data_3KLU # _entry.id 3KLU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3KLU RCSB RCSB056153 WWPDB D_1000056153 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2009-12-08 _pdbx_database_PDB_obs_spr.pdb_id 3KLU _pdbx_database_PDB_obs_spr.replace_pdb_id 3DFD _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id SR445 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3KLU _pdbx_database_status.recvd_initial_deposition_date 2009-11-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kuzin, A.P.' 1 'Su, M.' 2 'Seetharaman, J.' 3 'Wang, D.' 4 'Fang, Y.' 5 'Cunningham, K.' 6 'Ma, L.-C.' 7 'Xiao, R.' 8 'Liu, M.' 9 'Baran, M.C.' 10 'Acton, T.B.' 11 'Rost, B.' 12 'Montelione, G.T.' 13 'Hunt, J.F.' 14 'Tong, L.' 15 'Northeast Structural Genomics Consortium (NESG)' 16 # _citation.id primary _citation.title 'Crystal structure of the protein yqbn. northeast structural genomics consortium target sr445.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kuzin, A.P.' 1 primary 'Su, M.' 2 primary 'Seetharaman, J.' 3 primary 'Wang, D.' 4 primary 'Fang, Y.' 5 primary 'Cunningham, K.' 6 primary 'Ma, L.-C.' 7 primary 'Xiao, R.' 8 primary 'Liu, M.' 9 primary 'Baran, M.C.' 10 primary 'Acton, T.B.' 11 primary 'Rost, B.' 12 primary 'Montelione, G.T.' 13 primary 'Hunt, J.F.' 14 primary 'Tong, L.' 15 # _cell.entry_id 3KLU _cell.length_a 70.101 _cell.length_b 70.101 _cell.length_c 59.161 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3KLU _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein yqbN' 18324.096 1 ? ? ? ? 2 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 3 water nat water 18.015 26 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SENQNEKVYDLSFF(MSE)PGQTIDAEEVEVPISKRFVDKEGNVVPFIFKAITTDRIDELEKENTTYKNVKGRGR VKELDSQRFYARIAVETTVYPTFKAKELREAYKTEDPVEVAKRVLSVGGEYANWLNKAIEINGFDDDLEDLEEAAKNLEH HHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSENQNEKVYDLSFFMPGQTIDAEEVEVPISKRFVDKEGNVVPFIFKAITTDRIDELEKENTTYKNVKGRGRVKELDSQR FYARIAVETTVYPTFKAKELREAYKTEDPVEVAKRVLSVGGEYANWLNKAIEINGFDDDLEDLEEAAKNLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SR445 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 GLU n 1 4 ASN n 1 5 GLN n 1 6 ASN n 1 7 GLU n 1 8 LYS n 1 9 VAL n 1 10 TYR n 1 11 ASP n 1 12 LEU n 1 13 SER n 1 14 PHE n 1 15 PHE n 1 16 MSE n 1 17 PRO n 1 18 GLY n 1 19 GLN n 1 20 THR n 1 21 ILE n 1 22 ASP n 1 23 ALA n 1 24 GLU n 1 25 GLU n 1 26 VAL n 1 27 GLU n 1 28 VAL n 1 29 PRO n 1 30 ILE n 1 31 SER n 1 32 LYS n 1 33 ARG n 1 34 PHE n 1 35 VAL n 1 36 ASP n 1 37 LYS n 1 38 GLU n 1 39 GLY n 1 40 ASN n 1 41 VAL n 1 42 VAL n 1 43 PRO n 1 44 PHE n 1 45 ILE n 1 46 PHE n 1 47 LYS n 1 48 ALA n 1 49 ILE n 1 50 THR n 1 51 THR n 1 52 ASP n 1 53 ARG n 1 54 ILE n 1 55 ASP n 1 56 GLU n 1 57 LEU n 1 58 GLU n 1 59 LYS n 1 60 GLU n 1 61 ASN n 1 62 THR n 1 63 THR n 1 64 TYR n 1 65 LYS n 1 66 ASN n 1 67 VAL n 1 68 LYS n 1 69 GLY n 1 70 ARG n 1 71 GLY n 1 72 ARG n 1 73 VAL n 1 74 LYS n 1 75 GLU n 1 76 LEU n 1 77 ASP n 1 78 SER n 1 79 GLN n 1 80 ARG n 1 81 PHE n 1 82 TYR n 1 83 ALA n 1 84 ARG n 1 85 ILE n 1 86 ALA n 1 87 VAL n 1 88 GLU n 1 89 THR n 1 90 THR n 1 91 VAL n 1 92 TYR n 1 93 PRO n 1 94 THR n 1 95 PHE n 1 96 LYS n 1 97 ALA n 1 98 LYS n 1 99 GLU n 1 100 LEU n 1 101 ARG n 1 102 GLU n 1 103 ALA n 1 104 TYR n 1 105 LYS n 1 106 THR n 1 107 GLU n 1 108 ASP n 1 109 PRO n 1 110 VAL n 1 111 GLU n 1 112 VAL n 1 113 ALA n 1 114 LYS n 1 115 ARG n 1 116 VAL n 1 117 LEU n 1 118 SER n 1 119 VAL n 1 120 GLY n 1 121 GLY n 1 122 GLU n 1 123 TYR n 1 124 ALA n 1 125 ASN n 1 126 TRP n 1 127 LEU n 1 128 ASN n 1 129 LYS n 1 130 ALA n 1 131 ILE n 1 132 GLU n 1 133 ILE n 1 134 ASN n 1 135 GLY n 1 136 PHE n 1 137 ASP n 1 138 ASP n 1 139 ASP n 1 140 LEU n 1 141 GLU n 1 142 ASP n 1 143 LEU n 1 144 GLU n 1 145 GLU n 1 146 ALA n 1 147 ALA n 1 148 LYS n 1 149 ASN n 1 150 LEU n 1 151 GLU n 1 152 HIS n 1 153 HIS n 1 154 HIS n 1 155 HIS n 1 156 HIS n 1 157 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'yqbN, BSU26040' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1423 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YQBN_BACSU _struct_ref.pdbx_db_accession P45930 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSENQNEKVYDLSFFMPGQTIDAEEVEVPISKRFVDKEGNVVPFIFKAITTDRIDELEKENTTYKNVKGRGRVKELDSQR FYARIAVETTVYPTFKAKELREAYKTEDPVEVAKRVLSVGGEYANWLNKAIEINGFDDDLEDLEEAAKN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3KLU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45930 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 149 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3KLU LEU A 150 ? UNP P45930 ? ? 'expression tag' 150 1 1 3KLU GLU A 151 ? UNP P45930 ? ? 'expression tag' 151 2 1 3KLU HIS A 152 ? UNP P45930 ? ? 'expression tag' 152 3 1 3KLU HIS A 153 ? UNP P45930 ? ? 'expression tag' 153 4 1 3KLU HIS A 154 ? UNP P45930 ? ? 'expression tag' 154 5 1 3KLU HIS A 155 ? UNP P45930 ? ? 'expression tag' 155 6 1 3KLU HIS A 156 ? UNP P45930 ? ? 'expression tag' 156 7 1 3KLU HIS A 157 ? UNP P45930 ? ? 'expression tag' 157 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3KLU _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_percent_sol 46.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pdbx_details ;PEG1000 20%, 0.1M MNCL2, 0.1M NAACETATE, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details mirror # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(222)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9791 1.0 2 0.9679 1.0 3 0.9794 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.9791, 0.9679, 0.9794' # _reflns.entry_id 3KLU _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.2 _reflns.number_obs 16390 _reflns.number_all ? _reflns.percent_possible_obs 99.1 _reflns.pdbx_Rmerge_I_obs 0.117 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.5 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.28 _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs 0.447 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.7 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3KLU _refine.ls_number_reflns_obs 16390 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.20 _refine.ls_percent_reflns_obs 86.0 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.225 _refine.ls_R_factor_R_free 0.246 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 966 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 993 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 20.0 # _struct.entry_id 3KLU _struct.title 'Crystal structure of the protein yqbn. northeast structural genomics consortium target sr445.' _struct.pdbx_descriptor 'Uncharacterized protein yqbN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3KLU _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text 'NESG, STRUCTURAL GENOMICS, PSI-2, PROTEIN STRUCTURE INITIATIVE, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? MSE A 16 ? ASP A 11 MSE A 16 5 ? 6 HELX_P HELX_P2 2 THR A 50 ? ASN A 61 ? THR A 50 ASN A 61 1 ? 12 HELX_P HELX_P3 3 ASP A 77 ? THR A 89 ? ASP A 77 THR A 89 1 ? 13 HELX_P HELX_P4 4 ALA A 97 ? TYR A 104 ? ALA A 97 TYR A 104 1 ? 8 HELX_P HELX_P5 5 ASP A 108 ? LEU A 117 ? ASP A 108 LEU A 117 1 ? 10 HELX_P HELX_P6 6 VAL A 119 ? ASN A 134 ? VAL A 119 ASN A 134 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id MSE _struct_conn.ptnr1_label_seq_id 16 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id PRO _struct_conn.ptnr2_label_seq_id 17 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id MSE _struct_conn.ptnr1_auth_seq_id 16 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PRO _struct_conn.ptnr2_auth_seq_id 17 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.341 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 92 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 92 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 93 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 93 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.50 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 26 ? VAL A 28 ? VAL A 26 VAL A 28 A 2 PHE A 44 ? PHE A 46 ? PHE A 44 PHE A 46 A 3 THR A 90 ? TYR A 92 ? THR A 90 TYR A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 28 ? N VAL A 28 O PHE A 44 ? O PHE A 44 A 2 3 N ILE A 45 ? N ILE A 45 O TYR A 92 ? O TYR A 92 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE MN A 158' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 38 ? GLU A 38 . ? 1_555 ? 2 AC1 4 ASP A 52 ? ASP A 52 . ? 3_664 ? 3 AC1 4 GLU A 111 ? GLU A 111 . ? 4_664 ? 4 AC1 4 ARG A 115 ? ARG A 115 . ? 4_664 ? # _database_PDB_matrix.entry_id 3KLU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3KLU _atom_sites.fract_transf_matrix[1][1] 0.014265 _atom_sites.fract_transf_matrix[1][2] 0.008236 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016472 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016903 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MN N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLU 3 3 ? ? ? A . n A 1 4 ASN 4 4 ? ? ? A . n A 1 5 GLN 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 MSE 16 16 16 MSE MSE A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 TYR 64 64 ? ? ? A . n A 1 65 LYS 65 65 ? ? ? A . n A 1 66 ASN 66 66 ? ? ? A . n A 1 67 VAL 67 67 ? ? ? A . n A 1 68 LYS 68 68 ? ? ? A . n A 1 69 GLY 69 69 ? ? ? A . n A 1 70 ARG 70 70 ? ? ? A . n A 1 71 GLY 71 71 ? ? ? A . n A 1 72 ARG 72 72 ? ? ? A . n A 1 73 VAL 73 73 ? ? ? A . n A 1 74 LYS 74 74 ? ? ? A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 ASP 138 138 ? ? ? A . n A 1 139 ASP 139 139 ? ? ? A . n A 1 140 LEU 140 140 ? ? ? A . n A 1 141 GLU 141 141 ? ? ? A . n A 1 142 ASP 142 142 ? ? ? A . n A 1 143 LEU 143 143 ? ? ? A . n A 1 144 GLU 144 144 ? ? ? A . n A 1 145 GLU 145 145 ? ? ? A . n A 1 146 ALA 146 146 ? ? ? A . n A 1 147 ALA 147 147 ? ? ? A . n A 1 148 LYS 148 148 ? ? ? A . n A 1 149 ASN 149 149 ? ? ? A . n A 1 150 LEU 150 150 ? ? ? A . n A 1 151 GLU 151 151 ? ? ? A . n A 1 152 HIS 152 152 ? ? ? A . n A 1 153 HIS 153 153 ? ? ? A . n A 1 154 HIS 154 154 ? ? ? A . n A 1 155 HIS 155 155 ? ? ? A . n A 1 156 HIS 156 156 ? ? ? A . n A 1 157 HIS 157 157 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 16 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 16 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-11-24 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 SOLVE phasing . ? 2 CNS refinement 1.2 ? 3 HKL-2000 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 25 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 25 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 25 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 94.21 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -16.79 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 9 ? ? 20.74 101.18 2 1 GLN A 19 ? ? 172.14 -79.06 3 1 THR A 20 ? ? -32.71 112.62 4 1 GLU A 24 ? ? -27.93 -127.26 5 1 GLU A 25 ? ? 137.08 84.28 6 1 LYS A 47 ? ? -163.30 113.05 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLU 3 ? A GLU 3 4 1 Y 1 A ASN 4 ? A ASN 4 5 1 Y 1 A GLN 5 ? A GLN 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A TYR 64 ? A TYR 64 9 1 Y 1 A LYS 65 ? A LYS 65 10 1 Y 1 A ASN 66 ? A ASN 66 11 1 Y 1 A VAL 67 ? A VAL 67 12 1 Y 1 A LYS 68 ? A LYS 68 13 1 Y 1 A GLY 69 ? A GLY 69 14 1 Y 1 A ARG 70 ? A ARG 70 15 1 Y 1 A GLY 71 ? A GLY 71 16 1 Y 1 A ARG 72 ? A ARG 72 17 1 Y 1 A VAL 73 ? A VAL 73 18 1 Y 1 A LYS 74 ? A LYS 74 19 1 Y 1 A ASP 138 ? A ASP 138 20 1 Y 1 A ASP 139 ? A ASP 139 21 1 Y 1 A LEU 140 ? A LEU 140 22 1 Y 1 A GLU 141 ? A GLU 141 23 1 Y 1 A ASP 142 ? A ASP 142 24 1 Y 1 A LEU 143 ? A LEU 143 25 1 Y 1 A GLU 144 ? A GLU 144 26 1 Y 1 A GLU 145 ? A GLU 145 27 1 Y 1 A ALA 146 ? A ALA 146 28 1 Y 1 A ALA 147 ? A ALA 147 29 1 Y 1 A LYS 148 ? A LYS 148 30 1 Y 1 A ASN 149 ? A ASN 149 31 1 Y 1 A LEU 150 ? A LEU 150 32 1 Y 1 A GLU 151 ? A GLU 151 33 1 Y 1 A HIS 152 ? A HIS 152 34 1 Y 1 A HIS 153 ? A HIS 153 35 1 Y 1 A HIS 154 ? A HIS 154 36 1 Y 1 A HIS 155 ? A HIS 155 37 1 Y 1 A HIS 156 ? A HIS 156 38 1 Y 1 A HIS 157 ? A HIS 157 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MANGANESE (II) ION' MN 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MN 1 158 158 MN MN A . C 3 HOH 1 159 159 HOH HOH A . C 3 HOH 2 160 160 HOH HOH A . C 3 HOH 3 161 161 HOH HOH A . C 3 HOH 4 162 162 HOH HOH A . C 3 HOH 5 163 163 HOH HOH A . C 3 HOH 6 164 164 HOH HOH A . C 3 HOH 7 165 165 HOH HOH A . C 3 HOH 8 166 166 HOH HOH A . C 3 HOH 9 167 167 HOH HOH A . C 3 HOH 10 168 168 HOH HOH A . C 3 HOH 11 169 169 HOH HOH A . C 3 HOH 12 170 170 HOH HOH A . C 3 HOH 13 171 171 HOH HOH A . C 3 HOH 14 172 172 HOH HOH A . C 3 HOH 15 173 173 HOH HOH A . C 3 HOH 16 174 174 HOH HOH A . C 3 HOH 17 176 176 HOH HOH A . C 3 HOH 18 177 177 HOH HOH A . C 3 HOH 19 178 178 HOH HOH A . C 3 HOH 20 179 179 HOH HOH A . C 3 HOH 21 181 181 HOH HOH A . C 3 HOH 22 182 182 HOH HOH A . C 3 HOH 23 183 183 HOH HOH A . C 3 HOH 24 184 184 HOH HOH A . C 3 HOH 25 185 185 HOH HOH A . C 3 HOH 26 186 186 HOH HOH A . #