2 2 THR A 43 ? ASP A 58 ? THR A 43 ASP A 58 1 ? 16 HELX_P HELX_P3 3 CSX A 66 ? VAL A 77 ? CSX A 66 VAL A 77 1 ? 12 HELX_P HELX_P4 4 LYS A 79 ? PHE A 83 ? LYS A 79 PHE A 83 5 ? 5 HELX_P HELX_P5 5 ARG A 86 ? ASN A 107 ? ARG A 86 ASN A 107 1 ? 22 HELX_P HELX_P6 6 GLU A 115 ? GLU A 138 ? GLU A 115 GLU A 138 1 ? 24 HELX_P HELX_P7 7 GLU A 149 ? GLY A 163 ? GLU A 149 GLY A 163 1 ? 15 HELX_P HELX_P8 8 ASP A 168 ? ASP A 177 ? ASP A 168 ASP A 177 1 ? 10 HELX_P HELX_P9 9 PHE A 186 ? GLY A 202 ? PHE A 186 GLY A 202 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LEU 65 C ? ? ? 1_555 A CSX 66 N ? ? A LEU 65 A CSX 66 1_555 ? ? ? ? ? ? ? 1.324 ? covale2 covale ? ? A CSX 66 C ? ? ? 1_555 A TYR 67 N ? ? A CSX 66 A TYR 67 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 207 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 207 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 208 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 208 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.22 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 146 ? ASP A 148 ? LEU A 146 ASP A 148 A 2 SER A 183 ? THR A 185 ? SER A 183 THR A 185 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 147 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 147 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 184 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 184 # _atom_sites.entry_id 3CS1 _atom_sites.fract_transf_matrix[1][1] 0.030386 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026546 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007076 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 CYS 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 SER 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 THR 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 ASP 12 12 ? ? ? A . n A 1 13 LYS 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 CSX 66 66 66 CSX CSX A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 CYS 124 124 124 CYS CYS A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 TYR 127 127 127 TYR TYR A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 TRP 192 192 192 TRP TRP A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 SER 194 194 194 SER SER A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 ASN 206 206 206 ASN ASN A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 PRO 208 208 208 PRO PRO A . n A 1 209 GLU 209 209 ? ? ? A . n A 1 210 SER 210 210 ? ? ? A . n A 1 211 ALA 211 211 ? ? ? A . n A 1 212 LEU 212 212 ? ? ? A . n A 1 213 GLU 213 213 ? ? ? A . n A 1 214 HIS 214 214 ? ? ? A . n A 1 215 HIS 215 215 ? ? ? A . n A 1 216 HIS 216 216 ? ? ? A . n A 1 217 HIS 217 217 ? ? ? A . n A 1 218 HIS 218 218 ? ? ? A . n A 1 219 HIS 219 219 ? ? ? A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSX _pdbx_struct_mod_residue.label_seq_id 66 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSX _pdbx_struct_mod_residue.auth_seq_id 66 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'S-OXY CYSTEINE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-06-24 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 13.0352 _pdbx_refine_tls.origin_y -1.4832 _pdbx_refine_tls.origin_z -16.7111 _pdbx_refine_tls.T[1][1] -0.0618 _pdbx_refine_tls.T[2][2] -0.1139 _pdbx_refine_tls.T[3][3] 0.0126 _pdbx_refine_tls.T[1][2] -0.0223 _pdbx_refine_tls.T[1][3] 0.0015 _pdbx_refine_tls.T[2][3] -0.0057 _pdbx_refine_tls.L[1][1] 0.8318 _pdbx_refine_tls.L[2][2] 0.5322 _pdbx_refine_tls.L[3][3] 6.6796 _pdbx_refine_tls.L[1][2] 0.0284 _pdbx_refine_tls.L[1][3] -0.3250 _pdbx_refine_tls.L[2][3] -1.1823 _pdbx_refine_tls.S[1][1] -0.0247 _pdbx_refine_tls.S[1][2] 0.1055 _pdbx_refine_tls.S[1][3] 0.0070 _pdbx_refine_tls.S[2][1] -0.0697 _pdbx_refine_tls.S[2][2] -0.0212 _pdbx_refine_tls.S[2][3] 0.0262 _pdbx_refine_tls.S[3][1] 0.3274 _pdbx_refine_tls.S[3][2] -0.2478 _pdbx_refine_tls.S[3][3] 0.0459 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 17 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 17 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 208 _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 208 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.selection_details ? # _phasing.method SAD # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal d*TREK 9.1SSI 'Mar 19 2004' package 'Pflugrath, J.W.' jwp@RigakuMSC.com 'data scaling' http://www.msc.com/protein/dtrek.html ? ? 1 SHELX . ? package 'George Sheldrick' gsheldr@shelx.uni-ac.gwdg.de phasing http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 2 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 3 PDB_EXTRACT 3.005 'September 10, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 4 SHELXD . ? ? ? ? phasing ? ? ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 89 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 93 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 A _pdbx_validate_close_contact.dist 2.15 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 86 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -108.73 _pdbx_validate_torsion.psi 57.10 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A CYS 4 ? A CYS 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A SER 6 ? A SER 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A THR 10 ? A THR 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A ASP 12 ? A ASP 12 13 1 Y 1 A LYS 13 ? A LYS 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A GLU 209 ? A GLU 209 18 1 Y 1 A SER 210 ? A SER 210 19 1 Y 1 A ALA 211 ? A ALA 211 20 1 Y 1 A LEU 212 ? A LEU 212 21 1 Y 1 A GLU 213 ? A GLU 213 22 1 Y 1 A HIS 214 ? A HIS 214 23 1 Y 1 A HIS 215 ? A HIS 215 24 1 Y 1 A HIS 216 ? A HIS 216 25 1 Y 1 A HIS 217 ? A HIS 217 26 1 Y 1 A HIS 218 ? A HIS 218 27 1 Y 1 A HIS 219 ? A HIS 219 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 220 1 HOH HOH A . B 2 HOH 2 221 2 HOH HOH A . B 2 HOH 3 222 3 HOH HOH A . B 2 HOH 4 223 4 HOH HOH A . B 2 HOH 5 224 5 HOH HOH A . B 2 HOH 6 225 6 HOH HOH A . B 2 HOH 7 226 7 HOH HOH A . B 2 HOH 8 227 8 HOH HOH A . B 2 HOH 9 228 9 HOH HOH A . B 2 HOH 10 229 10 HOH HOH A . B 2 HOH 11 230 11 HOH HOH A . B 2 HOH 12 231 12 HOH HOH A . B 2 HOH 13 232 13 HOH HOH A . B 2 HOH 14 233 14 HOH HOH A . B 2 HOH 15 234 15 HOH HOH A . B 2 HOH 16 235 16 HOH HOH A . B 2 HOH 17 236 17 HOH HOH A . B 2 HOH 18 237 18 HOH HOH A . B 2 HOH 19 238 19 HOH HOH A . B 2 HOH 20 239 20 HOH HOH A . B 2 HOH 21 240 21 HOH HOH A . B 2 HOH 22 241 22 HOH HOH A . B 2 HOH 23 242 23 HOH HOH A . B 2 HOH 24 243 24 HOH HOH A . B 2 HOH 25 244 25 HOH HOH A . B 2 HOH 26 245 26 HOH HOH A . B 2 HOH 27 246 27 HOH HOH A . B 2 HOH 28 247 28 HOH HOH A . B 2 HOH 29 248 29 HOH HOH A . B 2 HOH 30 249 30 HOH HOH A . B 2 HOH 31 250 31 HOH HOH A . B 2 HOH 32 251 32 HOH HOH A . B 2 HOH 33 252 33 HOH HOH A . B 2 HOH 34 253 34 HOH HOH A . B 2 HOH 35 254 35 HOH HOH A . B 2 HOH 36 255 36 HOH HOH A . B 2 HOH 37 256 37 HOH HOH A . B 2 HOH 38 257 38 HOH HOH A . B 2 HOH 39 258 39 HOH HOH A . B 2 HOH 40 259 40 HOH HOH A . B 2 HOH 41 260 41 HOH HOH A . B 2 HOH 42 261 42 HOH HOH A . B 2 HOH 43 262 43 HOH HOH A . B 2 HOH 44 263 44 HOH HOH A . B 2 HOH 45 264 45 HOH HOH A . B 2 HOH 46 265 46 HOH HOH A . B 2 HOH 47 266 47 HOH HOH A . B 2 HOH 48 267 48 HOH HOH A . B 2 HOH 49 268 49 HOH HOH A . B 2 HOH 50 269 50 HOH HOH A . B 2 HOH 51 270 51 HOH HOH A . B 2 HOH 52 271 52 HOH HOH A . B 2 HOH 53 272 53 HOH HOH A . B 2 HOH 54 273 54 HOH HOH A . B 2 HOH 55 274 55 HOH HOH A . B 2 HOH 56 275 56 HOH HOH A . B 2 HOH 57 276 57 HOH HOH A . B 2 HOH 58 277 58 HOH HOH A . B 2 HOH 59 278 59 HOH HOH A . B 2 HOH 60 279 60 HOH HOH A . B 2 HOH 61 280 61 HOH HOH A . B 2 HOH 62 281 62 HOH HOH A . B 2 HOH 63 282 63 HOH HOH A . B 2 HOH 64 283 64 HOH HOH A . B 2 HOH 65 284 65 HOH HOH A . #