data_3GCC # _entry.id 3GCC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3GCC pdb_00003gcc 10.2210/pdb3gcc/pdb WWPDB D_1000178979 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3GCC _pdbx_database_status.recvd_initial_deposition_date 1998-03-13 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Allen, M.D.' 1 'Yamasaki, K.' 2 'Ohme-Takagi, M.' 3 'Tateno, M.' 4 'Suzuki, M.' 5 # _citation.id primary _citation.title ;A novel mode of DNA recognition by a beta-sheet revealed by the solution structure of the GCC-box binding domain in complex with DNA. ; _citation.journal_abbrev 'EMBO J.' _citation.journal_volume 17 _citation.page_first 5484 _citation.page_last 5496 _citation.year 1998 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9736626 _citation.pdbx_database_id_DOI 10.1093/emboj/17.18.5484 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Allen, M.D.' 1 ? primary 'Yamasaki, K.' 2 ? primary 'Ohme-Takagi, M.' 3 ? primary 'Tateno, M.' 4 ? primary 'Suzuki, M.' 5 ? # _cell.entry_id 3GCC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3GCC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description ATERF1 _entity.formula_weight 7891.974 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'GCC-BOX BINDING DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGE _entity_poly.pdbx_seq_one_letter_code_can AKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LYS n 1 3 GLY n 1 4 LYS n 1 5 HIS n 1 6 TYR n 1 7 ARG n 1 8 GLY n 1 9 VAL n 1 10 ARG n 1 11 GLN n 1 12 ARG n 1 13 PRO n 1 14 TRP n 1 15 GLY n 1 16 LYS n 1 17 PHE n 1 18 ALA n 1 19 ALA n 1 20 GLU n 1 21 ILE n 1 22 ARG n 1 23 ASP n 1 24 PRO n 1 25 ALA n 1 26 LYS n 1 27 ASN n 1 28 GLY n 1 29 ALA n 1 30 ARG n 1 31 VAL n 1 32 TRP n 1 33 LEU n 1 34 GLY n 1 35 THR n 1 36 PHE n 1 37 GLU n 1 38 THR n 1 39 ALA n 1 40 GLU n 1 41 ASP n 1 42 ALA n 1 43 ALA n 1 44 LEU n 1 45 ALA n 1 46 TYR n 1 47 ASP n 1 48 ARG n 1 49 ALA n 1 50 ALA n 1 51 PHE n 1 52 ARG n 1 53 MET n 1 54 ARG n 1 55 GLY n 1 56 SER n 1 57 ARG n 1 58 ALA n 1 59 LEU n 1 60 LEU n 1 61 ASN n 1 62 PHE n 1 63 PRO n 1 64 LEU n 1 65 ARG n 1 66 VAL n 1 67 ASN n 1 68 SER n 1 69 GLY n 1 70 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene ATERF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PAF104 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'DNA-BINDING DOMAIN OF ATERF1' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ERF1A_ARATH _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession O80337 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MTADSQSDYAFLESIRRHLLGESEPILSESTASSVTQSCVTGQSIKPVYGRNPSFSKLYPCFTESWGDLPLKENDSEDML VYGILNDAFHGGWEPSSSSSDEDRSSFPSVKIETPESFAAVDSVPVKKEKTSPVSAAVTAAKGKHYRGVRQRPWGKFAAE IRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRVNSGEPDPVRIKSKRSSFSSSNENGAPKKRRTVAA GGGMDKGLTVKCEVVEVARGDRLLVL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3GCC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O80337 _struct_ref_seq.db_align_beg 141 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 210 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 141 _struct_ref_seq.pdbx_auth_seq_align_end 210 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 DQF-COSY 1 4 1 '1H-15N HSQC' 1 5 1 '3D 1H-15N NOESY-HMQC' 1 6 1 '3D 1H-15N TOCSY-HMQC' 1 7 1 13C 1 8 1 '15N-FILTERED NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '90 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ATMOSPHERE _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'POTASIUM PHOSPHATE' _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX750 Bruker 750 ? 2 DMX500 Bruker 500 ? # _pdbx_nmr_refine.entry_id 3GCC _pdbx_nmr_refine.method 'SIMULATED ANNEALING PROTOCOL IN X-PLOR 3.1 WAS CARRIED OUT TO OBTAIN 46 STRUCTURES.' _pdbx_nmr_refine.details 'SEE REMARK 210' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 3GCC _pdbx_nmr_details.text ;SIGNALS DUE TO PROTEINS WERE OBTAINED BY NOESY, TOCSY, DQF-COSY FOR UNLABELED SAMPLE AND 1H-15N HSQC, 3D 1H-15N NOESY-HMQC AND 3D 1H-15N TOCSY-HMQC FOR THE SAMPLE WITH 15N-LABELED PROTEIN. ; # _pdbx_nmr_ensemble.entry_id 3GCC _pdbx_nmr_ensemble.conformers_calculated_total_number 46 _pdbx_nmr_ensemble.conformers_submitted_total_number 46 _pdbx_nmr_ensemble.conformer_selection_criteria 'NO NOE VIOLATIONS' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR 3.1 ? 2 # _exptl.entry_id 3GCC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 3GCC _struct.title 'SOLUTION STRUCTURE OF THE GCC-BOX BINDING DOMAIN, NMR, 46 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3GCC _struct_keywords.pdbx_keywords 'TRANSCRIPTION FACTOR' _struct_keywords.text 'TRANSCRIPTION FACTOR, ETHLENE INDUCIBLE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 39 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 52 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 179 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 192 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 9 ? GLN A 11 ? VAL A 149 GLN A 151 A 2 PHE A 17 ? ASP A 23 ? PHE A 157 ASP A 163 A 3 ALA A 29 ? PHE A 36 ? ALA A 169 PHE A 176 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 10 ? O ARG A 150 N ALA A 18 ? N ALA A 158 A 2 3 O PHE A 17 ? O PHE A 157 N PHE A 36 ? N PHE A 176 # _database_PDB_matrix.entry_id 3GCC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3GCC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 141 ? ? ? A . n A 1 2 LYS 2 142 ? ? ? A . n A 1 3 GLY 3 143 ? ? ? A . n A 1 4 LYS 4 144 144 LYS LYS A . n A 1 5 HIS 5 145 145 HIS HIS A . n A 1 6 TYR 6 146 146 TYR TYR A . n A 1 7 ARG 7 147 147 ARG ARG A . n A 1 8 GLY 8 148 148 GLY GLY A . n A 1 9 VAL 9 149 149 VAL VAL A . n A 1 10 ARG 10 150 150 ARG ARG A . n A 1 11 GLN 11 151 151 GLN GLN A . n A 1 12 ARG 12 152 152 ARG ARG A . n A 1 13 PRO 13 153 153 PRO PRO A . n A 1 14 TRP 14 154 154 TRP TRP A . n A 1 15 GLY 15 155 155 GLY GLY A . n A 1 16 LYS 16 156 156 LYS LYS A . n A 1 17 PHE 17 157 157 PHE PHE A . n A 1 18 ALA 18 158 158 ALA ALA A . n A 1 19 ALA 19 159 159 ALA ALA A . n A 1 20 GLU 20 160 160 GLU GLU A . n A 1 21 ILE 21 161 161 ILE ILE A . n A 1 22 ARG 22 162 162 ARG ARG A . n A 1 23 ASP 23 163 163 ASP ASP A . n A 1 24 PRO 24 164 164 PRO PRO A . n A 1 25 ALA 25 165 165 ALA ALA A . n A 1 26 LYS 26 166 166 LYS LYS A . n A 1 27 ASN 27 167 167 ASN ASN A . n A 1 28 GLY 28 168 168 GLY GLY A . n A 1 29 ALA 29 169 169 ALA ALA A . n A 1 30 ARG 30 170 170 ARG ARG A . n A 1 31 VAL 31 171 171 VAL VAL A . n A 1 32 TRP 32 172 172 TRP TRP A . n A 1 33 LEU 33 173 173 LEU LEU A . n A 1 34 GLY 34 174 174 GLY GLY A . n A 1 35 THR 35 175 175 THR THR A . n A 1 36 PHE 36 176 176 PHE PHE A . n A 1 37 GLU 37 177 177 GLU GLU A . n A 1 38 THR 38 178 178 THR THR A . n A 1 39 ALA 39 179 179 ALA ALA A . n A 1 40 GLU 40 180 180 GLU GLU A . n A 1 41 ASP 41 181 181 ASP ASP A . n A 1 42 ALA 42 182 182 ALA ALA A . n A 1 43 ALA 43 183 183 ALA ALA A . n A 1 44 LEU 44 184 184 LEU LEU A . n A 1 45 ALA 45 185 185 ALA ALA A . n A 1 46 TYR 46 186 186 TYR TYR A . n A 1 47 ASP 47 187 187 ASP ASP A . n A 1 48 ARG 48 188 188 ARG ARG A . n A 1 49 ALA 49 189 189 ALA ALA A . n A 1 50 ALA 50 190 190 ALA ALA A . n A 1 51 PHE 51 191 191 PHE PHE A . n A 1 52 ARG 52 192 192 ARG ARG A . n A 1 53 MET 53 193 193 MET MET A . n A 1 54 ARG 54 194 194 ARG ARG A . n A 1 55 GLY 55 195 195 GLY GLY A . n A 1 56 SER 56 196 196 SER SER A . n A 1 57 ARG 57 197 197 ARG ARG A . n A 1 58 ALA 58 198 198 ALA ALA A . n A 1 59 LEU 59 199 199 LEU LEU A . n A 1 60 LEU 60 200 200 LEU LEU A . n A 1 61 ASN 61 201 201 ASN ASN A . n A 1 62 PHE 62 202 202 PHE PHE A . n A 1 63 PRO 63 203 203 PRO PRO A . n A 1 64 LEU 64 204 204 LEU LEU A . n A 1 65 ARG 65 205 205 ARG ARG A . n A 1 66 VAL 66 206 206 VAL VAL A . n A 1 67 ASN 67 207 ? ? ? A . n A 1 68 SER 68 208 ? ? ? A . n A 1 69 GLY 69 209 ? ? ? A . n A 1 70 GLU 70 210 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-03-23 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 146 ? ? -48.38 150.60 2 1 LYS A 166 ? ? -100.12 55.61 3 1 ARG A 197 ? ? 58.57 91.08 4 1 LEU A 204 ? ? 174.51 -73.63 5 2 HIS A 145 ? ? -178.30 -165.00 6 2 ARG A 147 ? ? -84.52 31.01 7 2 LYS A 156 ? ? -126.44 -169.24 8 2 LYS A 166 ? ? -91.40 37.82 9 2 SER A 196 ? ? 61.01 149.05 10 2 ARG A 197 ? ? 61.76 120.92 11 2 ALA A 198 ? ? 173.31 153.59 12 2 ARG A 205 ? ? 166.09 148.36 13 3 HIS A 145 ? ? 62.18 136.23 14 3 ASN A 167 ? ? 70.39 47.22 15 3 TRP A 172 ? ? -61.87 90.65 16 3 THR A 175 ? ? -68.24 -177.22 17 3 SER A 196 ? ? -63.96 -148.22 18 3 ARG A 197 ? ? -39.99 139.72 19 4 HIS A 145 ? ? -173.10 133.77 20 4 LYS A 166 ? ? -119.09 57.54 21 4 ASN A 167 ? ? 49.49 26.01 22 4 SER A 196 ? ? 50.53 -176.66 23 4 ARG A 197 ? ? -43.70 101.61 24 4 LEU A 199 ? ? 39.35 94.52 25 5 ARG A 147 ? ? -81.59 35.02 26 5 ALA A 169 ? ? 67.18 87.84 27 5 ARG A 197 ? ? 70.46 118.79 28 6 HIS A 145 ? ? -55.20 176.48 29 6 ILE A 161 ? ? -174.76 141.09 30 6 LYS A 166 ? ? -98.33 59.83 31 6 ALA A 169 ? ? 63.27 95.33 32 6 ARG A 170 ? ? -45.28 157.11 33 6 SER A 196 ? ? 80.91 102.19 34 6 ARG A 197 ? ? 64.71 -96.72 35 6 ALA A 198 ? ? 63.08 145.21 36 6 ARG A 205 ? ? 65.90 162.58 37 7 HIS A 145 ? ? 176.39 125.19 38 7 LYS A 166 ? ? -93.89 39.85 39 7 SER A 196 ? ? -108.02 -78.04 40 7 LEU A 204 ? ? -89.64 -73.68 41 7 ARG A 205 ? ? 49.73 -165.50 42 8 ARG A 147 ? ? -65.14 87.94 43 8 LYS A 166 ? ? -95.90 40.56 44 8 SER A 196 ? ? 61.56 142.57 45 8 ARG A 197 ? ? 43.06 -96.18 46 8 ALA A 198 ? ? 65.29 168.70 47 9 HIS A 145 ? ? 73.24 102.50 48 9 ASN A 167 ? ? 75.11 43.99 49 9 ARG A 197 ? ? 54.94 104.02 50 9 LEU A 204 ? ? 60.59 89.49 51 10 LYS A 166 ? ? -89.46 39.54 52 10 TRP A 172 ? ? -67.21 97.30 53 10 THR A 175 ? ? -67.77 -176.59 54 10 SER A 196 ? ? -138.76 -80.86 55 10 LEU A 204 ? ? -68.85 -92.40 56 10 ARG A 205 ? ? 52.65 -154.33 57 11 TRP A 154 ? ? 83.77 -60.53 58 11 ASN A 167 ? ? 75.19 58.34 59 11 GLU A 180 ? ? -66.23 -70.03 60 11 SER A 196 ? ? 56.25 81.66 61 11 ARG A 197 ? ? 53.42 100.30 62 11 LEU A 204 ? ? 47.86 -167.81 63 11 ARG A 205 ? ? -141.52 -75.64 64 12 HIS A 145 ? ? 63.97 113.30 65 12 LYS A 166 ? ? -104.83 43.60 66 12 SER A 196 ? ? 43.00 -165.40 67 12 ALA A 198 ? ? 60.29 177.81 68 12 LEU A 204 ? ? -108.21 -148.91 69 13 TRP A 154 ? ? -99.21 -64.53 70 13 LYS A 166 ? ? -107.42 53.90 71 13 SER A 196 ? ? 57.96 -93.61 72 13 ARG A 197 ? ? -124.87 -54.92 73 13 ALA A 198 ? ? 61.85 154.90 74 13 PRO A 203 ? ? -77.23 -168.89 75 14 HIS A 145 ? ? 65.29 116.13 76 14 TRP A 154 ? ? 70.47 75.56 77 14 ARG A 197 ? ? 56.35 160.68 78 14 ALA A 198 ? ? 177.32 144.18 79 15 HIS A 145 ? ? 62.14 -174.56 80 15 LYS A 166 ? ? -108.80 42.65 81 15 PHE A 176 ? ? -123.44 -166.40 82 15 SER A 196 ? ? -85.25 -146.34 83 15 ARG A 197 ? ? -38.46 140.59 84 15 ALA A 198 ? ? -157.14 32.69 85 15 LEU A 199 ? ? 41.68 92.61 86 15 LEU A 204 ? ? 48.00 -175.91 87 16 LYS A 166 ? ? -107.38 51.03 88 16 SER A 196 ? ? 50.26 -107.20 89 17 ARG A 170 ? ? -59.04 96.19 90 17 PHE A 176 ? ? -120.25 -168.22 91 17 ARG A 197 ? ? 56.82 109.53 92 17 LEU A 204 ? ? 51.64 -173.57 93 17 ARG A 205 ? ? 75.99 -169.73 94 18 ARG A 147 ? ? -82.03 36.18 95 18 LYS A 166 ? ? -100.40 64.33 96 18 SER A 196 ? ? 84.53 -47.71 97 18 ARG A 197 ? ? -171.73 128.81 98 18 LEU A 204 ? ? 51.78 -173.30 99 19 HIS A 145 ? ? -53.56 177.44 100 19 ASN A 167 ? ? 67.46 66.02 101 19 ALA A 169 ? ? 51.33 80.57 102 19 ARG A 170 ? ? -46.90 153.74 103 19 TRP A 172 ? ? -61.40 97.79 104 19 SER A 196 ? ? -48.20 176.75 105 19 ARG A 197 ? ? -42.77 160.76 106 19 ALA A 198 ? ? -157.72 37.00 107 19 LEU A 199 ? ? 39.89 93.36 108 19 PRO A 203 ? ? -76.82 -169.45 109 19 ARG A 205 ? ? -170.17 132.05 110 20 LYS A 166 ? ? -93.55 39.16 111 20 ALA A 169 ? ? -179.61 128.14 112 20 SER A 196 ? ? -54.17 -167.98 113 20 ARG A 197 ? ? -42.77 156.69 114 20 PRO A 203 ? ? -77.34 -169.14 115 20 LEU A 204 ? ? -72.65 -149.18 116 21 TRP A 154 ? ? -145.64 -67.54 117 21 LYS A 156 ? ? 147.79 148.31 118 21 ARG A 170 ? ? -48.69 166.14 119 21 SER A 196 ? ? 170.28 61.92 120 21 PHE A 202 ? ? -119.15 76.32 121 22 TRP A 154 ? ? 63.17 74.85 122 22 LYS A 166 ? ? -100.84 46.97 123 22 SER A 196 ? ? 58.81 71.95 124 22 ARG A 197 ? ? 50.12 97.38 125 22 LEU A 204 ? ? 41.83 91.43 126 22 ARG A 205 ? ? 59.36 -148.13 127 23 TRP A 154 ? ? 168.86 -58.57 128 23 LYS A 166 ? ? -96.98 44.79 129 23 SER A 196 ? ? -63.01 -97.94 130 23 ARG A 197 ? ? -48.99 153.14 131 23 ALA A 198 ? ? 178.80 160.91 132 23 ARG A 205 ? ? -158.97 44.38 133 24 HIS A 145 ? ? -48.56 173.13 134 24 ASN A 167 ? ? 50.88 72.54 135 24 ALA A 169 ? ? -169.07 102.93 136 24 PHE A 176 ? ? -127.11 -167.59 137 24 ASP A 181 ? ? -74.52 -70.66 138 24 SER A 196 ? ? -40.34 105.17 139 24 ARG A 197 ? ? 46.17 -173.77 140 24 ALA A 198 ? ? 170.73 152.59 141 24 ARG A 205 ? ? 54.52 -91.19 142 25 PRO A 153 ? ? -69.85 83.79 143 25 TRP A 154 ? ? 63.27 63.35 144 25 LYS A 156 ? ? -111.19 -169.67 145 25 LYS A 166 ? ? -89.03 44.76 146 25 SER A 196 ? ? 76.94 85.60 147 25 ARG A 197 ? ? 71.83 -84.07 148 25 ALA A 198 ? ? 67.02 162.47 149 25 LEU A 204 ? ? -43.77 -91.12 150 26 TRP A 154 ? ? 72.60 60.83 151 26 ALA A 158 ? ? -161.22 110.82 152 26 LYS A 166 ? ? -90.86 43.45 153 26 SER A 196 ? ? 48.39 -176.84 154 26 ALA A 198 ? ? 59.39 149.37 155 26 LEU A 204 ? ? 71.27 167.50 156 26 ARG A 205 ? ? -54.11 -169.45 157 27 TRP A 154 ? ? 74.92 -80.23 158 27 ASN A 167 ? ? 76.51 40.26 159 27 ARG A 197 ? ? 54.04 -117.64 160 27 ALA A 198 ? ? 65.35 125.75 161 28 HIS A 145 ? ? 61.07 128.90 162 28 LYS A 166 ? ? -97.50 44.67 163 28 SER A 196 ? ? 43.41 -158.18 164 28 LEU A 204 ? ? 65.00 65.59 165 29 HIS A 145 ? ? 70.88 113.20 166 29 SER A 196 ? ? -46.30 175.12 167 29 ARG A 197 ? ? -40.44 157.58 168 29 LEU A 204 ? ? 62.79 151.65 169 30 PRO A 153 ? ? -80.61 37.00 170 30 TRP A 154 ? ? -146.05 -62.28 171 30 ARG A 197 ? ? 68.53 138.85 172 30 ALA A 198 ? ? 176.47 140.81 173 30 LEU A 204 ? ? -109.18 -73.94 174 31 LYS A 166 ? ? -93.38 42.58 175 31 ARG A 170 ? ? -54.21 170.55 176 31 SER A 196 ? ? 63.12 129.99 177 31 ARG A 197 ? ? 44.26 -93.73 178 31 ALA A 198 ? ? 66.95 144.81 179 31 ARG A 205 ? ? 58.17 100.59 180 32 HIS A 145 ? ? -52.18 179.06 181 32 ARG A 147 ? ? -81.87 37.64 182 32 TRP A 154 ? ? -82.60 -74.98 183 32 LYS A 166 ? ? -99.14 51.05 184 32 ARG A 197 ? ? 61.19 139.86 185 32 ALA A 198 ? ? -170.57 144.51 186 32 ARG A 205 ? ? 58.23 104.58 187 33 ARG A 152 ? ? -74.86 -166.76 188 33 TRP A 154 ? ? 158.79 85.04 189 33 LYS A 156 ? ? -116.70 -168.53 190 33 ASN A 167 ? ? 169.14 36.55 191 33 ALA A 169 ? ? -57.09 108.36 192 33 SER A 196 ? ? 43.61 -159.24 193 33 LEU A 204 ? ? 54.05 172.00 194 34 HIS A 145 ? ? -152.70 71.48 195 34 ARG A 147 ? ? -81.01 36.07 196 34 ALA A 169 ? ? -177.11 79.71 197 34 ARG A 170 ? ? -43.20 163.80 198 34 SER A 196 ? ? 162.87 -71.92 199 34 ARG A 197 ? ? -173.67 62.05 200 34 ARG A 205 ? ? -171.95 132.64 201 35 ARG A 197 ? ? 62.86 110.08 202 35 ARG A 205 ? ? -140.55 -41.54 203 36 ARG A 152 ? ? -68.67 -174.95 204 36 TRP A 154 ? ? 63.70 65.41 205 36 PHE A 157 ? ? -101.71 -163.94 206 36 SER A 196 ? ? -54.85 -96.24 207 36 ALA A 198 ? ? 179.04 176.35 208 37 TRP A 154 ? ? 55.43 73.25 209 37 LYS A 156 ? ? -115.77 -168.78 210 37 ALA A 169 ? ? -179.86 80.57 211 37 PHE A 176 ? ? -120.01 -169.93 212 37 SER A 196 ? ? -54.65 -171.69 213 37 ARG A 197 ? ? -53.85 -173.73 214 37 ALA A 198 ? ? 177.44 160.29 215 37 LEU A 204 ? ? 173.94 175.64 216 37 ARG A 205 ? ? 61.10 114.68 217 38 LYS A 166 ? ? -94.91 33.22 218 38 PHE A 176 ? ? -122.41 -169.14 219 38 SER A 196 ? ? -61.42 89.16 220 38 ARG A 197 ? ? 62.84 136.58 221 38 PRO A 203 ? ? -79.98 49.23 222 39 LYS A 156 ? ? 175.31 163.12 223 39 ASN A 167 ? ? 166.81 52.68 224 39 SER A 196 ? ? 72.31 93.54 225 39 ARG A 197 ? ? 65.89 -92.48 226 39 ALA A 198 ? ? 63.59 147.60 227 39 LEU A 204 ? ? -102.17 -168.89 228 40 LYS A 166 ? ? -106.39 41.32 229 40 ASN A 167 ? ? 48.26 72.60 230 40 ARG A 197 ? ? 57.75 113.07 231 40 ARG A 205 ? ? 56.01 -175.66 232 41 SER A 196 ? ? -90.34 -66.65 233 41 ALA A 198 ? ? 172.52 153.07 234 41 ARG A 205 ? ? -115.70 53.83 235 42 TRP A 154 ? ? 61.45 69.57 236 42 ILE A 161 ? ? 174.68 138.09 237 42 ASN A 167 ? ? 76.49 33.72 238 42 ARG A 197 ? ? 55.30 103.55 239 42 ALA A 198 ? ? -159.52 31.80 240 42 LEU A 199 ? ? 36.57 98.19 241 42 LEU A 204 ? ? 33.80 41.36 242 43 TRP A 154 ? ? 179.63 -31.92 243 43 LYS A 166 ? ? -105.84 40.57 244 43 PRO A 203 ? ? -76.87 -169.01 245 43 LEU A 204 ? ? 46.60 78.38 246 44 LYS A 166 ? ? -106.14 44.78 247 44 SER A 196 ? ? 42.82 -149.94 248 44 LEU A 204 ? ? -161.68 -106.57 249 44 ARG A 205 ? ? -49.37 -81.82 250 45 TRP A 154 ? ? 66.77 64.78 251 45 LYS A 166 ? ? -90.38 33.24 252 45 ALA A 169 ? ? -161.81 97.90 253 45 ARG A 170 ? ? -45.56 155.63 254 45 ARG A 197 ? ? 52.77 -93.02 255 45 ALA A 198 ? ? 59.05 153.57 256 46 LYS A 166 ? ? -95.25 33.51 257 46 ALA A 169 ? ? -175.54 112.88 258 46 GLU A 180 ? ? -68.54 -70.82 259 46 ARG A 197 ? ? 62.76 125.00 260 46 ALA A 198 ? ? 179.92 145.70 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 147 ? ? 0.299 'SIDE CHAIN' 2 1 ARG A 150 ? ? 0.312 'SIDE CHAIN' 3 1 ARG A 152 ? ? 0.308 'SIDE CHAIN' 4 1 ARG A 162 ? ? 0.110 'SIDE CHAIN' 5 1 ARG A 170 ? ? 0.283 'SIDE CHAIN' 6 1 ARG A 188 ? ? 0.269 'SIDE CHAIN' 7 1 ARG A 192 ? ? 0.258 'SIDE CHAIN' 8 1 ARG A 194 ? ? 0.317 'SIDE CHAIN' 9 1 ARG A 197 ? ? 0.295 'SIDE CHAIN' 10 1 ARG A 205 ? ? 0.238 'SIDE CHAIN' 11 2 ARG A 147 ? ? 0.256 'SIDE CHAIN' 12 2 ARG A 150 ? ? 0.318 'SIDE CHAIN' 13 2 ARG A 152 ? ? 0.237 'SIDE CHAIN' 14 2 ARG A 162 ? ? 0.119 'SIDE CHAIN' 15 2 ARG A 170 ? ? 0.152 'SIDE CHAIN' 16 2 ARG A 188 ? ? 0.123 'SIDE CHAIN' 17 2 ARG A 192 ? ? 0.312 'SIDE CHAIN' 18 2 ARG A 194 ? ? 0.301 'SIDE CHAIN' 19 2 ARG A 197 ? ? 0.310 'SIDE CHAIN' 20 2 ARG A 205 ? ? 0.245 'SIDE CHAIN' 21 3 ARG A 147 ? ? 0.317 'SIDE CHAIN' 22 3 ARG A 150 ? ? 0.097 'SIDE CHAIN' 23 3 ARG A 152 ? ? 0.308 'SIDE CHAIN' 24 3 ARG A 162 ? ? 0.313 'SIDE CHAIN' 25 3 ARG A 170 ? ? 0.283 'SIDE CHAIN' 26 3 ARG A 188 ? ? 0.248 'SIDE CHAIN' 27 3 ARG A 192 ? ? 0.183 'SIDE CHAIN' 28 3 ARG A 194 ? ? 0.126 'SIDE CHAIN' 29 3 ARG A 197 ? ? 0.298 'SIDE CHAIN' 30 3 ARG A 205 ? ? 0.240 'SIDE CHAIN' 31 4 ARG A 147 ? ? 0.283 'SIDE CHAIN' 32 4 ARG A 150 ? ? 0.315 'SIDE CHAIN' 33 4 ARG A 152 ? ? 0.142 'SIDE CHAIN' 34 4 ARG A 162 ? ? 0.313 'SIDE CHAIN' 35 4 ARG A 170 ? ? 0.314 'SIDE CHAIN' 36 4 ARG A 188 ? ? 0.317 'SIDE CHAIN' 37 4 ARG A 192 ? ? 0.198 'SIDE CHAIN' 38 4 ARG A 194 ? ? 0.249 'SIDE CHAIN' 39 4 ARG A 197 ? ? 0.271 'SIDE CHAIN' 40 4 ARG A 205 ? ? 0.114 'SIDE CHAIN' 41 5 ARG A 147 ? ? 0.183 'SIDE CHAIN' 42 5 ARG A 150 ? ? 0.317 'SIDE CHAIN' 43 5 ARG A 152 ? ? 0.304 'SIDE CHAIN' 44 5 ARG A 162 ? ? 0.271 'SIDE CHAIN' 45 5 ARG A 170 ? ? 0.316 'SIDE CHAIN' 46 5 ARG A 188 ? ? 0.240 'SIDE CHAIN' 47 5 ARG A 192 ? ? 0.270 'SIDE CHAIN' 48 5 ARG A 194 ? ? 0.165 'SIDE CHAIN' 49 5 ARG A 197 ? ? 0.270 'SIDE CHAIN' 50 5 ARG A 205 ? ? 0.265 'SIDE CHAIN' 51 6 ARG A 147 ? ? 0.307 'SIDE CHAIN' 52 6 ARG A 150 ? ? 0.318 'SIDE CHAIN' 53 6 ARG A 152 ? ? 0.195 'SIDE CHAIN' 54 6 ARG A 162 ? ? 0.271 'SIDE CHAIN' 55 6 ARG A 170 ? ? 0.312 'SIDE CHAIN' 56 6 ARG A 188 ? ? 0.289 'SIDE CHAIN' 57 6 ARG A 192 ? ? 0.233 'SIDE CHAIN' 58 6 ARG A 194 ? ? 0.304 'SIDE CHAIN' 59 6 ARG A 197 ? ? 0.272 'SIDE CHAIN' 60 6 ARG A 205 ? ? 0.291 'SIDE CHAIN' 61 7 ARG A 147 ? ? 0.274 'SIDE CHAIN' 62 7 ARG A 150 ? ? 0.205 'SIDE CHAIN' 63 7 ARG A 152 ? ? 0.214 'SIDE CHAIN' 64 7 ARG A 162 ? ? 0.316 'SIDE CHAIN' 65 7 ARG A 170 ? ? 0.085 'SIDE CHAIN' 66 7 ARG A 188 ? ? 0.316 'SIDE CHAIN' 67 7 ARG A 192 ? ? 0.298 'SIDE CHAIN' 68 7 ARG A 194 ? ? 0.182 'SIDE CHAIN' 69 7 ARG A 197 ? ? 0.238 'SIDE CHAIN' 70 7 ARG A 205 ? ? 0.188 'SIDE CHAIN' 71 8 ARG A 147 ? ? 0.183 'SIDE CHAIN' 72 8 ARG A 150 ? ? 0.188 'SIDE CHAIN' 73 8 ARG A 152 ? ? 0.188 'SIDE CHAIN' 74 8 ARG A 170 ? ? 0.271 'SIDE CHAIN' 75 8 ARG A 188 ? ? 0.317 'SIDE CHAIN' 76 8 ARG A 192 ? ? 0.295 'SIDE CHAIN' 77 8 ARG A 194 ? ? 0.209 'SIDE CHAIN' 78 8 ARG A 197 ? ? 0.211 'SIDE CHAIN' 79 8 ARG A 205 ? ? 0.301 'SIDE CHAIN' 80 9 ARG A 147 ? ? 0.098 'SIDE CHAIN' 81 9 ARG A 150 ? ? 0.204 'SIDE CHAIN' 82 9 ARG A 152 ? ? 0.173 'SIDE CHAIN' 83 9 ARG A 162 ? ? 0.317 'SIDE CHAIN' 84 9 ARG A 170 ? ? 0.317 'SIDE CHAIN' 85 9 ARG A 188 ? ? 0.286 'SIDE CHAIN' 86 9 ARG A 192 ? ? 0.293 'SIDE CHAIN' 87 9 ARG A 194 ? ? 0.273 'SIDE CHAIN' 88 9 ARG A 197 ? ? 0.313 'SIDE CHAIN' 89 9 ARG A 205 ? ? 0.255 'SIDE CHAIN' 90 10 ARG A 147 ? ? 0.165 'SIDE CHAIN' 91 10 ARG A 150 ? ? 0.305 'SIDE CHAIN' 92 10 ARG A 152 ? ? 0.225 'SIDE CHAIN' 93 10 ARG A 162 ? ? 0.209 'SIDE CHAIN' 94 10 ARG A 170 ? ? 0.259 'SIDE CHAIN' 95 10 ARG A 188 ? ? 0.114 'SIDE CHAIN' 96 10 ARG A 192 ? ? 0.255 'SIDE CHAIN' 97 10 ARG A 194 ? ? 0.312 'SIDE CHAIN' 98 10 ARG A 197 ? ? 0.117 'SIDE CHAIN' 99 10 ARG A 205 ? ? 0.303 'SIDE CHAIN' 100 11 ARG A 147 ? ? 0.293 'SIDE CHAIN' 101 11 ARG A 150 ? ? 0.268 'SIDE CHAIN' 102 11 ARG A 152 ? ? 0.244 'SIDE CHAIN' 103 11 ARG A 162 ? ? 0.199 'SIDE CHAIN' 104 11 ARG A 170 ? ? 0.317 'SIDE CHAIN' 105 11 ARG A 188 ? ? 0.224 'SIDE CHAIN' 106 11 ARG A 192 ? ? 0.224 'SIDE CHAIN' 107 11 ARG A 194 ? ? 0.298 'SIDE CHAIN' 108 11 ARG A 197 ? ? 0.242 'SIDE CHAIN' 109 11 ARG A 205 ? ? 0.315 'SIDE CHAIN' 110 12 ARG A 147 ? ? 0.156 'SIDE CHAIN' 111 12 ARG A 150 ? ? 0.299 'SIDE CHAIN' 112 12 ARG A 152 ? ? 0.317 'SIDE CHAIN' 113 12 ARG A 162 ? ? 0.224 'SIDE CHAIN' 114 12 ARG A 170 ? ? 0.294 'SIDE CHAIN' 115 12 ARG A 188 ? ? 0.316 'SIDE CHAIN' 116 12 ARG A 194 ? ? 0.244 'SIDE CHAIN' 117 12 ARG A 197 ? ? 0.300 'SIDE CHAIN' 118 12 ARG A 205 ? ? 0.310 'SIDE CHAIN' 119 13 ARG A 147 ? ? 0.189 'SIDE CHAIN' 120 13 ARG A 150 ? ? 0.312 'SIDE CHAIN' 121 13 ARG A 152 ? ? 0.169 'SIDE CHAIN' 122 13 ARG A 162 ? ? 0.211 'SIDE CHAIN' 123 13 ARG A 170 ? ? 0.291 'SIDE CHAIN' 124 13 ARG A 188 ? ? 0.172 'SIDE CHAIN' 125 13 ARG A 192 ? ? 0.257 'SIDE CHAIN' 126 13 ARG A 194 ? ? 0.317 'SIDE CHAIN' 127 13 ARG A 197 ? ? 0.293 'SIDE CHAIN' 128 13 ARG A 205 ? ? 0.266 'SIDE CHAIN' 129 14 ARG A 147 ? ? 0.273 'SIDE CHAIN' 130 14 ARG A 150 ? ? 0.317 'SIDE CHAIN' 131 14 ARG A 152 ? ? 0.249 'SIDE CHAIN' 132 14 ARG A 162 ? ? 0.200 'SIDE CHAIN' 133 14 ARG A 170 ? ? 0.220 'SIDE CHAIN' 134 14 ARG A 188 ? ? 0.152 'SIDE CHAIN' 135 14 ARG A 192 ? ? 0.255 'SIDE CHAIN' 136 14 ARG A 194 ? ? 0.314 'SIDE CHAIN' 137 14 ARG A 197 ? ? 0.212 'SIDE CHAIN' 138 14 ARG A 205 ? ? 0.316 'SIDE CHAIN' 139 15 ARG A 147 ? ? 0.309 'SIDE CHAIN' 140 15 ARG A 150 ? ? 0.277 'SIDE CHAIN' 141 15 ARG A 152 ? ? 0.221 'SIDE CHAIN' 142 15 ARG A 162 ? ? 0.280 'SIDE CHAIN' 143 15 ARG A 170 ? ? 0.313 'SIDE CHAIN' 144 15 ARG A 188 ? ? 0.175 'SIDE CHAIN' 145 15 ARG A 192 ? ? 0.315 'SIDE CHAIN' 146 15 ARG A 194 ? ? 0.318 'SIDE CHAIN' 147 15 ARG A 197 ? ? 0.167 'SIDE CHAIN' 148 15 ARG A 205 ? ? 0.215 'SIDE CHAIN' 149 16 ARG A 147 ? ? 0.232 'SIDE CHAIN' 150 16 ARG A 150 ? ? 0.311 'SIDE CHAIN' 151 16 ARG A 152 ? ? 0.317 'SIDE CHAIN' 152 16 ARG A 162 ? ? 0.121 'SIDE CHAIN' 153 16 ARG A 170 ? ? 0.251 'SIDE CHAIN' 154 16 ARG A 188 ? ? 0.133 'SIDE CHAIN' 155 16 ARG A 192 ? ? 0.164 'SIDE CHAIN' 156 16 ARG A 194 ? ? 0.288 'SIDE CHAIN' 157 16 ARG A 197 ? ? 0.277 'SIDE CHAIN' 158 16 ARG A 205 ? ? 0.317 'SIDE CHAIN' 159 17 ARG A 147 ? ? 0.310 'SIDE CHAIN' 160 17 ARG A 150 ? ? 0.299 'SIDE CHAIN' 161 17 ARG A 152 ? ? 0.304 'SIDE CHAIN' 162 17 ARG A 162 ? ? 0.240 'SIDE CHAIN' 163 17 ARG A 170 ? ? 0.126 'SIDE CHAIN' 164 17 ARG A 188 ? ? 0.212 'SIDE CHAIN' 165 17 ARG A 192 ? ? 0.241 'SIDE CHAIN' 166 17 ARG A 194 ? ? 0.188 'SIDE CHAIN' 167 17 ARG A 197 ? ? 0.316 'SIDE CHAIN' 168 17 ARG A 205 ? ? 0.150 'SIDE CHAIN' 169 18 ARG A 147 ? ? 0.179 'SIDE CHAIN' 170 18 ARG A 150 ? ? 0.299 'SIDE CHAIN' 171 18 ARG A 152 ? ? 0.279 'SIDE CHAIN' 172 18 ARG A 162 ? ? 0.314 'SIDE CHAIN' 173 18 ARG A 170 ? ? 0.303 'SIDE CHAIN' 174 18 ARG A 188 ? ? 0.301 'SIDE CHAIN' 175 18 ARG A 192 ? ? 0.158 'SIDE CHAIN' 176 18 ARG A 194 ? ? 0.079 'SIDE CHAIN' 177 18 ARG A 197 ? ? 0.243 'SIDE CHAIN' 178 18 ARG A 205 ? ? 0.248 'SIDE CHAIN' 179 19 ARG A 147 ? ? 0.112 'SIDE CHAIN' 180 19 ARG A 150 ? ? 0.209 'SIDE CHAIN' 181 19 ARG A 152 ? ? 0.313 'SIDE CHAIN' 182 19 ARG A 162 ? ? 0.136 'SIDE CHAIN' 183 19 ARG A 170 ? ? 0.300 'SIDE CHAIN' 184 19 ARG A 188 ? ? 0.318 'SIDE CHAIN' 185 19 ARG A 192 ? ? 0.172 'SIDE CHAIN' 186 19 ARG A 194 ? ? 0.271 'SIDE CHAIN' 187 19 ARG A 205 ? ? 0.312 'SIDE CHAIN' 188 20 ARG A 147 ? ? 0.304 'SIDE CHAIN' 189 20 ARG A 150 ? ? 0.109 'SIDE CHAIN' 190 20 ARG A 152 ? ? 0.307 'SIDE CHAIN' 191 20 ARG A 162 ? ? 0.243 'SIDE CHAIN' 192 20 ARG A 170 ? ? 0.316 'SIDE CHAIN' 193 20 ARG A 188 ? ? 0.288 'SIDE CHAIN' 194 20 ARG A 197 ? ? 0.312 'SIDE CHAIN' 195 20 ARG A 205 ? ? 0.311 'SIDE CHAIN' 196 21 ARG A 147 ? ? 0.315 'SIDE CHAIN' 197 21 ARG A 150 ? ? 0.289 'SIDE CHAIN' 198 21 ARG A 152 ? ? 0.191 'SIDE CHAIN' 199 21 ARG A 162 ? ? 0.162 'SIDE CHAIN' 200 21 ARG A 170 ? ? 0.208 'SIDE CHAIN' 201 21 ARG A 188 ? ? 0.293 'SIDE CHAIN' 202 21 ARG A 192 ? ? 0.317 'SIDE CHAIN' 203 21 ARG A 194 ? ? 0.244 'SIDE CHAIN' 204 21 ARG A 197 ? ? 0.160 'SIDE CHAIN' 205 21 ARG A 205 ? ? 0.315 'SIDE CHAIN' 206 22 ARG A 147 ? ? 0.168 'SIDE CHAIN' 207 22 ARG A 150 ? ? 0.289 'SIDE CHAIN' 208 22 ARG A 152 ? ? 0.302 'SIDE CHAIN' 209 22 ARG A 162 ? ? 0.165 'SIDE CHAIN' 210 22 ARG A 170 ? ? 0.288 'SIDE CHAIN' 211 22 ARG A 188 ? ? 0.144 'SIDE CHAIN' 212 22 ARG A 194 ? ? 0.307 'SIDE CHAIN' 213 22 ARG A 197 ? ? 0.310 'SIDE CHAIN' 214 22 ARG A 205 ? ? 0.224 'SIDE CHAIN' 215 23 ARG A 147 ? ? 0.237 'SIDE CHAIN' 216 23 ARG A 150 ? ? 0.252 'SIDE CHAIN' 217 23 ARG A 152 ? ? 0.175 'SIDE CHAIN' 218 23 ARG A 162 ? ? 0.187 'SIDE CHAIN' 219 23 ARG A 170 ? ? 0.318 'SIDE CHAIN' 220 23 ARG A 192 ? ? 0.307 'SIDE CHAIN' 221 23 ARG A 194 ? ? 0.302 'SIDE CHAIN' 222 23 ARG A 197 ? ? 0.308 'SIDE CHAIN' 223 23 ARG A 205 ? ? 0.248 'SIDE CHAIN' 224 24 ARG A 147 ? ? 0.294 'SIDE CHAIN' 225 24 ARG A 152 ? ? 0.316 'SIDE CHAIN' 226 24 ARG A 162 ? ? 0.226 'SIDE CHAIN' 227 24 ARG A 170 ? ? 0.309 'SIDE CHAIN' 228 24 ARG A 188 ? ? 0.172 'SIDE CHAIN' 229 24 ARG A 192 ? ? 0.301 'SIDE CHAIN' 230 24 ARG A 194 ? ? 0.191 'SIDE CHAIN' 231 24 ARG A 197 ? ? 0.315 'SIDE CHAIN' 232 24 ARG A 205 ? ? 0.259 'SIDE CHAIN' 233 25 ARG A 147 ? ? 0.288 'SIDE CHAIN' 234 25 ARG A 150 ? ? 0.254 'SIDE CHAIN' 235 25 ARG A 152 ? ? 0.256 'SIDE CHAIN' 236 25 ARG A 162 ? ? 0.225 'SIDE CHAIN' 237 25 ARG A 170 ? ? 0.247 'SIDE CHAIN' 238 25 ARG A 188 ? ? 0.200 'SIDE CHAIN' 239 25 ARG A 194 ? ? 0.143 'SIDE CHAIN' 240 25 ARG A 197 ? ? 0.253 'SIDE CHAIN' 241 25 ARG A 205 ? ? 0.275 'SIDE CHAIN' 242 26 ARG A 147 ? ? 0.290 'SIDE CHAIN' 243 26 ARG A 150 ? ? 0.275 'SIDE CHAIN' 244 26 ARG A 152 ? ? 0.246 'SIDE CHAIN' 245 26 ARG A 162 ? ? 0.306 'SIDE CHAIN' 246 26 ARG A 170 ? ? 0.310 'SIDE CHAIN' 247 26 ARG A 188 ? ? 0.287 'SIDE CHAIN' 248 26 ARG A 192 ? ? 0.219 'SIDE CHAIN' 249 26 ARG A 194 ? ? 0.188 'SIDE CHAIN' 250 26 ARG A 197 ? ? 0.259 'SIDE CHAIN' 251 26 ARG A 205 ? ? 0.231 'SIDE CHAIN' 252 27 ARG A 147 ? ? 0.317 'SIDE CHAIN' 253 27 ARG A 150 ? ? 0.318 'SIDE CHAIN' 254 27 ARG A 162 ? ? 0.316 'SIDE CHAIN' 255 27 ARG A 170 ? ? 0.245 'SIDE CHAIN' 256 27 ARG A 188 ? ? 0.312 'SIDE CHAIN' 257 27 ARG A 192 ? ? 0.309 'SIDE CHAIN' 258 27 ARG A 194 ? ? 0.317 'SIDE CHAIN' 259 27 ARG A 197 ? ? 0.251 'SIDE CHAIN' 260 27 ARG A 205 ? ? 0.132 'SIDE CHAIN' 261 28 ARG A 147 ? ? 0.300 'SIDE CHAIN' 262 28 ARG A 150 ? ? 0.275 'SIDE CHAIN' 263 28 ARG A 152 ? ? 0.282 'SIDE CHAIN' 264 28 ARG A 162 ? ? 0.316 'SIDE CHAIN' 265 28 ARG A 170 ? ? 0.318 'SIDE CHAIN' 266 28 ARG A 188 ? ? 0.309 'SIDE CHAIN' 267 28 ARG A 192 ? ? 0.304 'SIDE CHAIN' 268 28 ARG A 194 ? ? 0.290 'SIDE CHAIN' 269 28 ARG A 197 ? ? 0.250 'SIDE CHAIN' 270 28 ARG A 205 ? ? 0.180 'SIDE CHAIN' 271 29 ARG A 147 ? ? 0.188 'SIDE CHAIN' 272 29 ARG A 150 ? ? 0.123 'SIDE CHAIN' 273 29 ARG A 152 ? ? 0.261 'SIDE CHAIN' 274 29 ARG A 162 ? ? 0.254 'SIDE CHAIN' 275 29 ARG A 170 ? ? 0.256 'SIDE CHAIN' 276 29 ARG A 188 ? ? 0.283 'SIDE CHAIN' 277 29 ARG A 192 ? ? 0.314 'SIDE CHAIN' 278 29 ARG A 194 ? ? 0.309 'SIDE CHAIN' 279 29 ARG A 197 ? ? 0.287 'SIDE CHAIN' 280 29 ARG A 205 ? ? 0.237 'SIDE CHAIN' 281 30 ARG A 147 ? ? 0.315 'SIDE CHAIN' 282 30 ARG A 150 ? ? 0.276 'SIDE CHAIN' 283 30 ARG A 152 ? ? 0.310 'SIDE CHAIN' 284 30 ARG A 162 ? ? 0.307 'SIDE CHAIN' 285 30 ARG A 170 ? ? 0.294 'SIDE CHAIN' 286 30 ARG A 188 ? ? 0.317 'SIDE CHAIN' 287 30 ARG A 192 ? ? 0.289 'SIDE CHAIN' 288 30 ARG A 194 ? ? 0.255 'SIDE CHAIN' 289 30 ARG A 197 ? ? 0.294 'SIDE CHAIN' 290 30 ARG A 205 ? ? 0.313 'SIDE CHAIN' 291 31 ARG A 147 ? ? 0.299 'SIDE CHAIN' 292 31 ARG A 150 ? ? 0.300 'SIDE CHAIN' 293 31 ARG A 152 ? ? 0.273 'SIDE CHAIN' 294 31 ARG A 162 ? ? 0.238 'SIDE CHAIN' 295 31 ARG A 170 ? ? 0.148 'SIDE CHAIN' 296 31 ARG A 188 ? ? 0.314 'SIDE CHAIN' 297 31 ARG A 192 ? ? 0.279 'SIDE CHAIN' 298 31 ARG A 194 ? ? 0.232 'SIDE CHAIN' 299 31 ARG A 197 ? ? 0.183 'SIDE CHAIN' 300 31 ARG A 205 ? ? 0.141 'SIDE CHAIN' 301 32 ARG A 147 ? ? 0.288 'SIDE CHAIN' 302 32 ARG A 150 ? ? 0.315 'SIDE CHAIN' 303 32 ARG A 152 ? ? 0.161 'SIDE CHAIN' 304 32 ARG A 162 ? ? 0.307 'SIDE CHAIN' 305 32 ARG A 170 ? ? 0.269 'SIDE CHAIN' 306 32 ARG A 188 ? ? 0.259 'SIDE CHAIN' 307 32 ARG A 192 ? ? 0.307 'SIDE CHAIN' 308 32 ARG A 194 ? ? 0.313 'SIDE CHAIN' 309 32 ARG A 197 ? ? 0.318 'SIDE CHAIN' 310 32 ARG A 205 ? ? 0.307 'SIDE CHAIN' 311 33 ARG A 147 ? ? 0.291 'SIDE CHAIN' 312 33 ARG A 150 ? ? 0.299 'SIDE CHAIN' 313 33 ARG A 152 ? ? 0.272 'SIDE CHAIN' 314 33 ARG A 162 ? ? 0.299 'SIDE CHAIN' 315 33 ARG A 170 ? ? 0.305 'SIDE CHAIN' 316 33 ARG A 188 ? ? 0.174 'SIDE CHAIN' 317 33 ARG A 192 ? ? 0.250 'SIDE CHAIN' 318 33 ARG A 194 ? ? 0.250 'SIDE CHAIN' 319 33 ARG A 197 ? ? 0.164 'SIDE CHAIN' 320 33 ARG A 205 ? ? 0.302 'SIDE CHAIN' 321 34 ARG A 147 ? ? 0.265 'SIDE CHAIN' 322 34 ARG A 150 ? ? 0.159 'SIDE CHAIN' 323 34 ARG A 152 ? ? 0.309 'SIDE CHAIN' 324 34 ARG A 162 ? ? 0.301 'SIDE CHAIN' 325 34 ARG A 170 ? ? 0.207 'SIDE CHAIN' 326 34 ARG A 188 ? ? 0.205 'SIDE CHAIN' 327 34 ARG A 192 ? ? 0.217 'SIDE CHAIN' 328 34 ARG A 194 ? ? 0.182 'SIDE CHAIN' 329 34 ARG A 197 ? ? 0.314 'SIDE CHAIN' 330 34 ARG A 205 ? ? 0.275 'SIDE CHAIN' 331 35 ARG A 147 ? ? 0.263 'SIDE CHAIN' 332 35 ARG A 150 ? ? 0.317 'SIDE CHAIN' 333 35 ARG A 152 ? ? 0.229 'SIDE CHAIN' 334 35 ARG A 162 ? ? 0.147 'SIDE CHAIN' 335 35 ARG A 170 ? ? 0.302 'SIDE CHAIN' 336 35 ARG A 188 ? ? 0.303 'SIDE CHAIN' 337 35 ARG A 192 ? ? 0.299 'SIDE CHAIN' 338 35 ARG A 194 ? ? 0.188 'SIDE CHAIN' 339 35 ARG A 197 ? ? 0.314 'SIDE CHAIN' 340 35 ARG A 205 ? ? 0.293 'SIDE CHAIN' 341 36 ARG A 147 ? ? 0.314 'SIDE CHAIN' 342 36 ARG A 150 ? ? 0.207 'SIDE CHAIN' 343 36 ARG A 152 ? ? 0.317 'SIDE CHAIN' 344 36 ARG A 170 ? ? 0.137 'SIDE CHAIN' 345 36 ARG A 192 ? ? 0.317 'SIDE CHAIN' 346 36 ARG A 194 ? ? 0.313 'SIDE CHAIN' 347 36 ARG A 197 ? ? 0.241 'SIDE CHAIN' 348 36 ARG A 205 ? ? 0.283 'SIDE CHAIN' 349 37 ARG A 150 ? ? 0.264 'SIDE CHAIN' 350 37 ARG A 152 ? ? 0.274 'SIDE CHAIN' 351 37 ARG A 162 ? ? 0.314 'SIDE CHAIN' 352 37 ARG A 170 ? ? 0.240 'SIDE CHAIN' 353 37 ARG A 192 ? ? 0.201 'SIDE CHAIN' 354 37 ARG A 194 ? ? 0.164 'SIDE CHAIN' 355 37 ARG A 197 ? ? 0.306 'SIDE CHAIN' 356 37 ARG A 205 ? ? 0.312 'SIDE CHAIN' 357 38 ARG A 147 ? ? 0.133 'SIDE CHAIN' 358 38 ARG A 150 ? ? 0.130 'SIDE CHAIN' 359 38 ARG A 152 ? ? 0.313 'SIDE CHAIN' 360 38 ARG A 162 ? ? 0.142 'SIDE CHAIN' 361 38 ARG A 170 ? ? 0.192 'SIDE CHAIN' 362 38 ARG A 188 ? ? 0.317 'SIDE CHAIN' 363 38 ARG A 192 ? ? 0.139 'SIDE CHAIN' 364 38 ARG A 194 ? ? 0.274 'SIDE CHAIN' 365 38 ARG A 197 ? ? 0.253 'SIDE CHAIN' 366 38 ARG A 205 ? ? 0.306 'SIDE CHAIN' 367 39 ARG A 147 ? ? 0.201 'SIDE CHAIN' 368 39 ARG A 150 ? ? 0.299 'SIDE CHAIN' 369 39 ARG A 162 ? ? 0.149 'SIDE CHAIN' 370 39 ARG A 170 ? ? 0.278 'SIDE CHAIN' 371 39 ARG A 188 ? ? 0.309 'SIDE CHAIN' 372 39 ARG A 192 ? ? 0.257 'SIDE CHAIN' 373 39 ARG A 194 ? ? 0.313 'SIDE CHAIN' 374 39 ARG A 197 ? ? 0.192 'SIDE CHAIN' 375 39 ARG A 205 ? ? 0.274 'SIDE CHAIN' 376 40 ARG A 147 ? ? 0.318 'SIDE CHAIN' 377 40 ARG A 150 ? ? 0.211 'SIDE CHAIN' 378 40 ARG A 152 ? ? 0.292 'SIDE CHAIN' 379 40 ARG A 162 ? ? 0.213 'SIDE CHAIN' 380 40 ARG A 170 ? ? 0.207 'SIDE CHAIN' 381 40 ARG A 188 ? ? 0.229 'SIDE CHAIN' 382 40 ARG A 192 ? ? 0.164 'SIDE CHAIN' 383 40 ARG A 194 ? ? 0.289 'SIDE CHAIN' 384 40 ARG A 197 ? ? 0.262 'SIDE CHAIN' 385 40 ARG A 205 ? ? 0.253 'SIDE CHAIN' 386 41 ARG A 147 ? ? 0.244 'SIDE CHAIN' 387 41 ARG A 150 ? ? 0.279 'SIDE CHAIN' 388 41 ARG A 152 ? ? 0.242 'SIDE CHAIN' 389 41 ARG A 162 ? ? 0.271 'SIDE CHAIN' 390 41 ARG A 170 ? ? 0.283 'SIDE CHAIN' 391 41 ARG A 188 ? ? 0.315 'SIDE CHAIN' 392 41 ARG A 192 ? ? 0.317 'SIDE CHAIN' 393 41 ARG A 194 ? ? 0.312 'SIDE CHAIN' 394 41 ARG A 197 ? ? 0.275 'SIDE CHAIN' 395 41 ARG A 205 ? ? 0.295 'SIDE CHAIN' 396 42 ARG A 147 ? ? 0.302 'SIDE CHAIN' 397 42 ARG A 150 ? ? 0.317 'SIDE CHAIN' 398 42 ARG A 152 ? ? 0.259 'SIDE CHAIN' 399 42 ARG A 162 ? ? 0.171 'SIDE CHAIN' 400 42 ARG A 170 ? ? 0.217 'SIDE CHAIN' 401 42 ARG A 188 ? ? 0.257 'SIDE CHAIN' 402 42 ARG A 192 ? ? 0.211 'SIDE CHAIN' 403 42 ARG A 194 ? ? 0.094 'SIDE CHAIN' 404 42 ARG A 197 ? ? 0.255 'SIDE CHAIN' 405 42 ARG A 205 ? ? 0.281 'SIDE CHAIN' 406 43 ARG A 147 ? ? 0.198 'SIDE CHAIN' 407 43 ARG A 150 ? ? 0.298 'SIDE CHAIN' 408 43 ARG A 152 ? ? 0.174 'SIDE CHAIN' 409 43 ARG A 162 ? ? 0.315 'SIDE CHAIN' 410 43 ARG A 170 ? ? 0.250 'SIDE CHAIN' 411 43 ARG A 188 ? ? 0.293 'SIDE CHAIN' 412 43 ARG A 192 ? ? 0.247 'SIDE CHAIN' 413 43 ARG A 194 ? ? 0.318 'SIDE CHAIN' 414 43 ARG A 197 ? ? 0.297 'SIDE CHAIN' 415 43 ARG A 205 ? ? 0.318 'SIDE CHAIN' 416 44 ARG A 147 ? ? 0.293 'SIDE CHAIN' 417 44 ARG A 150 ? ? 0.222 'SIDE CHAIN' 418 44 ARG A 152 ? ? 0.318 'SIDE CHAIN' 419 44 ARG A 162 ? ? 0.309 'SIDE CHAIN' 420 44 ARG A 170 ? ? 0.314 'SIDE CHAIN' 421 44 ARG A 188 ? ? 0.240 'SIDE CHAIN' 422 44 ARG A 192 ? ? 0.293 'SIDE CHAIN' 423 44 ARG A 197 ? ? 0.239 'SIDE CHAIN' 424 44 ARG A 205 ? ? 0.222 'SIDE CHAIN' 425 45 ARG A 150 ? ? 0.265 'SIDE CHAIN' 426 45 ARG A 152 ? ? 0.272 'SIDE CHAIN' 427 45 ARG A 162 ? ? 0.208 'SIDE CHAIN' 428 45 ARG A 170 ? ? 0.304 'SIDE CHAIN' 429 45 ARG A 188 ? ? 0.305 'SIDE CHAIN' 430 45 ARG A 192 ? ? 0.217 'SIDE CHAIN' 431 45 ARG A 194 ? ? 0.192 'SIDE CHAIN' 432 45 ARG A 197 ? ? 0.261 'SIDE CHAIN' 433 45 ARG A 205 ? ? 0.317 'SIDE CHAIN' 434 46 ARG A 147 ? ? 0.277 'SIDE CHAIN' 435 46 ARG A 150 ? ? 0.301 'SIDE CHAIN' 436 46 ARG A 152 ? ? 0.078 'SIDE CHAIN' 437 46 ARG A 162 ? ? 0.269 'SIDE CHAIN' 438 46 ARG A 170 ? ? 0.260 'SIDE CHAIN' 439 46 ARG A 188 ? ? 0.188 'SIDE CHAIN' 440 46 ARG A 192 ? ? 0.090 'SIDE CHAIN' 441 46 ARG A 194 ? ? 0.307 'SIDE CHAIN' 442 46 ARG A 197 ? ? 0.313 'SIDE CHAIN' 443 46 ARG A 205 ? ? 0.153 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 141 ? A ALA 1 2 1 Y 1 A LYS 142 ? A LYS 2 3 1 Y 1 A GLY 143 ? A GLY 3 4 1 Y 1 A ASN 207 ? A ASN 67 5 1 Y 1 A SER 208 ? A SER 68 6 1 Y 1 A GLY 209 ? A GLY 69 7 1 Y 1 A GLU 210 ? A GLU 70 8 2 Y 1 A ALA 141 ? A ALA 1 9 2 Y 1 A LYS 142 ? A LYS 2 10 2 Y 1 A GLY 143 ? A GLY 3 11 2 Y 1 A ASN 207 ? A ASN 67 12 2 Y 1 A SER 208 ? A SER 68 13 2 Y 1 A GLY 209 ? A GLY 69 14 2 Y 1 A GLU 210 ? A GLU 70 15 3 Y 1 A ALA 141 ? A ALA 1 16 3 Y 1 A LYS 142 ? A LYS 2 17 3 Y 1 A GLY 143 ? A GLY 3 18 3 Y 1 A ASN 207 ? A ASN 67 19 3 Y 1 A SER 208 ? A SER 68 20 3 Y 1 A GLY 209 ? A GLY 69 21 3 Y 1 A GLU 210 ? A GLU 70 22 4 Y 1 A ALA 141 ? A ALA 1 23 4 Y 1 A LYS 142 ? A LYS 2 24 4 Y 1 A GLY 143 ? A GLY 3 25 4 Y 1 A ASN 207 ? A ASN 67 26 4 Y 1 A SER 208 ? A SER 68 27 4 Y 1 A GLY 209 ? A GLY 69 28 4 Y 1 A GLU 210 ? A GLU 70 29 5 Y 1 A ALA 141 ? A ALA 1 30 5 Y 1 A LYS 142 ? A LYS 2 31 5 Y 1 A GLY 143 ? A GLY 3 32 5 Y 1 A ASN 207 ? A ASN 67 33 5 Y 1 A SER 208 ? A SER 68 34 5 Y 1 A GLY 209 ? A GLY 69 35 5 Y 1 A GLU 210 ? A GLU 70 36 6 Y 1 A ALA 141 ? A ALA 1 37 6 Y 1 A LYS 142 ? A LYS 2 38 6 Y 1 A GLY 143 ? A GLY 3 39 6 Y 1 A ASN 207 ? A ASN 67 40 6 Y 1 A SER 208 ? A SER 68 41 6 Y 1 A GLY 209 ? A GLY 69 42 6 Y 1 A GLU 210 ? A GLU 70 43 7 Y 1 A ALA 141 ? A ALA 1 44 7 Y 1 A LYS 142 ? A LYS 2 45 7 Y 1 A GLY 143 ? A GLY 3 46 7 Y 1 A ASN 207 ? A ASN 67 47 7 Y 1 A SER 208 ? A SER 68 48 7 Y 1 A GLY 209 ? A GLY 69 49 7 Y 1 A GLU 210 ? A GLU 70 50 8 Y 1 A ALA 141 ? A ALA 1 51 8 Y 1 A LYS 142 ? A LYS 2 52 8 Y 1 A GLY 143 ? A GLY 3 53 8 Y 1 A ASN 207 ? A ASN 67 54 8 Y 1 A SER 208 ? A SER 68 55 8 Y 1 A GLY 209 ? A GLY 69 56 8 Y 1 A GLU 210 ? A GLU 70 57 9 Y 1 A ALA 141 ? A ALA 1 58 9 Y 1 A LYS 142 ? A LYS 2 59 9 Y 1 A GLY 143 ? A GLY 3 60 9 Y 1 A ASN 207 ? A ASN 67 61 9 Y 1 A SER 208 ? A SER 68 62 9 Y 1 A GLY 209 ? A GLY 69 63 9 Y 1 A GLU 210 ? A GLU 70 64 10 Y 1 A ALA 141 ? A ALA 1 65 10 Y 1 A LYS 142 ? A LYS 2 66 10 Y 1 A GLY 143 ? A GLY 3 67 10 Y 1 A ASN 207 ? A ASN 67 68 10 Y 1 A SER 208 ? A SER 68 69 10 Y 1 A GLY 209 ? A GLY 69 70 10 Y 1 A GLU 210 ? A GLU 70 71 11 Y 1 A ALA 141 ? A ALA 1 72 11 Y 1 A LYS 142 ? A LYS 2 73 11 Y 1 A GLY 143 ? A GLY 3 74 11 Y 1 A ASN 207 ? A ASN 67 75 11 Y 1 A SER 208 ? A SER 68 76 11 Y 1 A GLY 209 ? A GLY 69 77 11 Y 1 A GLU 210 ? A GLU 70 78 12 Y 1 A ALA 141 ? A ALA 1 79 12 Y 1 A LYS 142 ? A LYS 2 80 12 Y 1 A GLY 143 ? A GLY 3 81 12 Y 1 A ASN 207 ? A ASN 67 82 12 Y 1 A SER 208 ? A SER 68 83 12 Y 1 A GLY 209 ? A GLY 69 84 12 Y 1 A GLU 210 ? A GLU 70 85 13 Y 1 A ALA 141 ? A ALA 1 86 13 Y 1 A LYS 142 ? A LYS 2 87 13 Y 1 A GLY 143 ? A GLY 3 88 13 Y 1 A ASN 207 ? A ASN 67 89 13 Y 1 A SER 208 ? A SER 68 90 13 Y 1 A GLY 209 ? A GLY 69 91 13 Y 1 A GLU 210 ? A GLU 70 92 14 Y 1 A ALA 141 ? A ALA 1 93 14 Y 1 A LYS 142 ? A LYS 2 94 14 Y 1 A GLY 143 ? A GLY 3 95 14 Y 1 A ASN 207 ? A ASN 67 96 14 Y 1 A SER 208 ? A SER 68 97 14 Y 1 A GLY 209 ? A GLY 69 98 14 Y 1 A GLU 210 ? A GLU 70 99 15 Y 1 A ALA 141 ? A ALA 1 100 15 Y 1 A LYS 142 ? A LYS 2 101 15 Y 1 A GLY 143 ? A GLY 3 102 15 Y 1 A ASN 207 ? A ASN 67 103 15 Y 1 A SER 208 ? A SER 68 104 15 Y 1 A GLY 209 ? A GLY 69 105 15 Y 1 A GLU 210 ? A GLU 70 106 16 Y 1 A ALA 141 ? A ALA 1 107 16 Y 1 A LYS 142 ? A LYS 2 108 16 Y 1 A GLY 143 ? A GLY 3 109 16 Y 1 A ASN 207 ? A ASN 67 110 16 Y 1 A SER 208 ? A SER 68 111 16 Y 1 A GLY 209 ? A GLY 69 112 16 Y 1 A GLU 210 ? A GLU 70 113 17 Y 1 A ALA 141 ? A ALA 1 114 17 Y 1 A LYS 142 ? A LYS 2 115 17 Y 1 A GLY 143 ? A GLY 3 116 17 Y 1 A ASN 207 ? A ASN 67 117 17 Y 1 A SER 208 ? A SER 68 118 17 Y 1 A GLY 209 ? A GLY 69 119 17 Y 1 A GLU 210 ? A GLU 70 120 18 Y 1 A ALA 141 ? A ALA 1 121 18 Y 1 A LYS 142 ? A LYS 2 122 18 Y 1 A GLY 143 ? A GLY 3 123 18 Y 1 A ASN 207 ? A ASN 67 124 18 Y 1 A SER 208 ? A SER 68 125 18 Y 1 A GLY 209 ? A GLY 69 126 18 Y 1 A GLU 210 ? A GLU 70 127 19 Y 1 A ALA 141 ? A ALA 1 128 19 Y 1 A LYS 142 ? A LYS 2 129 19 Y 1 A GLY 143 ? A GLY 3 130 19 Y 1 A ASN 207 ? A ASN 67 131 19 Y 1 A SER 208 ? A SER 68 132 19 Y 1 A GLY 209 ? A GLY 69 133 19 Y 1 A GLU 210 ? A GLU 70 134 20 Y 1 A ALA 141 ? A ALA 1 135 20 Y 1 A LYS 142 ? A LYS 2 136 20 Y 1 A GLY 143 ? A GLY 3 137 20 Y 1 A ASN 207 ? A ASN 67 138 20 Y 1 A SER 208 ? A SER 68 139 20 Y 1 A GLY 209 ? A GLY 69 140 20 Y 1 A GLU 210 ? A GLU 70 141 21 Y 1 A ALA 141 ? A ALA 1 142 21 Y 1 A LYS 142 ? A LYS 2 143 21 Y 1 A GLY 143 ? A GLY 3 144 21 Y 1 A ASN 207 ? A ASN 67 145 21 Y 1 A SER 208 ? A SER 68 146 21 Y 1 A GLY 209 ? A GLY 69 147 21 Y 1 A GLU 210 ? A GLU 70 148 22 Y 1 A ALA 141 ? A ALA 1 149 22 Y 1 A LYS 142 ? A LYS 2 150 22 Y 1 A GLY 143 ? A GLY 3 151 22 Y 1 A ASN 207 ? A ASN 67 152 22 Y 1 A SER 208 ? A SER 68 153 22 Y 1 A GLY 209 ? A GLY 69 154 22 Y 1 A GLU 210 ? A GLU 70 155 23 Y 1 A ALA 141 ? A ALA 1 156 23 Y 1 A LYS 142 ? A LYS 2 157 23 Y 1 A GLY 143 ? A GLY 3 158 23 Y 1 A ASN 207 ? A ASN 67 159 23 Y 1 A SER 208 ? A SER 68 160 23 Y 1 A GLY 209 ? A GLY 69 161 23 Y 1 A GLU 210 ? A GLU 70 162 24 Y 1 A ALA 141 ? A ALA 1 163 24 Y 1 A LYS 142 ? A LYS 2 164 24 Y 1 A GLY 143 ? A GLY 3 165 24 Y 1 A ASN 207 ? A ASN 67 166 24 Y 1 A SER 208 ? A SER 68 167 24 Y 1 A GLY 209 ? A GLY 69 168 24 Y 1 A GLU 210 ? A GLU 70 169 25 Y 1 A ALA 141 ? A ALA 1 170 25 Y 1 A LYS 142 ? A LYS 2 171 25 Y 1 A GLY 143 ? A GLY 3 172 25 Y 1 A ASN 207 ? A ASN 67 173 25 Y 1 A SER 208 ? A SER 68 174 25 Y 1 A GLY 209 ? A GLY 69 175 25 Y 1 A GLU 210 ? A GLU 70 176 26 Y 1 A ALA 141 ? A ALA 1 177 26 Y 1 A LYS 142 ? A LYS 2 178 26 Y 1 A GLY 143 ? A GLY 3 179 26 Y 1 A ASN 207 ? A ASN 67 180 26 Y 1 A SER 208 ? A SER 68 181 26 Y 1 A GLY 209 ? A GLY 69 182 26 Y 1 A GLU 210 ? A GLU 70 183 27 Y 1 A ALA 141 ? A ALA 1 184 27 Y 1 A LYS 142 ? A LYS 2 185 27 Y 1 A GLY 143 ? A GLY 3 186 27 Y 1 A ASN 207 ? A ASN 67 187 27 Y 1 A SER 208 ? A SER 68 188 27 Y 1 A GLY 209 ? A GLY 69 189 27 Y 1 A GLU 210 ? A GLU 70 190 28 Y 1 A ALA 141 ? A ALA 1 191 28 Y 1 A LYS 142 ? A LYS 2 192 28 Y 1 A GLY 143 ? A GLY 3 193 28 Y 1 A ASN 207 ? A ASN 67 194 28 Y 1 A SER 208 ? A SER 68 195 28 Y 1 A GLY 209 ? A GLY 69 196 28 Y 1 A GLU 210 ? A GLU 70 197 29 Y 1 A ALA 141 ? A ALA 1 198 29 Y 1 A LYS 142 ? A LYS 2 199 29 Y 1 A GLY 143 ? A GLY 3 200 29 Y 1 A ASN 207 ? A ASN 67 201 29 Y 1 A SER 208 ? A SER 68 202 29 Y 1 A GLY 209 ? A GLY 69 203 29 Y 1 A GLU 210 ? A GLU 70 204 30 Y 1 A ALA 141 ? A ALA 1 205 30 Y 1 A LYS 142 ? A LYS 2 206 30 Y 1 A GLY 143 ? A GLY 3 207 30 Y 1 A ASN 207 ? A ASN 67 208 30 Y 1 A SER 208 ? A SER 68 209 30 Y 1 A GLY 209 ? A GLY 69 210 30 Y 1 A GLU 210 ? A GLU 70 211 31 Y 1 A ALA 141 ? A ALA 1 212 31 Y 1 A LYS 142 ? A LYS 2 213 31 Y 1 A GLY 143 ? A GLY 3 214 31 Y 1 A ASN 207 ? A ASN 67 215 31 Y 1 A SER 208 ? A SER 68 216 31 Y 1 A GLY 209 ? A GLY 69 217 31 Y 1 A GLU 210 ? A GLU 70 218 32 Y 1 A ALA 141 ? A ALA 1 219 32 Y 1 A LYS 142 ? A LYS 2 220 32 Y 1 A GLY 143 ? A GLY 3 221 32 Y 1 A ASN 207 ? A ASN 67 222 32 Y 1 A SER 208 ? A SER 68 223 32 Y 1 A GLY 209 ? A GLY 69 224 32 Y 1 A GLU 210 ? A GLU 70 225 33 Y 1 A ALA 141 ? A ALA 1 226 33 Y 1 A LYS 142 ? A LYS 2 227 33 Y 1 A GLY 143 ? A GLY 3 228 33 Y 1 A ASN 207 ? A ASN 67 229 33 Y 1 A SER 208 ? A SER 68 230 33 Y 1 A GLY 209 ? A GLY 69 231 33 Y 1 A GLU 210 ? A GLU 70 232 34 Y 1 A ALA 141 ? A ALA 1 233 34 Y 1 A LYS 142 ? A LYS 2 234 34 Y 1 A GLY 143 ? A GLY 3 235 34 Y 1 A ASN 207 ? A ASN 67 236 34 Y 1 A SER 208 ? A SER 68 237 34 Y 1 A GLY 209 ? A GLY 69 238 34 Y 1 A GLU 210 ? A GLU 70 239 35 Y 1 A ALA 141 ? A ALA 1 240 35 Y 1 A LYS 142 ? A LYS 2 241 35 Y 1 A GLY 143 ? A GLY 3 242 35 Y 1 A ASN 207 ? A ASN 67 243 35 Y 1 A SER 208 ? A SER 68 244 35 Y 1 A GLY 209 ? A GLY 69 245 35 Y 1 A GLU 210 ? A GLU 70 246 36 Y 1 A ALA 141 ? A ALA 1 247 36 Y 1 A LYS 142 ? A LYS 2 248 36 Y 1 A GLY 143 ? A GLY 3 249 36 Y 1 A ASN 207 ? A ASN 67 250 36 Y 1 A SER 208 ? A SER 68 251 36 Y 1 A GLY 209 ? A GLY 69 252 36 Y 1 A GLU 210 ? A GLU 70 253 37 Y 1 A ALA 141 ? A ALA 1 254 37 Y 1 A LYS 142 ? A LYS 2 255 37 Y 1 A GLY 143 ? A GLY 3 256 37 Y 1 A ASN 207 ? A ASN 67 257 37 Y 1 A SER 208 ? A SER 68 258 37 Y 1 A GLY 209 ? A GLY 69 259 37 Y 1 A GLU 210 ? A GLU 70 260 38 Y 1 A ALA 141 ? A ALA 1 261 38 Y 1 A LYS 142 ? A LYS 2 262 38 Y 1 A GLY 143 ? A GLY 3 263 38 Y 1 A ASN 207 ? A ASN 67 264 38 Y 1 A SER 208 ? A SER 68 265 38 Y 1 A GLY 209 ? A GLY 69 266 38 Y 1 A GLU 210 ? A GLU 70 267 39 Y 1 A ALA 141 ? A ALA 1 268 39 Y 1 A LYS 142 ? A LYS 2 269 39 Y 1 A GLY 143 ? A GLY 3 270 39 Y 1 A ASN 207 ? A ASN 67 271 39 Y 1 A SER 208 ? A SER 68 272 39 Y 1 A GLY 209 ? A GLY 69 273 39 Y 1 A GLU 210 ? A GLU 70 274 40 Y 1 A ALA 141 ? A ALA 1 275 40 Y 1 A LYS 142 ? A LYS 2 276 40 Y 1 A GLY 143 ? A GLY 3 277 40 Y 1 A ASN 207 ? A ASN 67 278 40 Y 1 A SER 208 ? A SER 68 279 40 Y 1 A GLY 209 ? A GLY 69 280 40 Y 1 A GLU 210 ? A GLU 70 281 41 Y 1 A ALA 141 ? A ALA 1 282 41 Y 1 A LYS 142 ? A LYS 2 283 41 Y 1 A GLY 143 ? A GLY 3 284 41 Y 1 A ASN 207 ? A ASN 67 285 41 Y 1 A SER 208 ? A SER 68 286 41 Y 1 A GLY 209 ? A GLY 69 287 41 Y 1 A GLU 210 ? A GLU 70 288 42 Y 1 A ALA 141 ? A ALA 1 289 42 Y 1 A LYS 142 ? A LYS 2 290 42 Y 1 A GLY 143 ? A GLY 3 291 42 Y 1 A ASN 207 ? A ASN 67 292 42 Y 1 A SER 208 ? A SER 68 293 42 Y 1 A GLY 209 ? A GLY 69 294 42 Y 1 A GLU 210 ? A GLU 70 295 43 Y 1 A ALA 141 ? A ALA 1 296 43 Y 1 A LYS 142 ? A LYS 2 297 43 Y 1 A GLY 143 ? A GLY 3 298 43 Y 1 A ASN 207 ? A ASN 67 299 43 Y 1 A SER 208 ? A SER 68 300 43 Y 1 A GLY 209 ? A GLY 69 301 43 Y 1 A GLU 210 ? A GLU 70 302 44 Y 1 A ALA 141 ? A ALA 1 303 44 Y 1 A LYS 142 ? A LYS 2 304 44 Y 1 A GLY 143 ? A GLY 3 305 44 Y 1 A ASN 207 ? A ASN 67 306 44 Y 1 A SER 208 ? A SER 68 307 44 Y 1 A GLY 209 ? A GLY 69 308 44 Y 1 A GLU 210 ? A GLU 70 309 45 Y 1 A ALA 141 ? A ALA 1 310 45 Y 1 A LYS 142 ? A LYS 2 311 45 Y 1 A GLY 143 ? A GLY 3 312 45 Y 1 A ASN 207 ? A ASN 67 313 45 Y 1 A SER 208 ? A SER 68 314 45 Y 1 A GLY 209 ? A GLY 69 315 45 Y 1 A GLU 210 ? A GLU 70 316 46 Y 1 A ALA 141 ? A ALA 1 317 46 Y 1 A LYS 142 ? A LYS 2 318 46 Y 1 A GLY 143 ? A GLY 3 319 46 Y 1 A ASN 207 ? A ASN 67 320 46 Y 1 A SER 208 ? A SER 68 321 46 Y 1 A GLY 209 ? A GLY 69 322 46 Y 1 A GLU 210 ? A GLU 70 #