data_3FOJ # _entry.id 3FOJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3FOJ RCSB RCSB050845 WWPDB D_1000050845 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id SyR101A _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3FOJ _pdbx_database_status.recvd_initial_deposition_date 2008-12-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Seetharaman, J.' 1 'Abashidze, M.' 2 'Wang, H.' 3 'Janjua, H.' 4 'Foote, E.L.' 5 'Xiao, R.' 6 'Everett, J.K.' 7 'Acton, T.B.' 8 'Rost, B.' 9 'Montelione, G.T.' 10 'Hunt, J.F.' 11 'Tong, L.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Crystal Structure of SSP1007 From Staphylococcus saprophyticus subsp. saprophyticus. Northeast Structural Genomics Target SyR101A.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Seetharaman, J.' 1 primary 'Abashidze, M.' 2 primary 'Wang, H.' 3 primary 'Janjua, H.' 4 primary 'Foote, E.L.' 5 primary 'Xiao, R.' 6 primary 'Everett, J.K.' 7 primary 'Acton, T.B.' 8 primary 'Rost, B.' 9 primary 'Montelione, G.T.' 10 primary 'Hunt, J.F.' 11 primary 'Tong, L.' 12 # _cell.entry_id 3FOJ _cell.length_a 30.692 _cell.length_b 42.130 _cell.length_c 58.855 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3FOJ _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'uncharacterized protein' 11172.685 1 ? ? ? ? 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 water nat water 18.015 123 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ESITVTELKEKILDANPVNIVDVRTDQETA(MSE)GIIPGAETIP(MSE)NSIPDNLNYFNDNETYYIICKAGGR SAQVVQYLEQNGVNAVNVEGG(MSE)DEFGDEGLEH ; _entity_poly.pdbx_seq_one_letter_code_can ;MESITVTELKEKILDANPVNIVDVRTDQETAMGIIPGAETIPMNSIPDNLNYFNDNETYYIICKAGGRSAQVVQYLEQNG VNAVNVEGGMDEFGDEGLEH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SyR101A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLU n 1 3 SER n 1 4 ILE n 1 5 THR n 1 6 VAL n 1 7 THR n 1 8 GLU n 1 9 LEU n 1 10 LYS n 1 11 GLU n 1 12 LYS n 1 13 ILE n 1 14 LEU n 1 15 ASP n 1 16 ALA n 1 17 ASN n 1 18 PRO n 1 19 VAL n 1 20 ASN n 1 21 ILE n 1 22 VAL n 1 23 ASP n 1 24 VAL n 1 25 ARG n 1 26 THR n 1 27 ASP n 1 28 GLN n 1 29 GLU n 1 30 THR n 1 31 ALA n 1 32 MSE n 1 33 GLY n 1 34 ILE n 1 35 ILE n 1 36 PRO n 1 37 GLY n 1 38 ALA n 1 39 GLU n 1 40 THR n 1 41 ILE n 1 42 PRO n 1 43 MSE n 1 44 ASN n 1 45 SER n 1 46 ILE n 1 47 PRO n 1 48 ASP n 1 49 ASN n 1 50 LEU n 1 51 ASN n 1 52 TYR n 1 53 PHE n 1 54 ASN n 1 55 ASP n 1 56 ASN n 1 57 GLU n 1 58 THR n 1 59 TYR n 1 60 TYR n 1 61 ILE n 1 62 ILE n 1 63 CYS n 1 64 LYS n 1 65 ALA n 1 66 GLY n 1 67 GLY n 1 68 ARG n 1 69 SER n 1 70 ALA n 1 71 GLN n 1 72 VAL n 1 73 VAL n 1 74 GLN n 1 75 TYR n 1 76 LEU n 1 77 GLU n 1 78 GLN n 1 79 ASN n 1 80 GLY n 1 81 VAL n 1 82 ASN n 1 83 ALA n 1 84 VAL n 1 85 ASN n 1 86 VAL n 1 87 GLU n 1 88 GLY n 1 89 GLY n 1 90 MSE n 1 91 ASP n 1 92 GLU n 1 93 PHE n 1 94 GLY n 1 95 ASP n 1 96 GLU n 1 97 GLY n 1 98 LEU n 1 99 GLU n 1 100 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SSP1007 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 342451 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q49YI7_STAS1 _struct_ref.pdbx_db_accession Q49YI7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MESITVTELKEKILDANPVNIVDVRTDQETAMGIIPGAETIPMNSIPDNLNYFNDNETYYIICKAGGRSAQVVQYLEQNG VNAVNVEGGMDEFGDEG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3FOJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 97 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q49YI7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 97 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 97 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3FOJ LEU A 98 ? UNP Q49YI7 ? ? 'expression tag' 98 1 1 3FOJ GLU A 99 ? UNP Q49YI7 ? ? 'expression tag' 99 2 1 3FOJ HIS A 100 ? UNP Q49YI7 ? ? 'expression tag' 100 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3FOJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.70 _exptl_crystal.density_percent_sol 27.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5 _exptl_crystal_grow.pdbx_details '150mM MgSO4, 100 MM Na3 Citrate, 20% PEG3350, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2008-11-28 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.979 # _reflns.entry_id 3FOJ _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.6 _reflns.number_obs 19428 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.076 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 17.2 _reflns.B_iso_Wilson_estimate 18.4 _reflns.pdbx_redundancy 6.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.66 _reflns_shell.percent_possible_all 99.4 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.36 _reflns_shell.meanI_over_sigI_obs 16.0 _reflns_shell.pdbx_redundancy 6.0 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1907 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3FOJ _refine.ls_number_reflns_obs 18913 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 119624.42 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.21 _refine.ls_d_res_high 1.60 _refine.ls_percent_reflns_obs 97.0 _refine.ls_R_factor_obs 0.194 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.194 _refine.ls_R_factor_R_free 0.235 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 951 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 18.1 _refine.aniso_B[1][1] 1.53 _refine.aniso_B[2][2] -0.05 _refine.aniso_B[3][3] -1.48 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.4 _refine.solvent_model_param_bsol 42.7996 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'BULK SOLVENT MODEL USED' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3FOJ _refine_analyze.Luzzati_coordinate_error_obs 0.17 _refine_analyze.Luzzati_sigma_a_obs 0.07 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.20 _refine_analyze.Luzzati_sigma_a_free 0.02 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 768 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 123 _refine_hist.number_atoms_total 892 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 27.21 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.004 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.1 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.75 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.13 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 1.72 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.57 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.55 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.60 _refine_ls_shell.d_res_low 1.69 _refine_ls_shell.number_reflns_R_work 0 _refine_ls_shell.R_factor_R_work 0.243 _refine_ls_shell.percent_reflns_obs 0.99 _refine_ls_shell.R_factor_R_free ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 3FOJ _struct.title 'Crystal Structure of SSP1007 From Staphylococcus saprophyticus subsp. saprophyticus. Northeast Structural Genomics Target SyR101A.' _struct.pdbx_descriptor 'uncharacterized protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3FOJ _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;protein SSP1007, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details monomer # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? LYS A 12 ? THR A 5 LYS A 12 1 ? 8 HELX_P HELX_P2 2 ILE A 13 ? ASP A 15 ? ILE A 13 ASP A 15 5 ? 3 HELX_P HELX_P3 3 THR A 26 ? ALA A 31 ? THR A 26 ALA A 31 1 ? 6 HELX_P HELX_P4 4 PRO A 42 ? PHE A 53 ? PRO A 42 PHE A 53 5 ? 12 HELX_P HELX_P5 5 GLY A 66 ? GLN A 78 ? GLY A 66 GLN A 78 1 ? 13 HELX_P HELX_P6 6 GLY A 88 ? GLY A 94 ? GLY A 88 GLY A 94 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A GLU 2 N ? ? A MSE 1 A GLU 2 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A ALA 31 C ? ? ? 1_555 A MSE 32 N ? ? A ALA 31 A MSE 32 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale ? ? A MSE 32 C ? ? ? 1_555 A GLY 33 N ? ? A MSE 32 A GLY 33 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale ? ? A PRO 42 C ? ? ? 1_555 A MSE 43 N ? ? A PRO 42 A MSE 43 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale ? ? A MSE 43 C ? ? ? 1_555 A ASN 44 N ? ? A MSE 43 A ASN 44 1_555 ? ? ? ? ? ? ? 1.329 ? covale6 covale ? ? A GLY 89 C ? ? ? 1_555 A MSE 90 N ? ? A GLY 89 A MSE 90 1_555 ? ? ? ? ? ? ? 1.331 ? covale7 covale ? ? A MSE 90 C ? ? ? 1_555 A ASP 91 N ? ? A MSE 90 A ASP 91 1_555 ? ? ? ? ? ? ? 1.331 ? metalc1 metalc ? ? A THR 40 O ? ? ? 1_555 B NA . NA ? ? A THR 40 A NA 101 1_555 ? ? ? ? ? ? ? 2.464 ? metalc2 metalc ? ? A THR 40 OG1 ? ? ? 1_555 B NA . NA ? ? A THR 40 A NA 101 1_555 ? ? ? ? ? ? ? 2.652 ? metalc3 metalc ? ? B NA . NA ? ? ? 1_555 C HOH . O ? ? A NA 101 A HOH 143 1_555 ? ? ? ? ? ? ? 2.685 ? metalc4 metalc ? ? B NA . NA ? ? ? 1_555 C HOH . O ? ? A NA 101 A HOH 146 1_555 ? ? ? ? ? ? ? 2.879 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 3 ? ILE A 4 ? SER A 3 ILE A 4 A 2 ASN A 82 ? VAL A 86 ? ASN A 82 VAL A 86 A 3 THR A 58 ? ILE A 62 ? THR A 58 ILE A 62 A 4 ASN A 20 ? ASP A 23 ? ASN A 20 ASP A 23 A 5 GLU A 39 ? THR A 40 ? GLU A 39 THR A 40 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 4 ? N ILE A 4 O ASN A 85 ? O ASN A 85 A 2 3 O VAL A 84 ? O VAL A 84 N ILE A 61 ? N ILE A 61 A 3 4 O TYR A 60 ? O TYR A 60 N ASN A 20 ? N ASN A 20 A 4 5 N ASP A 23 ? N ASP A 23 O GLU A 39 ? O GLU A 39 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE NA A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 THR A 40 ? THR A 40 . ? 1_555 ? 2 AC1 7 GLU A 96 ? GLU A 96 . ? 4_566 ? 3 AC1 7 HOH C . ? HOH A 118 . ? 4_566 ? 4 AC1 7 HOH C . ? HOH A 126 . ? 4_566 ? 5 AC1 7 HOH C . ? HOH A 143 . ? 1_555 ? 6 AC1 7 HOH C . ? HOH A 146 . ? 1_555 ? 7 AC1 7 HOH C . ? HOH A 160 . ? 3_655 ? # _database_PDB_matrix.entry_id 3FOJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3FOJ _atom_sites.fract_transf_matrix[1][1] 0.032582 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023736 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016991 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 MSE 32 32 32 MSE MSE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 MSE 43 43 43 MSE MSE A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 MSE 90 90 90 MSE MSE A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 HIS 100 100 100 HIS HIS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 32 A MSE 32 ? MET SELENOMETHIONINE 3 A MSE 43 A MSE 43 ? MET SELENOMETHIONINE 4 A MSE 90 A MSE 90 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A THR 40 ? A THR 40 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 OG1 ? A THR 40 ? A THR 40 ? 1_555 69.1 ? 2 O ? A THR 40 ? A THR 40 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 O ? C HOH . ? A HOH 143 ? 1_555 74.8 ? 3 OG1 ? A THR 40 ? A THR 40 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 O ? C HOH . ? A HOH 143 ? 1_555 134.5 ? 4 O ? A THR 40 ? A THR 40 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 O ? C HOH . ? A HOH 146 ? 1_555 97.6 ? 5 OG1 ? A THR 40 ? A THR 40 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 O ? C HOH . ? A HOH 146 ? 1_555 77.3 ? 6 O ? C HOH . ? A HOH 143 ? 1_555 NA ? B NA . ? A NA 101 ? 1_555 O ? C HOH . ? A HOH 146 ? 1_555 80.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-01-20 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 SHELXS phasing . ? 2 CNS refinement 1.2 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 101 1 NA NA A . C 3 HOH 1 102 102 HOH TIP A . C 3 HOH 2 103 103 HOH TIP A . C 3 HOH 3 104 104 HOH TIP A . C 3 HOH 4 105 105 HOH TIP A . C 3 HOH 5 106 106 HOH TIP A . C 3 HOH 6 107 107 HOH TIP A . C 3 HOH 7 108 108 HOH TIP A . C 3 HOH 8 109 109 HOH TIP A . C 3 HOH 9 110 110 HOH TIP A . C 3 HOH 10 111 111 HOH TIP A . C 3 HOH 11 112 112 HOH TIP A . C 3 HOH 12 113 113 HOH TIP A . C 3 HOH 13 114 114 HOH TIP A . C 3 HOH 14 115 115 HOH TIP A . C 3 HOH 15 116 116 HOH TIP A . C 3 HOH 16 117 117 HOH TIP A . C 3 HOH 17 118 118 HOH TIP A . C 3 HOH 18 119 119 HOH TIP A . C 3 HOH 19 120 120 HOH TIP A . C 3 HOH 20 121 121 HOH TIP A . C 3 HOH 21 122 122 HOH TIP A . C 3 HOH 22 123 123 HOH TIP A . C 3 HOH 23 124 124 HOH TIP A . C 3 HOH 24 125 2 HOH TIP A . C 3 HOH 25 126 3 HOH TIP A . C 3 HOH 26 127 4 HOH TIP A . C 3 HOH 27 128 5 HOH TIP A . C 3 HOH 28 129 6 HOH TIP A . C 3 HOH 29 130 7 HOH TIP A . C 3 HOH 30 131 8 HOH TIP A . C 3 HOH 31 132 9 HOH TIP A . C 3 HOH 32 133 10 HOH TIP A . C 3 HOH 33 134 11 HOH TIP A . C 3 HOH 34 135 12 HOH TIP A . C 3 HOH 35 136 13 HOH TIP A . C 3 HOH 36 137 14 HOH TIP A . C 3 HOH 37 138 15 HOH TIP A . C 3 HOH 38 139 16 HOH TIP A . C 3 HOH 39 140 17 HOH TIP A . C 3 HOH 40 141 18 HOH TIP A . C 3 HOH 41 142 19 HOH TIP A . C 3 HOH 42 143 20 HOH TIP A . C 3 HOH 43 144 21 HOH TIP A . C 3 HOH 44 145 22 HOH TIP A . C 3 HOH 45 146 23 HOH TIP A . C 3 HOH 46 147 24 HOH TIP A . C 3 HOH 47 148 25 HOH TIP A . C 3 HOH 48 149 26 HOH TIP A . C 3 HOH 49 150 27 HOH TIP A . C 3 HOH 50 151 28 HOH TIP A . C 3 HOH 51 152 29 HOH TIP A . C 3 HOH 52 153 30 HOH TIP A . C 3 HOH 53 154 31 HOH TIP A . C 3 HOH 54 155 32 HOH TIP A . C 3 HOH 55 156 33 HOH TIP A . C 3 HOH 56 157 34 HOH TIP A . C 3 HOH 57 158 35 HOH TIP A . C 3 HOH 58 159 36 HOH TIP A . C 3 HOH 59 160 37 HOH TIP A . C 3 HOH 60 161 38 HOH TIP A . C 3 HOH 61 162 39 HOH TIP A . C 3 HOH 62 163 40 HOH TIP A . C 3 HOH 63 164 41 HOH TIP A . C 3 HOH 64 165 42 HOH TIP A . C 3 HOH 65 166 43 HOH TIP A . C 3 HOH 66 167 44 HOH TIP A . C 3 HOH 67 168 45 HOH TIP A . C 3 HOH 68 169 46 HOH TIP A . C 3 HOH 69 170 47 HOH TIP A . C 3 HOH 70 171 48 HOH TIP A . C 3 HOH 71 172 49 HOH TIP A . C 3 HOH 72 173 50 HOH TIP A . C 3 HOH 73 174 51 HOH TIP A . C 3 HOH 74 175 52 HOH TIP A . C 3 HOH 75 176 53 HOH TIP A . C 3 HOH 76 177 54 HOH TIP A . C 3 HOH 77 178 55 HOH TIP A . C 3 HOH 78 179 56 HOH TIP A . C 3 HOH 79 180 57 HOH TIP A . C 3 HOH 80 181 58 HOH TIP A . C 3 HOH 81 182 59 HOH TIP A . C 3 HOH 82 183 60 HOH TIP A . C 3 HOH 83 184 61 HOH TIP A . C 3 HOH 84 185 62 HOH TIP A . C 3 HOH 85 186 63 HOH TIP A . C 3 HOH 86 187 64 HOH TIP A . C 3 HOH 87 188 65 HOH TIP A . C 3 HOH 88 189 66 HOH TIP A . C 3 HOH 89 190 67 HOH TIP A . C 3 HOH 90 191 68 HOH TIP A . C 3 HOH 91 192 69 HOH TIP A . C 3 HOH 92 193 70 HOH TIP A . C 3 HOH 93 194 71 HOH TIP A . C 3 HOH 94 195 72 HOH TIP A . C 3 HOH 95 196 73 HOH TIP A . C 3 HOH 96 197 74 HOH TIP A . C 3 HOH 97 198 75 HOH TIP A . C 3 HOH 98 199 76 HOH TIP A . C 3 HOH 99 200 77 HOH TIP A . C 3 HOH 100 201 78 HOH TIP A . C 3 HOH 101 202 79 HOH TIP A . C 3 HOH 102 203 80 HOH TIP A . C 3 HOH 103 204 81 HOH TIP A . C 3 HOH 104 205 82 HOH TIP A . C 3 HOH 105 206 83 HOH TIP A . C 3 HOH 106 207 84 HOH TIP A . C 3 HOH 107 208 85 HOH TIP A . C 3 HOH 108 209 86 HOH TIP A . C 3 HOH 109 210 87 HOH TIP A . C 3 HOH 110 211 88 HOH TIP A . C 3 HOH 111 212 89 HOH TIP A . C 3 HOH 112 213 90 HOH TIP A . C 3 HOH 113 214 91 HOH TIP A . C 3 HOH 114 215 92 HOH TIP A . C 3 HOH 115 216 93 HOH TIP A . C 3 HOH 116 217 94 HOH TIP A . C 3 HOH 117 218 95 HOH TIP A . C 3 HOH 118 219 96 HOH TIP A . C 3 HOH 119 220 97 HOH TIP A . C 3 HOH 120 221 98 HOH TIP A . C 3 HOH 121 222 99 HOH TIP A . C 3 HOH 122 223 100 HOH TIP A . C 3 HOH 123 224 101 HOH TIP A . #