data_3FEZ # _entry.id 3FEZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.365 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3FEZ pdb_00003fez 10.2210/pdb3fez/pdb RCSB RCSB050507 ? ? WWPDB D_1000050507 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id 390913 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.SG_entry Y _pdbx_database_status.entry_id 3FEZ _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-12-01 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Joint Center for Structural Genomics (JCSG)' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Crystal structure of uncharacterized ferredoxin fold protein related to antibiotic biosynthesis monooxygenases (YP_014836.1) from LISTERIA MONOCYTOGENES 4b F2365 at 2.10 A resolution ; _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Joint Center for Structural Genomics (JCSG)' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _cell.entry_id 3FEZ _cell.length_a 73.220 _cell.length_b 73.220 _cell.length_c 214.380 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3FEZ _symmetry.Int_Tables_number 178 _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'uncharacterized ferredoxin fold protein related to antibiotic biosynthesis monooxygenases' 22117.885 1 ? ? ? ? 2 water nat water 18.015 84 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GSDKIHHHHHHENLYFQG(MSE)KKVFITTGTEHYLRQL(MSE)ANYTGGNVTLLQNFSQSLLYQESTGEKLFQE GAEYRVLQSSGSLKGFGVVVFEYIHLRDEEIPIFLQ(MSE)YQRASLHFSETPGLQSTKLTKA(MSE)N(MSE)NKFLII SFWDSEVFFHDWKKTPLSKEITNI(MSE)KKNNTQSGFSHEDIYHYPEFSHDAK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSDKIHHHHHHENLYFQGMKKVFITTGTEHYLRQLMANYTGGNVTLLQNFSQSLLYQESTGEKLFQEGAEYRVLQSSGS LKGFGVVVFEYIHLRDEEIPIFLQMYQRASLHFSETPGLQSTKLTKAMNMNKFLIISFWDSEVFFHDWKKTPLSKEITNI MKKNNTQSGFSHEDIYHYPEFSHDAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 390913 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 SER n 1 4 ASP n 1 5 LYS n 1 6 ILE n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 GLU n 1 14 ASN n 1 15 LEU n 1 16 TYR n 1 17 PHE n 1 18 GLN n 1 19 GLY n 1 20 MSE n 1 21 LYS n 1 22 LYS n 1 23 VAL n 1 24 PHE n 1 25 ILE n 1 26 THR n 1 27 THR n 1 28 GLY n 1 29 THR n 1 30 GLU n 1 31 HIS n 1 32 TYR n 1 33 LEU n 1 34 ARG n 1 35 GLN n 1 36 LEU n 1 37 MSE n 1 38 ALA n 1 39 ASN n 1 40 TYR n 1 41 THR n 1 42 GLY n 1 43 GLY n 1 44 ASN n 1 45 VAL n 1 46 THR n 1 47 LEU n 1 48 LEU n 1 49 GLN n 1 50 ASN n 1 51 PHE n 1 52 SER n 1 53 GLN n 1 54 SER n 1 55 LEU n 1 56 LEU n 1 57 TYR n 1 58 GLN n 1 59 GLU n 1 60 SER n 1 61 THR n 1 62 GLY n 1 63 GLU n 1 64 LYS n 1 65 LEU n 1 66 PHE n 1 67 GLN n 1 68 GLU n 1 69 GLY n 1 70 ALA n 1 71 GLU n 1 72 TYR n 1 73 ARG n 1 74 VAL n 1 75 LEU n 1 76 GLN n 1 77 SER n 1 78 SER n 1 79 GLY n 1 80 SER n 1 81 LEU n 1 82 LYS n 1 83 GLY n 1 84 PHE n 1 85 GLY n 1 86 VAL n 1 87 VAL n 1 88 VAL n 1 89 PHE n 1 90 GLU n 1 91 TYR n 1 92 ILE n 1 93 HIS n 1 94 LEU n 1 95 ARG n 1 96 ASP n 1 97 GLU n 1 98 GLU n 1 99 ILE n 1 100 PRO n 1 101 ILE n 1 102 PHE n 1 103 LEU n 1 104 GLN n 1 105 MSE n 1 106 TYR n 1 107 GLN n 1 108 ARG n 1 109 ALA n 1 110 SER n 1 111 LEU n 1 112 HIS n 1 113 PHE n 1 114 SER n 1 115 GLU n 1 116 THR n 1 117 PRO n 1 118 GLY n 1 119 LEU n 1 120 GLN n 1 121 SER n 1 122 THR n 1 123 LYS n 1 124 LEU n 1 125 THR n 1 126 LYS n 1 127 ALA n 1 128 MSE n 1 129 ASN n 1 130 MSE n 1 131 ASN n 1 132 LYS n 1 133 PHE n 1 134 LEU n 1 135 ILE n 1 136 ILE n 1 137 SER n 1 138 PHE n 1 139 TRP n 1 140 ASP n 1 141 SER n 1 142 GLU n 1 143 VAL n 1 144 PHE n 1 145 PHE n 1 146 HIS n 1 147 ASP n 1 148 TRP n 1 149 LYS n 1 150 LYS n 1 151 THR n 1 152 PRO n 1 153 LEU n 1 154 SER n 1 155 LYS n 1 156 GLU n 1 157 ILE n 1 158 THR n 1 159 ASN n 1 160 ILE n 1 161 MSE n 1 162 LYS n 1 163 LYS n 1 164 ASN n 1 165 ASN n 1 166 THR n 1 167 GLN n 1 168 SER n 1 169 GLY n 1 170 PHE n 1 171 SER n 1 172 HIS n 1 173 GLU n 1 174 ASP n 1 175 ILE n 1 176 TYR n 1 177 HIS n 1 178 TYR n 1 179 PRO n 1 180 GLU n 1 181 PHE n 1 182 SER n 1 183 HIS n 1 184 ASP n 1 185 ALA n 1 186 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'LMOf2365_2246, YP_014836.1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria monocytogenes str. 4b F2365' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 265669 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia Coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HK100 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name SpeedET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q71XF2_LISMF _struct_ref.pdbx_db_accession Q71XF2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKVFITTGTEHYLRQLMANYTGGNVTLLQNFSQSLLYQESTGEKLFQEGAEYRVLQSSGSLKGFGVVVFEYIHLRDEEI PIFLQMYQRASLHFSETPGLQSTKLTKAMNMNKFLIISFWDSEVFFHDWKKTPLSKEITNIMKKNNTQSGFSHEDIYHYP EFSHDAK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3FEZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 186 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q71XF2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 167 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 167 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3FEZ MSE A 1 ? UNP Q71XF2 ? ? 'expression tag' -18 1 1 3FEZ GLY A 2 ? UNP Q71XF2 ? ? 'expression tag' -17 2 1 3FEZ SER A 3 ? UNP Q71XF2 ? ? 'expression tag' -16 3 1 3FEZ ASP A 4 ? UNP Q71XF2 ? ? 'expression tag' -15 4 1 3FEZ LYS A 5 ? UNP Q71XF2 ? ? 'expression tag' -14 5 1 3FEZ ILE A 6 ? UNP Q71XF2 ? ? 'expression tag' -13 6 1 3FEZ HIS A 7 ? UNP Q71XF2 ? ? 'expression tag' -12 7 1 3FEZ HIS A 8 ? UNP Q71XF2 ? ? 'expression tag' -11 8 1 3FEZ HIS A 9 ? UNP Q71XF2 ? ? 'expression tag' -10 9 1 3FEZ HIS A 10 ? UNP Q71XF2 ? ? 'expression tag' -9 10 1 3FEZ HIS A 11 ? UNP Q71XF2 ? ? 'expression tag' -8 11 1 3FEZ HIS A 12 ? UNP Q71XF2 ? ? 'expression tag' -7 12 1 3FEZ GLU A 13 ? UNP Q71XF2 ? ? 'expression tag' -6 13 1 3FEZ ASN A 14 ? UNP Q71XF2 ? ? 'expression tag' -5 14 1 3FEZ LEU A 15 ? UNP Q71XF2 ? ? 'expression tag' -4 15 1 3FEZ TYR A 16 ? UNP Q71XF2 ? ? 'expression tag' -3 16 1 3FEZ PHE A 17 ? UNP Q71XF2 ? ? 'expression tag' -2 17 1 3FEZ GLN A 18 ? UNP Q71XF2 ? ? 'expression tag' -1 18 1 3FEZ GLY A 19 ? UNP Q71XF2 ? ? 'expression tag' 0 19 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.method 'X-RAY DIFFRACTION' _exptl.entry_id 3FEZ # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.75 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 67.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details '0.2000M NH4H2PO3, 20.0000% PEG-3350, No Buffer pH 4.6, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR MAR300' _diffrn_detector.details 'Adjustable focusing mirrors in K-B geometry' _diffrn_detector.pdbx_collection_date 2008-10-12 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111) Double Crystal Monochrometer' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.94645 1.0 2 0.97966 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.pdbx_wavelength_list 0.94645,0.97966 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS # _reflns.entry_id 3FEZ _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 28.976 _reflns.number_obs 20290 _reflns.pdbx_Rmerge_I_obs 0.155 _reflns.percent_possible_obs 97.900 _reflns.B_iso_Wilson_estimate 36.004 _reflns.observed_criterion_sigma_I -3.00 _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.10 2.17 21608 ? 3205 0.011 1.6 ? ? ? ? ? 91.50 1 1 2.17 2.26 29528 ? 3845 0.011 2.3 ? ? ? ? ? 98.20 2 1 2.26 2.36 28541 ? 3636 0.011 3.4 ? ? ? ? ? 98.40 3 1 2.36 2.49 30273 ? 3859 0.011 4.3 ? ? ? ? ? 98.60 4 1 2.49 2.64 28015 ? 3568 0.011 5.7 ? ? ? ? ? 98.60 5 1 2.64 2.85 33518 ? 3833 0.011 7.8 ? ? ? ? ? 98.70 6 1 2.85 3.13 39385 ? 3637 0.011 11.2 ? ? ? ? ? 98.90 7 1 3.13 3.59 49991 ? 3801 0.011 16.8 ? ? ? ? ? 99.00 8 1 3.59 4.51 49700 ? 3703 0.011 22.3 ? ? ? ? ? 99.10 9 1 4.51 ? 49994 ? 3761 0.011 24.7 ? ? ? ? ? 97.90 10 1 # _refine.entry_id 3FEZ _refine.ls_d_res_high 2.100 _refine.ls_d_res_low 28.976 _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 97.870 _refine.ls_number_reflns_obs 20282 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;1.HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2.ATOM RECORD CONTAINS RESIDUAL B FACTORS ONLY. 3.A MET-INHIBITION PROTOCOL WAS USED FOR SELENOMETHIONINE INCORPORATION DURING PROTEIN EXPRESSION. THE OCCUPANCY OF THE SE ATOMS IN THE MSE RESIDUES WAS REDUCED TO 0.75 TO ACCOUNT FOR THE REDUCED SCATTERING POWER DUE TO PARTIAL S-MET INCORPORATION. ; _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.204 _refine.ls_R_factor_R_work 0.203 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.227 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 1039 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 53.552 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.070 _refine.aniso_B[2][2] 0.070 _refine.aniso_B[3][3] -0.110 _refine.aniso_B[1][2] 0.040 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.948 _refine.correlation_coeff_Fo_to_Fc_free 0.937 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.149 _refine.pdbx_overall_ESU_R_Free 0.138 _refine.overall_SU_ML 0.098 _refine.overall_SU_B 7.220 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 87.59 _refine.B_iso_min 39.01 _refine.occupancy_max 1.00 _refine.occupancy_min 0.25 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1360 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 84 _refine_hist.number_atoms_total 1444 _refine_hist.d_res_high 2.100 _refine_hist.d_res_low 28.976 # loop_ _refine_ls_restr.type _refine_ls_restr.pdbx_refine_id _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 'X-RAY DIFFRACTION' 1475 0.017 0.022 ? ? r_bond_other_d 'X-RAY DIFFRACTION' 987 0.001 0.020 ? ? r_angle_refined_deg 'X-RAY DIFFRACTION' 1999 1.289 1.931 ? ? r_angle_other_deg 'X-RAY DIFFRACTION' 2407 0.771 3.000 ? ? r_dihedral_angle_1_deg 'X-RAY DIFFRACTION' 184 4.333 5.000 ? ? r_dihedral_angle_2_deg 'X-RAY DIFFRACTION' 72 28.369 24.444 ? ? r_dihedral_angle_3_deg 'X-RAY DIFFRACTION' 256 12.262 15.000 ? ? r_dihedral_angle_4_deg 'X-RAY DIFFRACTION' 5 18.940 15.000 ? ? r_chiral_restr 'X-RAY DIFFRACTION' 210 0.082 0.200 ? ? r_gen_planes_refined 'X-RAY DIFFRACTION' 1683 0.004 0.020 ? ? r_gen_planes_other 'X-RAY DIFFRACTION' 324 0.001 0.020 ? ? r_nbd_refined 'X-RAY DIFFRACTION' 289 0.235 0.300 ? ? r_nbd_other 'X-RAY DIFFRACTION' 950 0.184 0.300 ? ? r_nbtor_refined 'X-RAY DIFFRACTION' 720 0.192 0.500 ? ? r_nbtor_other 'X-RAY DIFFRACTION' 739 0.089 0.500 ? ? r_xyhbond_nbd_refined 'X-RAY DIFFRACTION' 124 0.165 0.500 ? ? r_xyhbond_nbd_other 'X-RAY DIFFRACTION' 1 0.035 0.500 ? ? r_symmetry_vdw_refined 'X-RAY DIFFRACTION' 13 0.239 0.300 ? ? r_symmetry_vdw_other 'X-RAY DIFFRACTION' 40 0.218 0.300 ? ? r_symmetry_hbond_refined 'X-RAY DIFFRACTION' 14 0.182 0.500 ? ? r_mcbond_it 'X-RAY DIFFRACTION' 956 0.843 1.500 ? ? r_mcbond_other 'X-RAY DIFFRACTION' 363 0.144 1.500 ? ? r_mcangle_it 'X-RAY DIFFRACTION' 1435 1.242 2.000 ? ? r_scbond_it 'X-RAY DIFFRACTION' 655 1.720 3.000 ? ? r_scangle_it 'X-RAY DIFFRACTION' 564 2.343 4.500 ? ? # _refine_ls_shell.d_res_high 2.101 _refine_ls_shell.d_res_low 2.155 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 91.280 _refine_ls_shell.number_reflns_R_work 1287 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.241 _refine_ls_shell.R_factor_R_free 0.269 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 73 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1360 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3FEZ _struct.title ;Crystal structure of uncharacterized ferredoxin fold protein related to antibiotic biosynthesis monooxygenases (YP_014836.1) from LISTERIA MONOCYTOGENES 4b F2365 at 2.10 A resolution ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;YP_014836.1, uncharacterized ferredoxin fold protein related to antibiotic biosynthesis monooxygenases, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function ; _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.entry_id 3FEZ # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 14 ? GLY A 19 ? ASN A -5 GLY A 0 1 ? 6 HELX_P HELX_P2 2 THR A 29 ? TYR A 40 ? THR A 10 TYR A 21 1 ? 12 HELX_P HELX_P3 3 ARG A 95 ? GLU A 97 ? ARG A 76 GLU A 78 5 ? 3 HELX_P HELX_P4 4 GLU A 98 ? LEU A 111 ? GLU A 79 LEU A 92 1 ? 14 HELX_P HELX_P5 5 HIS A 112 ? THR A 116 ? HIS A 93 THR A 97 5 ? 5 HELX_P HELX_P6 6 SER A 141 ? LYS A 149 ? SER A 122 LYS A 130 1 ? 9 HELX_P HELX_P7 7 THR A 151 ? GLN A 167 ? THR A 132 GLN A 148 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLY 19 C ? ? ? 1_555 A MSE 20 N ? ? A GLY 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale2 covale both ? A MSE 20 C ? ? ? 1_555 A LYS 21 N ? ? A MSE 1 A LYS 2 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? A LEU 36 C ? ? ? 1_555 A MSE 37 N A ? A LEU 17 A MSE 18 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A LEU 36 C ? ? ? 1_555 A MSE 37 N B ? A LEU 17 A MSE 18 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale5 covale both ? A MSE 37 C A ? ? 1_555 A ALA 38 N ? ? A MSE 18 A ALA 19 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale6 covale both ? A MSE 37 C B ? ? 1_555 A ALA 38 N ? ? A MSE 18 A ALA 19 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale7 covale both ? A GLN 104 C A ? ? 1_555 A MSE 105 N A ? A GLN 85 A MSE 86 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale8 covale both ? A GLN 104 C B ? ? 1_555 A MSE 105 N B ? A GLN 85 A MSE 86 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale9 covale both ? A MSE 105 C A ? ? 1_555 A TYR 106 N ? ? A MSE 86 A TYR 87 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale10 covale both ? A MSE 105 C B ? ? 1_555 A TYR 106 N ? ? A MSE 86 A TYR 87 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale11 covale both ? A ALA 127 C ? ? ? 1_555 A MSE 128 N ? ? A ALA 108 A MSE 109 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale12 covale both ? A MSE 128 C ? ? ? 1_555 A ASN 129 N ? ? A MSE 109 A ASN 110 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale13 covale both ? A ASN 129 C ? ? ? 1_555 A MSE 130 N A ? A ASN 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale14 covale both ? A ASN 129 C ? ? ? 1_555 A MSE 130 N B ? A ASN 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale15 covale both ? A MSE 130 C A ? ? 1_555 A ASN 131 N ? ? A MSE 111 A ASN 112 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale16 covale both ? A MSE 130 C B ? ? 1_555 A ASN 131 N ? ? A MSE 111 A ASN 112 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale17 covale both ? A ILE 160 C ? ? ? 1_555 A MSE 161 N ? ? A ILE 141 A MSE 142 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale18 covale both ? A MSE 161 C ? ? ? 1_555 A LYS 162 N ? ? A MSE 142 A LYS 143 1_555 ? ? ? ? ? ? ? 1.327 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 21 ? GLY A 28 ? LYS A 2 GLY A 9 A 2 SER A 54 ? THR A 61 ? SER A 35 THR A 42 A 3 THR A 46 ? GLN A 49 ? THR A 27 GLN A 30 A 4 HIS A 172 ? HIS A 177 ? HIS A 153 HIS A 158 A 5 VAL A 86 ? HIS A 93 ? VAL A 67 HIS A 74 A 6 LYS A 132 ? TRP A 139 ? LYS A 113 TRP A 120 A 7 LEU A 119 ? ALA A 127 ? LEU A 100 ALA A 108 A 8 ALA A 70 ? GLY A 79 ? ALA A 51 GLY A 60 A 9 LYS A 21 ? GLY A 28 ? LYS A 2 GLY A 9 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 22 ? N LYS A 3 O SER A 60 ? O SER A 41 A 2 3 O LEU A 55 ? O LEU A 36 N LEU A 48 ? N LEU A 29 A 3 4 N GLN A 49 ? N GLN A 30 O HIS A 177 ? O HIS A 158 A 4 5 O TYR A 176 ? O TYR A 157 N VAL A 87 ? N VAL A 68 A 5 6 N ILE A 92 ? N ILE A 73 O PHE A 133 ? O PHE A 114 A 6 7 O PHE A 138 ? O PHE A 119 N GLN A 120 ? N GLN A 101 A 7 8 O LYS A 126 ? O LYS A 107 N ARG A 73 ? N ARG A 54 A 8 9 O VAL A 74 ? O VAL A 55 N LYS A 21 ? N LYS A 2 # _atom_sites.entry_id 3FEZ _atom_sites.fract_transf_matrix[1][1] 0.013657 _atom_sites.fract_transf_matrix[1][2] 0.007885 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015770 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004665 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -18 ? ? ? A . n A 1 2 GLY 2 -17 ? ? ? A . n A 1 3 SER 3 -16 ? ? ? A . n A 1 4 ASP 4 -15 ? ? ? A . n A 1 5 LYS 5 -14 ? ? ? A . n A 1 6 ILE 6 -13 ? ? ? A . n A 1 7 HIS 7 -12 ? ? ? A . n A 1 8 HIS 8 -11 ? ? ? A . n A 1 9 HIS 9 -10 ? ? ? A . n A 1 10 HIS 10 -9 ? ? ? A . n A 1 11 HIS 11 -8 ? ? ? A . n A 1 12 HIS 12 -7 ? ? ? A . n A 1 13 GLU 13 -6 -6 GLU GLU A . n A 1 14 ASN 14 -5 -5 ASN ASN A . n A 1 15 LEU 15 -4 -4 LEU LEU A . n A 1 16 TYR 16 -3 -3 TYR TYR A . n A 1 17 PHE 17 -2 -2 PHE PHE A . n A 1 18 GLN 18 -1 -1 GLN GLN A . n A 1 19 GLY 19 0 0 GLY GLY A . n A 1 20 MSE 20 1 1 MSE MSE A . n A 1 21 LYS 21 2 2 LYS LYS A . n A 1 22 LYS 22 3 3 LYS LYS A . n A 1 23 VAL 23 4 4 VAL VAL A . n A 1 24 PHE 24 5 5 PHE PHE A . n A 1 25 ILE 25 6 6 ILE ILE A . n A 1 26 THR 26 7 7 THR THR A . n A 1 27 THR 27 8 8 THR THR A . n A 1 28 GLY 28 9 9 GLY GLY A . n A 1 29 THR 29 10 10 THR THR A . n A 1 30 GLU 30 11 11 GLU GLU A . n A 1 31 HIS 31 12 12 HIS HIS A . n A 1 32 TYR 32 13 13 TYR TYR A . n A 1 33 LEU 33 14 14 LEU LEU A . n A 1 34 ARG 34 15 15 ARG ARG A . n A 1 35 GLN 35 16 16 GLN GLN A . n A 1 36 LEU 36 17 17 LEU LEU A . n A 1 37 MSE 37 18 18 MSE MSE A . n A 1 38 ALA 38 19 19 ALA ALA A . n A 1 39 ASN 39 20 20 ASN ASN A . n A 1 40 TYR 40 21 21 TYR TYR A . n A 1 41 THR 41 22 22 THR THR A . n A 1 42 GLY 42 23 23 GLY GLY A . n A 1 43 GLY 43 24 24 GLY GLY A . n A 1 44 ASN 44 25 25 ASN ASN A . n A 1 45 VAL 45 26 26 VAL VAL A . n A 1 46 THR 46 27 27 THR THR A . n A 1 47 LEU 47 28 28 LEU LEU A . n A 1 48 LEU 48 29 29 LEU LEU A . n A 1 49 GLN 49 30 30 GLN GLN A . n A 1 50 ASN 50 31 31 ASN ASN A . n A 1 51 PHE 51 32 32 PHE PHE A . n A 1 52 SER 52 33 33 SER SER A . n A 1 53 GLN 53 34 34 GLN GLN A . n A 1 54 SER 54 35 35 SER SER A . n A 1 55 LEU 55 36 36 LEU LEU A . n A 1 56 LEU 56 37 37 LEU LEU A . n A 1 57 TYR 57 38 38 TYR TYR A . n A 1 58 GLN 58 39 39 GLN GLN A . n A 1 59 GLU 59 40 40 GLU GLU A . n A 1 60 SER 60 41 41 SER SER A . n A 1 61 THR 61 42 42 THR THR A . n A 1 62 GLY 62 43 43 GLY GLY A . n A 1 63 GLU 63 44 44 GLU GLU A . n A 1 64 LYS 64 45 45 LYS LYS A . n A 1 65 LEU 65 46 46 LEU LEU A . n A 1 66 PHE 66 47 47 PHE PHE A . n A 1 67 GLN 67 48 48 GLN GLN A . n A 1 68 GLU 68 49 49 GLU GLU A . n A 1 69 GLY 69 50 50 GLY GLY A . n A 1 70 ALA 70 51 51 ALA ALA A . n A 1 71 GLU 71 52 52 GLU GLU A . n A 1 72 TYR 72 53 53 TYR TYR A . n A 1 73 ARG 73 54 54 ARG ARG A . n A 1 74 VAL 74 55 55 VAL VAL A . n A 1 75 LEU 75 56 56 LEU LEU A . n A 1 76 GLN 76 57 57 GLN GLN A . n A 1 77 SER 77 58 58 SER SER A . n A 1 78 SER 78 59 59 SER SER A . n A 1 79 GLY 79 60 60 GLY GLY A . n A 1 80 SER 80 61 61 SER SER A . n A 1 81 LEU 81 62 62 LEU LEU A . n A 1 82 LYS 82 63 63 LYS LYS A . n A 1 83 GLY 83 64 64 GLY GLY A . n A 1 84 PHE 84 65 65 PHE PHE A . n A 1 85 GLY 85 66 66 GLY GLY A . n A 1 86 VAL 86 67 67 VAL VAL A . n A 1 87 VAL 87 68 68 VAL VAL A . n A 1 88 VAL 88 69 69 VAL VAL A . n A 1 89 PHE 89 70 70 PHE PHE A . n A 1 90 GLU 90 71 71 GLU GLU A . n A 1 91 TYR 91 72 72 TYR TYR A . n A 1 92 ILE 92 73 73 ILE ILE A . n A 1 93 HIS 93 74 74 HIS HIS A . n A 1 94 LEU 94 75 75 LEU LEU A . n A 1 95 ARG 95 76 76 ARG ARG A . n A 1 96 ASP 96 77 77 ASP ASP A . n A 1 97 GLU 97 78 78 GLU GLU A . n A 1 98 GLU 98 79 79 GLU GLU A . n A 1 99 ILE 99 80 80 ILE ILE A . n A 1 100 PRO 100 81 81 PRO PRO A . n A 1 101 ILE 101 82 82 ILE ILE A . n A 1 102 PHE 102 83 83 PHE PHE A . n A 1 103 LEU 103 84 84 LEU LEU A . n A 1 104 GLN 104 85 85 GLN GLN A . n A 1 105 MSE 105 86 86 MSE MSE A . n A 1 106 TYR 106 87 87 TYR TYR A . n A 1 107 GLN 107 88 88 GLN GLN A . n A 1 108 ARG 108 89 89 ARG ARG A . n A 1 109 ALA 109 90 90 ALA ALA A . n A 1 110 SER 110 91 91 SER SER A . n A 1 111 LEU 111 92 92 LEU LEU A . n A 1 112 HIS 112 93 93 HIS HIS A . n A 1 113 PHE 113 94 94 PHE PHE A . n A 1 114 SER 114 95 95 SER SER A . n A 1 115 GLU 115 96 96 GLU GLU A . n A 1 116 THR 116 97 97 THR THR A . n A 1 117 PRO 117 98 98 PRO PRO A . n A 1 118 GLY 118 99 99 GLY GLY A . n A 1 119 LEU 119 100 100 LEU LEU A . n A 1 120 GLN 120 101 101 GLN GLN A . n A 1 121 SER 121 102 102 SER SER A . n A 1 122 THR 122 103 103 THR THR A . n A 1 123 LYS 123 104 104 LYS LYS A . n A 1 124 LEU 124 105 105 LEU LEU A . n A 1 125 THR 125 106 106 THR THR A . n A 1 126 LYS 126 107 107 LYS LYS A . n A 1 127 ALA 127 108 108 ALA ALA A . n A 1 128 MSE 128 109 109 MSE MSE A . n A 1 129 ASN 129 110 110 ASN ASN A . n A 1 130 MSE 130 111 111 MSE MSE A . n A 1 131 ASN 131 112 112 ASN ASN A . n A 1 132 LYS 132 113 113 LYS LYS A . n A 1 133 PHE 133 114 114 PHE PHE A . n A 1 134 LEU 134 115 115 LEU LEU A . n A 1 135 ILE 135 116 116 ILE ILE A . n A 1 136 ILE 136 117 117 ILE ILE A . n A 1 137 SER 137 118 118 SER SER A . n A 1 138 PHE 138 119 119 PHE PHE A . n A 1 139 TRP 139 120 120 TRP TRP A . n A 1 140 ASP 140 121 121 ASP ASP A . n A 1 141 SER 141 122 122 SER SER A . n A 1 142 GLU 142 123 123 GLU GLU A . n A 1 143 VAL 143 124 124 VAL VAL A . n A 1 144 PHE 144 125 125 PHE PHE A . n A 1 145 PHE 145 126 126 PHE PHE A . n A 1 146 HIS 146 127 127 HIS HIS A . n A 1 147 ASP 147 128 128 ASP ASP A . n A 1 148 TRP 148 129 129 TRP TRP A . n A 1 149 LYS 149 130 130 LYS LYS A . n A 1 150 LYS 150 131 131 LYS LYS A . n A 1 151 THR 151 132 132 THR THR A . n A 1 152 PRO 152 133 133 PRO PRO A . n A 1 153 LEU 153 134 134 LEU LEU A . n A 1 154 SER 154 135 135 SER SER A . n A 1 155 LYS 155 136 136 LYS LYS A . n A 1 156 GLU 156 137 137 GLU GLU A . n A 1 157 ILE 157 138 138 ILE ILE A . n A 1 158 THR 158 139 139 THR THR A . n A 1 159 ASN 159 140 140 ASN ASN A . n A 1 160 ILE 160 141 141 ILE ILE A . n A 1 161 MSE 161 142 142 MSE MSE A . n A 1 162 LYS 162 143 143 LYS LYS A . n A 1 163 LYS 163 144 144 LYS LYS A . n A 1 164 ASN 164 145 145 ASN ASN A . n A 1 165 ASN 165 146 146 ASN ASN A . n A 1 166 THR 166 147 147 THR THR A . n A 1 167 GLN 167 148 148 GLN GLN A . n A 1 168 SER 168 149 149 SER SER A . n A 1 169 GLY 169 150 150 GLY GLY A . n A 1 170 PHE 170 151 151 PHE PHE A . n A 1 171 SER 171 152 152 SER SER A . n A 1 172 HIS 172 153 153 HIS HIS A . n A 1 173 GLU 173 154 154 GLU GLU A . n A 1 174 ASP 174 155 155 ASP ASP A . n A 1 175 ILE 175 156 156 ILE ILE A . n A 1 176 TYR 176 157 157 TYR TYR A . n A 1 177 HIS 177 158 158 HIS HIS A . n A 1 178 TYR 178 159 159 TYR TYR A . n A 1 179 PRO 179 160 160 PRO PRO A . n A 1 180 GLU 180 161 161 GLU GLU A . n A 1 181 PHE 181 162 162 PHE PHE A . n A 1 182 SER 182 163 ? ? ? A . n A 1 183 HIS 183 164 ? ? ? A . n A 1 184 ASP 184 165 ? ? ? A . n A 1 185 ALA 185 166 ? ? ? A . n A 1 186 LYS 186 167 ? ? ? A . n # _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Joint Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center JCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 168 1 HOH HOH A . B 2 HOH 2 169 2 HOH HOH A . B 2 HOH 3 170 3 HOH HOH A . B 2 HOH 4 171 4 HOH HOH A . B 2 HOH 5 172 5 HOH HOH A . B 2 HOH 6 173 6 HOH HOH A . B 2 HOH 7 174 7 HOH HOH A . B 2 HOH 8 175 8 HOH HOH A . B 2 HOH 9 176 9 HOH HOH A . B 2 HOH 10 177 10 HOH HOH A . B 2 HOH 11 178 11 HOH HOH A . B 2 HOH 12 179 12 HOH HOH A . B 2 HOH 13 180 13 HOH HOH A . B 2 HOH 14 181 14 HOH HOH A . B 2 HOH 15 182 15 HOH HOH A . B 2 HOH 16 183 16 HOH HOH A . B 2 HOH 17 184 17 HOH HOH A . B 2 HOH 18 185 18 HOH HOH A . B 2 HOH 19 186 19 HOH HOH A . B 2 HOH 20 187 20 HOH HOH A . B 2 HOH 21 188 21 HOH HOH A . B 2 HOH 22 189 22 HOH HOH A . B 2 HOH 23 190 23 HOH HOH A . B 2 HOH 24 191 24 HOH HOH A . B 2 HOH 25 192 25 HOH HOH A . B 2 HOH 26 193 26 HOH HOH A . B 2 HOH 27 194 27 HOH HOH A . B 2 HOH 28 195 28 HOH HOH A . B 2 HOH 29 196 29 HOH HOH A . B 2 HOH 30 197 30 HOH HOH A . B 2 HOH 31 198 31 HOH HOH A . B 2 HOH 32 199 32 HOH HOH A . B 2 HOH 33 200 33 HOH HOH A . B 2 HOH 34 201 34 HOH HOH A . B 2 HOH 35 202 35 HOH HOH A . B 2 HOH 36 203 36 HOH HOH A . B 2 HOH 37 204 37 HOH HOH A . B 2 HOH 38 205 38 HOH HOH A . B 2 HOH 39 206 39 HOH HOH A . B 2 HOH 40 207 40 HOH HOH A . B 2 HOH 41 208 41 HOH HOH A . B 2 HOH 42 209 42 HOH HOH A . B 2 HOH 43 210 43 HOH HOH A . B 2 HOH 44 211 44 HOH HOH A . B 2 HOH 45 212 45 HOH HOH A . B 2 HOH 46 213 46 HOH HOH A . B 2 HOH 47 214 47 HOH HOH A . B 2 HOH 48 215 48 HOH HOH A . B 2 HOH 49 216 49 HOH HOH A . B 2 HOH 50 217 50 HOH HOH A . B 2 HOH 51 218 51 HOH HOH A . B 2 HOH 52 219 52 HOH HOH A . B 2 HOH 53 220 53 HOH HOH A . B 2 HOH 54 221 54 HOH HOH A . B 2 HOH 55 222 55 HOH HOH A . B 2 HOH 56 223 56 HOH HOH A . B 2 HOH 57 224 57 HOH HOH A . B 2 HOH 58 225 58 HOH HOH A . B 2 HOH 59 226 59 HOH HOH A . B 2 HOH 60 227 60 HOH HOH A . B 2 HOH 61 228 61 HOH HOH A . B 2 HOH 62 229 62 HOH HOH A . B 2 HOH 63 230 63 HOH HOH A . B 2 HOH 64 231 64 HOH HOH A . B 2 HOH 65 232 65 HOH HOH A . B 2 HOH 66 233 66 HOH HOH A . B 2 HOH 67 234 67 HOH HOH A . B 2 HOH 68 235 68 HOH HOH A . B 2 HOH 69 236 69 HOH HOH A . B 2 HOH 70 237 70 HOH HOH A . B 2 HOH 71 238 71 HOH HOH A . B 2 HOH 72 239 72 HOH HOH A . B 2 HOH 73 240 73 HOH HOH A . B 2 HOH 74 241 74 HOH HOH A . B 2 HOH 75 242 75 HOH HOH A . B 2 HOH 76 243 76 HOH HOH A . B 2 HOH 77 244 77 HOH HOH A . B 2 HOH 78 245 78 HOH HOH A . B 2 HOH 79 246 79 HOH HOH A . B 2 HOH 80 247 80 HOH HOH A . B 2 HOH 81 248 81 HOH HOH A . B 2 HOH 82 249 82 HOH HOH A . B 2 HOH 83 250 83 HOH HOH A . B 2 HOH 84 251 84 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 20 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 37 A MSE 18 ? MET SELENOMETHIONINE 3 A MSE 105 A MSE 86 ? MET SELENOMETHIONINE 4 A MSE 128 A MSE 109 ? MET SELENOMETHIONINE 5 A MSE 130 A MSE 111 ? MET SELENOMETHIONINE 6 A MSE 161 A MSE 142 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-12-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2019-07-24 5 'Structure model' 1 4 2023-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' software 3 4 'Structure model' struct_conn 4 5 'Structure model' database_2 5 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.name' 3 4 'Structure model' '_software.classification' 4 4 'Structure model' '_software.contact_author' 5 4 'Structure model' '_software.contact_author_email' 6 4 'Structure model' '_software.language' 7 4 'Structure model' '_software.location' 8 4 'Structure model' '_software.name' 9 4 'Structure model' '_software.type' 10 4 'Structure model' '_software.version' 11 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 12 5 'Structure model' '_database_2.pdbx_DOI' 13 5 'Structure model' '_database_2.pdbx_database_accession' 14 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 61.9400 _pdbx_refine_tls.origin_y 14.3165 _pdbx_refine_tls.origin_z 17.2999 _pdbx_refine_tls.T[1][1] -0.0582 _pdbx_refine_tls.T[2][2] -0.1401 _pdbx_refine_tls.T[3][3] -0.1133 _pdbx_refine_tls.T[1][2] 0.1047 _pdbx_refine_tls.T[1][3] -0.0192 _pdbx_refine_tls.T[2][3] 0.0069 _pdbx_refine_tls.L[1][1] 1.5646 _pdbx_refine_tls.L[2][2] 4.0281 _pdbx_refine_tls.L[3][3] 3.4719 _pdbx_refine_tls.L[1][2] -1.1572 _pdbx_refine_tls.L[1][3] -0.6955 _pdbx_refine_tls.L[2][3] -0.0715 _pdbx_refine_tls.S[1][1] 0.0207 _pdbx_refine_tls.S[2][2] 0.0712 _pdbx_refine_tls.S[3][3] -0.0919 _pdbx_refine_tls.S[1][2] -0.0377 _pdbx_refine_tls.S[1][3] 0.0207 _pdbx_refine_tls.S[2][3] 0.0658 _pdbx_refine_tls.S[2][1] -0.2048 _pdbx_refine_tls.S[3][1] -0.3457 _pdbx_refine_tls.S[3][2] -0.1386 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.beg_auth_seq_id -6 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 162 _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # _phasing.method MAD # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC 5.2.0019 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 PHENIX . ? package 'P.D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 SHELX . ? package 'George M. Sheldrick' gsheldr@shelx.uni-ac.gwdg.de phasing http://shelx.uni-ac.gwdg.de/SHELX/ Fortran_77 ? 3 MolProbity 3beta29 ? package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 'model building' http://kinemage.biochem.duke.edu/molprobity/ ? ? 4 XSCALE . ? package 'Wolfgang Kabsch' ? 'data scaling' http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? ? 5 PDB_EXTRACT 3.006 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 XDS . ? ? ? ? 'data reduction' ? ? ? 7 SHELXD . ? ? ? ? phasing ? ? ? 8 autoSHARP . ? ? ? ? phasing ? ? ? 9 # _pdbx_entry_details.entry_id 3FEZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'THE CONSTRUCT WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG.' _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 SE _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 MSE _pdbx_validate_rmsd_bond.auth_seq_id_1 142 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CE _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 MSE _pdbx_validate_rmsd_bond.auth_seq_id_2 142 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.574 _pdbx_validate_rmsd_bond.bond_target_value 1.950 _pdbx_validate_rmsd_bond.bond_deviation -0.376 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.059 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 46 ? ? -122.95 -82.30 2 1 ASN A 112 ? ? -83.43 42.93 3 1 ASN A 112 ? ? -88.40 42.93 4 1 GLN A 148 ? ? -93.26 -134.68 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU -6 ? CD ? A GLU 13 CD 2 1 Y 1 A GLU -6 ? OE1 ? A GLU 13 OE1 3 1 Y 1 A GLU -6 ? OE2 ? A GLU 13 OE2 4 1 Y 1 A TYR 21 ? CG ? A TYR 40 CG 5 1 Y 1 A TYR 21 ? CD1 ? A TYR 40 CD1 6 1 Y 1 A TYR 21 ? CD2 ? A TYR 40 CD2 7 1 Y 1 A TYR 21 ? CE1 ? A TYR 40 CE1 8 1 Y 1 A TYR 21 ? CE2 ? A TYR 40 CE2 9 1 Y 1 A TYR 21 ? CZ ? A TYR 40 CZ 10 1 Y 1 A TYR 21 ? OH ? A TYR 40 OH 11 1 Y 1 A LYS 45 ? CE ? A LYS 64 CE 12 1 Y 1 A LYS 45 ? NZ ? A LYS 64 NZ 13 1 Y 1 A GLN 88 ? CD ? A GLN 107 CD 14 1 Y 1 A GLN 88 ? OE1 ? A GLN 107 OE1 15 1 Y 1 A GLN 88 ? NE2 ? A GLN 107 NE2 16 1 Y 1 A LYS 136 ? CE ? A LYS 155 CE 17 1 Y 1 A LYS 136 ? NZ ? A LYS 155 NZ 18 1 Y 1 A GLU 137 ? CG ? A GLU 156 CG 19 1 Y 1 A GLU 137 ? CD ? A GLU 156 CD 20 1 Y 1 A GLU 137 ? OE1 ? A GLU 156 OE1 21 1 Y 1 A GLU 137 ? OE2 ? A GLU 156 OE2 22 1 Y 1 A LYS 143 ? CD ? A LYS 162 CD 23 1 Y 1 A LYS 143 ? CE ? A LYS 162 CE 24 1 Y 1 A LYS 143 ? NZ ? A LYS 162 NZ 25 1 Y 1 A LYS 144 ? CE ? A LYS 163 CE 26 1 Y 1 A LYS 144 ? NZ ? A LYS 163 NZ 27 1 Y 1 A GLN 148 ? CG ? A GLN 167 CG 28 1 Y 1 A GLN 148 ? CD ? A GLN 167 CD 29 1 Y 1 A GLN 148 ? OE1 ? A GLN 167 OE1 30 1 Y 1 A GLN 148 ? NE2 ? A GLN 167 NE2 31 1 Y 1 A SER 149 ? CB ? A SER 168 CB 32 1 Y 1 A SER 149 ? OG ? A SER 168 OG 33 1 Y 1 A GLU 161 ? CG ? A GLU 180 CG 34 1 Y 1 A GLU 161 ? CD ? A GLU 180 CD 35 1 Y 1 A GLU 161 ? OE1 ? A GLU 180 OE1 36 1 Y 1 A GLU 161 ? OE2 ? A GLU 180 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -18 ? A MSE 1 2 1 Y 1 A GLY -17 ? A GLY 2 3 1 Y 1 A SER -16 ? A SER 3 4 1 Y 1 A ASP -15 ? A ASP 4 5 1 Y 1 A LYS -14 ? A LYS 5 6 1 Y 1 A ILE -13 ? A ILE 6 7 1 Y 1 A HIS -12 ? A HIS 7 8 1 Y 1 A HIS -11 ? A HIS 8 9 1 Y 1 A HIS -10 ? A HIS 9 10 1 Y 1 A HIS -9 ? A HIS 10 11 1 Y 1 A HIS -8 ? A HIS 11 12 1 Y 1 A HIS -7 ? A HIS 12 13 1 Y 1 A SER 163 ? A SER 182 14 1 Y 1 A HIS 164 ? A HIS 183 15 1 Y 1 A ASP 165 ? A ASP 184 16 1 Y 1 A ALA 166 ? A ALA 185 17 1 Y 1 A LYS 167 ? A LYS 186 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #