data_3I18 # _entry.id 3I18 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3I18 RCSB RCSB053836 WWPDB D_1000053836 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id LmR166B _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 3I18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-06-25 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Lew, S.' 2 'Seetharaman, J.' 3 'Janjua, J.' 4 'Xiao, R.' 5 'Ciccosanti, C.' 6 'Zhao, L.' 7 'Everett, J.K.' 8 'Nair, R.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Tong, L.' 13 'Hunt, J.F.' 14 'Northeast Structural Genomics Consortium (NESG)' 15 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target LmR166B' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Forouhar, F.' 1 ? primary 'Lew, S.' 2 ? primary 'Seetharaman, J.' 3 ? primary 'Janjua, J.' 4 ? primary 'Xiao, R.' 5 ? primary 'Ciccosanti, C.' 6 ? primary 'Zhao, L.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Nair, R.' 9 ? primary 'Acton, T.B.' 10 ? primary 'Rost, B.' 11 ? primary 'Montelione, G.T.' 12 ? primary 'Tong, L.' 13 ? primary 'Hunt, J.F.' 14 ? # _cell.entry_id 3I18 _cell.length_a 35.705 _cell.length_b 90.475 _cell.length_c 51.811 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3I18 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Lmo2051 protein' 11204.261 1 ? ? 'PDZ domain' ? 2 non-polymer syn 'BROMIDE ION' 79.904 1 ? ? ? ? 3 water nat water 18.015 122 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)VKVTYDGVYV(MSE)SVKDDVPAADVLHAGDLITEIDGNAFKSSQEFIDYIHSKKVGDTVKINYKHGDKNEQADI KLTAIDKKGTPGIGITLVDDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MVKVTYDGVYVMSVKDDVPAADVLHAGDLITEIDGNAFKSSQEFIDYIHSKKVGDTVKINYKHGDKNEQADIKLTAIDKK GTPGIGITLVDDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier LmR166B # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 VAL n 1 3 LYS n 1 4 VAL n 1 5 THR n 1 6 TYR n 1 7 ASP n 1 8 GLY n 1 9 VAL n 1 10 TYR n 1 11 VAL n 1 12 MSE n 1 13 SER n 1 14 VAL n 1 15 LYS n 1 16 ASP n 1 17 ASP n 1 18 VAL n 1 19 PRO n 1 20 ALA n 1 21 ALA n 1 22 ASP n 1 23 VAL n 1 24 LEU n 1 25 HIS n 1 26 ALA n 1 27 GLY n 1 28 ASP n 1 29 LEU n 1 30 ILE n 1 31 THR n 1 32 GLU n 1 33 ILE n 1 34 ASP n 1 35 GLY n 1 36 ASN n 1 37 ALA n 1 38 PHE n 1 39 LYS n 1 40 SER n 1 41 SER n 1 42 GLN n 1 43 GLU n 1 44 PHE n 1 45 ILE n 1 46 ASP n 1 47 TYR n 1 48 ILE n 1 49 HIS n 1 50 SER n 1 51 LYS n 1 52 LYS n 1 53 VAL n 1 54 GLY n 1 55 ASP n 1 56 THR n 1 57 VAL n 1 58 LYS n 1 59 ILE n 1 60 ASN n 1 61 TYR n 1 62 LYS n 1 63 HIS n 1 64 GLY n 1 65 ASP n 1 66 LYS n 1 67 ASN n 1 68 GLU n 1 69 GLN n 1 70 ALA n 1 71 ASP n 1 72 ILE n 1 73 LYS n 1 74 LEU n 1 75 THR n 1 76 ALA n 1 77 ILE n 1 78 ASP n 1 79 LYS n 1 80 LYS n 1 81 GLY n 1 82 THR n 1 83 PRO n 1 84 GLY n 1 85 ILE n 1 86 GLY n 1 87 ILE n 1 88 THR n 1 89 LEU n 1 90 VAL n 1 91 ASP n 1 92 ASP n 1 93 LEU n 1 94 GLU n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n 1 100 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene lmo2051 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain EGD-e _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria monocytogenes' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1639 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET21 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BL21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8Y5K8_LISMO _struct_ref.pdbx_db_accession Q8Y5K8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VKVTYDGVYVLSVKDDVPAADVLHAGDLITEIDGNAFKSSQEFIDYIHSKKVGDTVKINYKHGDKNEQADIKLTAIDKKG TPGIGITLVDD ; _struct_ref.pdbx_align_begin 124 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3I18 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8Y5K8 _struct_ref_seq.db_align_beg 124 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 214 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3I18 MSE A 1 ? UNP Q8Y5K8 ? ? 'INITIATING METHIONINE' 1 1 1 3I18 MSE A 12 ? UNP Q8Y5K8 LEU 134 'SEE REMARK 999' 12 2 1 3I18 LEU A 93 ? UNP Q8Y5K8 ? ? 'EXPRESSION TAG' 93 3 1 3I18 GLU A 94 ? UNP Q8Y5K8 ? ? 'EXPRESSION TAG' 94 4 1 3I18 HIS A 95 ? UNP Q8Y5K8 ? ? 'EXPRESSION TAG' 95 5 1 3I18 HIS A 96 ? UNP Q8Y5K8 ? ? 'EXPRESSION TAG' 96 6 1 3I18 HIS A 97 ? UNP Q8Y5K8 ? ? 'EXPRESSION TAG' 97 7 1 3I18 HIS A 98 ? UNP Q8Y5K8 ? ? 'EXPRESSION TAG' 98 8 1 3I18 HIS A 99 ? UNP Q8Y5K8 ? ? 'EXPRESSION TAG' 99 9 1 3I18 HIS A 97 ? UNP Q8Y5K8 ? ? 'EXPRESSION TAG' 97 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BR non-polymer . 'BROMIDE ION' ? 'Br -1' 79.904 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 3I18 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 1.87 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 34.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'microbatch, under oil' _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.pdbx_details ;Protein solution: 100mM NaCl, 5mM DTT, 0.02% NaN3, 10mM Tris-HCl (pH 7.5), Reservoir solution: 30% w/v Polyethylene glycol monomethyl ether 2k and 150mM Potassium Bromide, microbatch, under oil, temperature 291K ; _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2009-06-23 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97947 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_wavelength_list 0.97947 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A # _reflns.entry_id 3I18 _reflns.B_iso_Wilson_estimate 10.700 _reflns.observed_criterion_sigma_F 2.0 _reflns.observed_criterion_sigma_I 2.0 _reflns.d_resolution_high 1.7 _reflns.d_resolution_low 30 _reflns.number_all 17896 _reflns.number_obs 14872 _reflns.percent_possible_obs 83.1 _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rsym_value 0.054 _reflns.pdbx_netI_over_sigmaI 32.6 _reflns.pdbx_redundancy 4.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.7 _reflns_shell.d_res_low 2.0 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 61.2 _reflns_shell.Rmerge_I_obs 0.083 _reflns_shell.meanI_over_sigI_obs 9.4 _reflns_shell.pdbx_Rsym_value 0.106 _reflns_shell.pdbx_redundancy 2.5 _reflns_shell.number_unique_all 1784 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3I18 _refine.ls_d_res_high 1.700 _refine.ls_d_res_low 17.850 _refine.pdbx_ls_sigma_F 2.00 _refine.pdbx_data_cutoff_high_absF 586592.500 _refine.pdbx_data_cutoff_low_absF 0.000 _refine.ls_percent_reflns_obs 83.100 _refine.ls_number_reflns_obs 14838 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.ls_R_factor_R_work 0.193 _refine.ls_R_factor_R_free 0.226 _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 735 _refine.ls_R_factor_R_free_error 0.008 _refine.B_iso_mean 18.600 _refine.solvent_model_param_bsol 33.418 _refine.solvent_model_param_ksol 0.350 _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.aniso_B[1][1] -0.480 _refine.aniso_B[2][2] -1.650 _refine.aniso_B[3][3] 2.130 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'FLAT MODEL' _refine.pdbx_ls_sigma_I 2.00 _refine.ls_number_reflns_all 17855 _refine.ls_R_factor_all 0.195 _refine.ls_R_factor_obs 0.194 _refine.ls_redundancy_reflns_obs ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.occupancy_max ? _refine.occupancy_min ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3I18 _refine_analyze.Luzzati_coordinate_error_obs 0.180 _refine_analyze.Luzzati_sigma_a_obs 0.050 _refine_analyze.Luzzati_d_res_low_obs 5.000 _refine_analyze.Luzzati_coordinate_error_free 0.230 _refine_analyze.Luzzati_sigma_a_free 0.110 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 735 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 122 _refine_hist.number_atoms_total 858 _refine_hist.d_res_high 1.700 _refine_hist.d_res_low 17.850 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.005 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 1.100 ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? 24.900 ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? 0.700 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.700 _refine_ls_shell.d_res_low 1.760 _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.percent_reflns_obs 61.500 _refine_ls_shell.number_reflns_R_work 1022 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.171 _refine_ls_shell.R_factor_R_free 0.243 _refine_ls_shell.percent_reflns_R_free 6.500 _refine_ls_shell.number_reflns_R_free 71 _refine_ls_shell.R_factor_R_free_error 0.029 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 1093 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3I18 _struct.title ;Crystal Structure of the PDZ domain of the SdrC-like protein (Lmo2051) from Listeria monocytogenes, Northeast Structural Genomics Consortium Target LmR166B ; _struct.pdbx_descriptor 'Lmo2051 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3I18 _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 18 ? VAL A 23 ? VAL A 18 VAL A 23 5 ? 6 HELX_P HELX_P2 2 SER A 40 ? SER A 50 ? SER A 40 SER A 50 1 ? 11 HELX_P HELX_P3 3 ASP A 91 ? LEU A 93 ? ASP A 91 LEU A 93 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A VAL 11 C ? ? ? 1_555 A MSE 12 N ? ? A VAL 11 A MSE 12 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale both ? A MSE 12 C ? ? ? 1_555 A SER 13 N ? ? A MSE 12 A SER 13 1_555 ? ? ? ? ? ? ? 1.326 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 66 ? LYS A 73 ? LYS A 66 LYS A 73 A 2 THR A 56 ? HIS A 63 ? THR A 56 HIS A 63 A 3 LEU A 29 ? ILE A 33 ? LEU A 29 ILE A 33 A 4 VAL A 9 ? VAL A 14 ? VAL A 9 VAL A 14 A 5 ILE A 87 ? LEU A 89 ? ILE A 87 LEU A 89 B 1 THR A 75 ? ALA A 76 ? THR A 75 ALA A 76 B 2 PRO A 83 ? GLY A 84 ? PRO A 83 GLY A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 68 ? O GLU A 68 N TYR A 61 ? N TYR A 61 A 2 3 O ASN A 60 ? O ASN A 60 N THR A 31 ? N THR A 31 A 3 4 O ILE A 30 ? O ILE A 30 N VAL A 9 ? N VAL A 9 A 4 5 N MSE A 12 ? N MSE A 12 O THR A 88 ? O THR A 88 B 1 2 N THR A 75 ? N THR A 75 O GLY A 84 ? O GLY A 84 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE BR A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 VAL A 9 ? VAL A 9 . ? 1_555 ? 2 AC1 3 TYR A 10 ? TYR A 10 . ? 1_555 ? 3 AC1 3 ASP A 91 ? ASP A 91 . ? 1_555 ? # _database_PDB_matrix.entry_id 3I18 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 3I18 _atom_sites.fract_transf_matrix[1][1] 0.028007 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011053 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019301 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BR C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 MSE 12 12 12 MSE MSE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 HIS 100 100 100 HIS HIS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BR 1 101 101 BR BR A . C 3 HOH 1 102 102 HOH HOH A . C 3 HOH 2 103 103 HOH HOH A . C 3 HOH 3 104 104 HOH HOH A . C 3 HOH 4 105 105 HOH HOH A . C 3 HOH 5 106 106 HOH HOH A . C 3 HOH 6 107 107 HOH HOH A . C 3 HOH 7 108 108 HOH HOH A . C 3 HOH 8 109 109 HOH HOH A . C 3 HOH 9 110 110 HOH HOH A . C 3 HOH 10 111 111 HOH HOH A . C 3 HOH 11 112 112 HOH HOH A . C 3 HOH 12 113 113 HOH HOH A . C 3 HOH 13 114 114 HOH HOH A . C 3 HOH 14 115 115 HOH HOH A . C 3 HOH 15 116 116 HOH HOH A . C 3 HOH 16 117 117 HOH HOH A . C 3 HOH 17 118 118 HOH HOH A . C 3 HOH 18 119 119 HOH HOH A . C 3 HOH 19 120 120 HOH HOH A . C 3 HOH 20 121 121 HOH HOH A . C 3 HOH 21 122 122 HOH HOH A . C 3 HOH 22 123 123 HOH HOH A . C 3 HOH 23 124 124 HOH HOH A . C 3 HOH 24 125 125 HOH HOH A . C 3 HOH 25 126 126 HOH HOH A . C 3 HOH 26 127 127 HOH HOH A . C 3 HOH 27 128 128 HOH HOH A . C 3 HOH 28 129 129 HOH HOH A . C 3 HOH 29 130 130 HOH HOH A . C 3 HOH 30 131 131 HOH HOH A . C 3 HOH 31 132 132 HOH HOH A . C 3 HOH 32 133 133 HOH HOH A . C 3 HOH 33 134 134 HOH HOH A . C 3 HOH 34 135 135 HOH HOH A . C 3 HOH 35 136 136 HOH HOH A . C 3 HOH 36 137 137 HOH HOH A . C 3 HOH 37 138 138 HOH HOH A . C 3 HOH 38 139 139 HOH HOH A . C 3 HOH 39 140 140 HOH HOH A . C 3 HOH 40 141 141 HOH HOH A . C 3 HOH 41 142 142 HOH HOH A . C 3 HOH 42 143 143 HOH HOH A . C 3 HOH 43 144 144 HOH HOH A . C 3 HOH 44 145 145 HOH HOH A . C 3 HOH 45 146 146 HOH HOH A . C 3 HOH 46 147 147 HOH HOH A . C 3 HOH 47 148 148 HOH HOH A . C 3 HOH 48 149 149 HOH HOH A . C 3 HOH 49 150 150 HOH HOH A . C 3 HOH 50 151 151 HOH HOH A . C 3 HOH 51 152 152 HOH HOH A . C 3 HOH 52 153 153 HOH HOH A . C 3 HOH 53 154 154 HOH HOH A . C 3 HOH 54 155 155 HOH HOH A . C 3 HOH 55 156 156 HOH HOH A . C 3 HOH 56 157 157 HOH HOH A . C 3 HOH 57 158 158 HOH HOH A . C 3 HOH 58 159 159 HOH HOH A . C 3 HOH 59 160 160 HOH HOH A . C 3 HOH 60 161 161 HOH HOH A . C 3 HOH 61 162 162 HOH HOH A . C 3 HOH 62 163 163 HOH HOH A . C 3 HOH 63 164 164 HOH HOH A . C 3 HOH 64 165 165 HOH HOH A . C 3 HOH 65 166 166 HOH HOH A . C 3 HOH 66 167 167 HOH HOH A . C 3 HOH 67 168 168 HOH HOH A . C 3 HOH 68 169 169 HOH HOH A . C 3 HOH 69 170 170 HOH HOH A . C 3 HOH 70 171 171 HOH HOH A . C 3 HOH 71 172 172 HOH HOH A . C 3 HOH 72 173 173 HOH HOH A . C 3 HOH 73 174 174 HOH HOH A . C 3 HOH 74 175 175 HOH HOH A . C 3 HOH 75 176 176 HOH HOH A . C 3 HOH 76 177 177 HOH HOH A . C 3 HOH 77 178 178 HOH HOH A . C 3 HOH 78 179 179 HOH HOH A . C 3 HOH 79 180 180 HOH HOH A . C 3 HOH 80 181 181 HOH HOH A . C 3 HOH 81 182 182 HOH HOH A . C 3 HOH 82 183 183 HOH HOH A . C 3 HOH 83 184 184 HOH HOH A . C 3 HOH 84 185 185 HOH HOH A . C 3 HOH 85 186 186 HOH HOH A . C 3 HOH 86 187 187 HOH HOH A . C 3 HOH 87 188 188 HOH HOH A . C 3 HOH 88 189 189 HOH HOH A . C 3 HOH 89 190 190 HOH HOH A . C 3 HOH 90 191 191 HOH HOH A . C 3 HOH 91 192 192 HOH HOH A . C 3 HOH 92 193 193 HOH HOH A . C 3 HOH 93 194 194 HOH HOH A . C 3 HOH 94 195 195 HOH HOH A . C 3 HOH 95 196 196 HOH HOH A . C 3 HOH 96 197 197 HOH HOH A . C 3 HOH 97 198 198 HOH HOH A . C 3 HOH 98 199 199 HOH HOH A . C 3 HOH 99 200 200 HOH HOH A . C 3 HOH 100 201 201 HOH HOH A . C 3 HOH 101 202 202 HOH HOH A . C 3 HOH 102 203 203 HOH HOH A . C 3 HOH 103 204 204 HOH HOH A . C 3 HOH 104 205 205 HOH HOH A . C 3 HOH 105 206 206 HOH HOH A . C 3 HOH 106 207 207 HOH HOH A . C 3 HOH 107 208 208 HOH HOH A . C 3 HOH 108 209 209 HOH HOH A . C 3 HOH 109 210 210 HOH HOH A . C 3 HOH 110 211 211 HOH HOH A . C 3 HOH 111 212 212 HOH HOH A . C 3 HOH 112 213 213 HOH HOH A . C 3 HOH 113 214 214 HOH HOH A . C 3 HOH 114 215 215 HOH HOH A . C 3 HOH 115 216 216 HOH HOH A . C 3 HOH 116 217 217 HOH HOH A . C 3 HOH 117 218 218 HOH HOH A . C 3 HOH 118 219 219 HOH HOH A . C 3 HOH 119 220 220 HOH HOH A . C 3 HOH 120 221 221 HOH HOH A . C 3 HOH 121 222 222 HOH HOH A . C 3 HOH 122 223 223 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 12 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 12 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-07-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2019-07-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.contact_author' 2 3 'Structure model' '_software.contact_author_email' 3 3 'Structure model' '_software.language' 4 3 'Structure model' '_software.location' 5 3 'Structure model' '_software.name' 6 3 'Structure model' '_software.type' 7 3 'Structure model' '_software.version' 8 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal CNS '1.2 & XtalView' ? ? ? ? refinement ? ? ? 1 PDB_EXTRACT 3.00 'March. 27, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 3 DENZO . ? ? ? ? 'data reduction' ? ? ? 4 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 5 SOLVE . ? ? ? ? phasing ? ? ? 6 RESOLVE . ? ? ? ? phasing ? ? ? 7 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 8 # _pdbx_entry_details.entry_id 3I18 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'LEU134 WAS MUTATED TO MET SO THAT THE STRUCTURE COULD BE DETERMINED USING SE ANOMALOUS SIGNAL.' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 23 ? ? -132.13 -58.16 2 1 ASP A 65 ? ? -140.79 37.08 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLU 94 ? A GLU 94 3 1 Y 1 A HIS 95 ? A HIS 95 4 1 Y 1 A HIS 96 ? A HIS 96 5 1 Y 1 A HIS 97 ? A HIS 97 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'BROMIDE ION' BR 3 water HOH #