data_3L8G # _entry.id 3L8G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3L8G RCSB RCSB056964 WWPDB D_1000056964 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3L8E . unspecified PDB 3L8F . unspecified PDB 3L8H . unspecified # _pdbx_database_status.entry_id 3L8G _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-12-31 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nguyen, H.' 1 'Peisach, E.' 2 'Allen, K.N.' 3 # _citation.id primary _citation.title ;Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) . ; _citation.journal_abbrev Biochemistry _citation.journal_volume 49 _citation.page_first 1082 _citation.page_last 1092 _citation.year 2010 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20050614 _citation.pdbx_database_id_DOI 10.1021/bi902019q # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nguyen, H.H.' 1 ? primary 'Wang, L.' 2 ? primary 'Huang, H.' 3 ? primary 'Peisach, E.' 4 ? primary 'Dunaway-Mariano, D.' 5 ? primary 'Allen, K.N.' 6 ? # _cell.entry_id 3L8G _cell.length_a 63.669 _cell.length_b 51.572 _cell.length_c 52.185 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3L8G _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'D,D-heptose 1,7-bisphosphate phosphatase' 21268.887 1 3.1.3.- ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 non-polymer syn 1,7-di-O-phosphono-L-glycero-beta-D-manno-heptopyranose 370.142 1 ? ? ? ? 6 water nat water 18.015 79 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)AKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDA(MSE)RELKK(MSE)GFALVVVTNQSGIARGKFTEAQF ETLTEW(MSE)DWSLADRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPG(MSE)LLSARDYLHID(MSE)AASY (MSE)VGDKLED(MSE)QAAVAANVGTKVLVRTGKPITPEAENAADWVLNSLADLPQAIKKQQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLA DRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKP ITPEAENAADWVLNSLADLPQAIKKQQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 LYS n 1 4 SER n 1 5 VAL n 1 6 PRO n 1 7 ALA n 1 8 ILE n 1 9 PHE n 1 10 LEU n 1 11 ASP n 1 12 ARG n 1 13 ASP n 1 14 GLY n 1 15 THR n 1 16 ILE n 1 17 ASN n 1 18 VAL n 1 19 ASP n 1 20 HIS n 1 21 GLY n 1 22 TYR n 1 23 VAL n 1 24 HIS n 1 25 GLU n 1 26 ILE n 1 27 ASP n 1 28 ASN n 1 29 PHE n 1 30 GLU n 1 31 PHE n 1 32 ILE n 1 33 ASP n 1 34 GLY n 1 35 VAL n 1 36 ILE n 1 37 ASP n 1 38 ALA n 1 39 MSE n 1 40 ARG n 1 41 GLU n 1 42 LEU n 1 43 LYS n 1 44 LYS n 1 45 MSE n 1 46 GLY n 1 47 PHE n 1 48 ALA n 1 49 LEU n 1 50 VAL n 1 51 VAL n 1 52 VAL n 1 53 THR n 1 54 ASN n 1 55 GLN n 1 56 SER n 1 57 GLY n 1 58 ILE n 1 59 ALA n 1 60 ARG n 1 61 GLY n 1 62 LYS n 1 63 PHE n 1 64 THR n 1 65 GLU n 1 66 ALA n 1 67 GLN n 1 68 PHE n 1 69 GLU n 1 70 THR n 1 71 LEU n 1 72 THR n 1 73 GLU n 1 74 TRP n 1 75 MSE n 1 76 ASP n 1 77 TRP n 1 78 SER n 1 79 LEU n 1 80 ALA n 1 81 ASP n 1 82 ARG n 1 83 ASP n 1 84 VAL n 1 85 ASP n 1 86 LEU n 1 87 ASP n 1 88 GLY n 1 89 ILE n 1 90 TYR n 1 91 TYR n 1 92 CYS n 1 93 PRO n 1 94 HIS n 1 95 HIS n 1 96 PRO n 1 97 GLN n 1 98 GLY n 1 99 SER n 1 100 VAL n 1 101 GLU n 1 102 GLU n 1 103 PHE n 1 104 ARG n 1 105 GLN n 1 106 VAL n 1 107 CYS n 1 108 ASP n 1 109 CYS n 1 110 ARG n 1 111 LYS n 1 112 PRO n 1 113 HIS n 1 114 PRO n 1 115 GLY n 1 116 MSE n 1 117 LEU n 1 118 LEU n 1 119 SER n 1 120 ALA n 1 121 ARG n 1 122 ASP n 1 123 TYR n 1 124 LEU n 1 125 HIS n 1 126 ILE n 1 127 ASP n 1 128 MSE n 1 129 ALA n 1 130 ALA n 1 131 SER n 1 132 TYR n 1 133 MSE n 1 134 VAL n 1 135 GLY n 1 136 ASP n 1 137 LYS n 1 138 LEU n 1 139 GLU n 1 140 ASP n 1 141 MSE n 1 142 GLN n 1 143 ALA n 1 144 ALA n 1 145 VAL n 1 146 ALA n 1 147 ALA n 1 148 ASN n 1 149 VAL n 1 150 GLY n 1 151 THR n 1 152 LYS n 1 153 VAL n 1 154 LEU n 1 155 VAL n 1 156 ARG n 1 157 THR n 1 158 GLY n 1 159 LYS n 1 160 PRO n 1 161 ILE n 1 162 THR n 1 163 PRO n 1 164 GLU n 1 165 ALA n 1 166 GLU n 1 167 ASN n 1 168 ALA n 1 169 ALA n 1 170 ASP n 1 171 TRP n 1 172 VAL n 1 173 LEU n 1 174 ASN n 1 175 SER n 1 176 LEU n 1 177 ALA n 1 178 ASP n 1 179 LEU n 1 180 PRO n 1 181 GLN n 1 182 ALA n 1 183 ILE n 1 184 LYS n 1 185 LYS n 1 186 GLN n 1 187 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'b0200, gmhB, JW0196, yaeD' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain B-834 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GMHB_ECOLI _struct_ref.pdbx_db_accession P63228 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLA DRDVDLDGIYYCPHHPQGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKP ITPEAENAADWVLNSLADLPQAIKKQQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3L8G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 187 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P63228 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 187 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 187 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GMB D-saccharide . 1,7-di-O-phosphono-L-glycero-beta-D-manno-heptopyranose ? 'C7 H16 O13 P2' 370.142 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 3L8G _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.01 _exptl_crystal.density_percent_sol 38.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'hanging drop' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1M Tris, 5mM MgCl2, 25% PEG 3350, pH 7.5, hanging drop, temperature 298K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 2007-02-11 _diffrn_detector.details 'Osmic mirrors' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Nickel _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU300' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 3L8G _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.180 _reflns.number_obs 9183 _reflns.number_all ? _reflns.percent_possible_obs 97.200 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 16.600 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.500 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 2.18 2.26 99.00 0.427 ? ? 3.50 ? ? ? ? ? ? ? 1 2.26 2.35 98.50 0.342 ? ? 3.50 ? ? ? ? ? ? ? 2 2.35 2.46 98.20 0.283 ? ? 3.40 ? ? ? ? ? ? ? 3 2.46 2.58 98.50 0.236 ? ? 3.50 ? ? ? ? ? ? ? 4 2.58 2.75 97.50 0.181 ? ? 3.50 ? ? ? ? ? ? ? 5 2.75 2.96 98.50 0.123 ? ? 3.60 ? ? ? ? ? ? ? 6 2.96 3.26 97.20 0.084 ? ? 3.60 ? ? ? ? ? ? ? 7 3.26 3.73 97.80 0.048 ? ? 3.60 ? ? ? ? ? ? ? 8 3.73 4.70 95.60 0.037 ? ? 3.60 ? ? ? ? ? ? ? 9 4.70 50.00 92.00 0.036 ? ? 3.50 ? ? ? ? ? ? ? 10 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3L8G _refine.ls_number_reflns_obs 8761 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.06 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 18.341 _refine.ls_d_res_high 2.180 _refine.ls_percent_reflns_obs 93.22 _refine.ls_R_factor_obs 0.1911 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1878 _refine.ls_R_factor_R_free 0.2554 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.79 _refine.ls_number_reflns_R_free 420 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min 1.00 _refine.occupancy_max 1.00 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 31.383 _refine.aniso_B[1][1] -4.997 _refine.aniso_B[2][2] 1.245 _refine.aniso_B[3][3] 3.752 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] -0.000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.386 _refine.solvent_model_param_bsol 39.035 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.23 _refine.pdbx_overall_phase_error 24.26 _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1432 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 1536 _refine_hist.d_res_high 2.180 _refine_hist.d_res_low 18.341 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.010 ? ? 1486 'X-RAY DIFFRACTION' ? f_angle_d 1.265 ? ? 2021 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 20.282 ? ? 559 'X-RAY DIFFRACTION' ? f_chiral_restr 0.073 ? ? 219 'X-RAY DIFFRACTION' ? f_plane_restr 0.004 ? ? 262 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.1800 2.26 2643 0.2205 91.00 0.3066 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.4948 3.1406 2779 0.1974 94.00 0.2602 . . 127 . . . . 'X-RAY DIFFRACTION' . 3.1406 18.3415 2919 0.1743 95.00 0.2365 . . 149 . . . . # _struct.entry_id 3L8G _struct.title ;Crystal Structure of D,D-heptose 1.7-bisphosphate phosphatase from E. Coli complexed with D-glycero-D-manno-heptose 1 ,7-bisphosphate ; _struct.pdbx_descriptor 'D,D-heptose 1,7-bisphosphate phosphatase (E.C.3.1.3.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3L8G _struct_keywords.text ;HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bisphosphate phosphatase, Carbohydrate metabolism, Cytoplasm, Hydrolase, Lipopolysaccharide biosynthesis ; _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 25 ? PHE A 29 ? GLU A 25 PHE A 29 5 ? 5 HELX_P HELX_P2 2 GLY A 34 ? MSE A 45 ? GLY A 34 MSE A 45 1 ? 12 HELX_P HELX_P3 3 SER A 56 ? ALA A 59 ? SER A 56 ALA A 59 5 ? 4 HELX_P HELX_P4 4 THR A 64 ? ASP A 81 ? THR A 64 ASP A 81 1 ? 18 HELX_P HELX_P5 5 VAL A 100 ? ARG A 104 ? VAL A 100 ARG A 104 5 ? 5 HELX_P HELX_P6 6 PRO A 114 ? HIS A 125 ? PRO A 114 HIS A 125 1 ? 12 HELX_P HELX_P7 7 LYS A 137 ? ALA A 147 ? LYS A 137 ALA A 147 1 ? 11 HELX_P HELX_P8 8 THR A 162 ? ALA A 169 ? THR A 162 ALA A 169 1 ? 8 HELX_P HELX_P9 9 SER A 175 ? ALA A 177 ? SER A 175 ALA A 177 5 ? 3 HELX_P HELX_P10 10 ASP A 178 ? LYS A 185 ? ASP A 178 LYS A 185 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 38 C ? ? ? 1_555 A MSE 39 N ? ? A ALA 38 A MSE 39 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale2 covale both ? A MSE 39 C ? ? ? 1_555 A ARG 40 N ? ? A MSE 39 A ARG 40 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale3 covale both ? A LYS 44 C ? ? ? 1_555 A MSE 45 N ? ? A LYS 44 A MSE 45 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 45 C ? ? ? 1_555 A GLY 46 N ? ? A MSE 45 A GLY 46 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale5 covale both ? A TRP 74 C ? ? ? 1_555 A MSE 75 N ? ? A TRP 74 A MSE 75 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale6 covale both ? A MSE 75 C ? ? ? 1_555 A ASP 76 N ? ? A MSE 75 A ASP 76 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale7 covale both ? A GLY 115 C ? ? ? 1_555 A MSE 116 N ? ? A GLY 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale8 covale both ? A MSE 116 C ? ? ? 1_555 A LEU 117 N ? ? A MSE 116 A LEU 117 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale9 covale both ? A ASP 127 C ? ? ? 1_555 A MSE 128 N ? ? A ASP 127 A MSE 128 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale10 covale both ? A MSE 128 C ? ? ? 1_555 A ALA 129 N ? ? A MSE 128 A ALA 129 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale11 covale both ? A TYR 132 C ? ? ? 1_555 A MSE 133 N ? ? A TYR 132 A MSE 133 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale12 covale both ? A MSE 133 C ? ? ? 1_555 A VAL 134 N ? ? A MSE 133 A VAL 134 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale13 covale both ? A ASP 140 C ? ? ? 1_555 A MSE 141 N ? ? A ASP 140 A MSE 141 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale14 covale both ? A MSE 141 C ? ? ? 1_555 A GLN 142 N ? ? A MSE 141 A GLN 142 1_555 ? ? ? ? ? ? ? 1.334 ? ? metalc1 metalc ? ? A ASP 11 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 11 A MG 188 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc2 metalc ? ? A ASP 11 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 11 A MG 188 1_555 ? ? ? ? ? ? ? 2.655 ? ? metalc3 metalc ? ? A ASP 13 O ? ? ? 1_555 B MG . MG ? ? A ASP 13 A MG 188 1_555 ? ? ? ? ? ? ? 2.382 ? ? metalc4 metalc ? ? A TYR 22 OH ? ? ? 1_555 D NA . NA ? ? A TYR 22 A NA 190 1_555 ? ? ? ? ? ? ? 2.797 ? ? metalc5 metalc ? ? A CYS 92 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 92 A ZN 189 1_555 ? ? ? ? ? ? ? 2.346 ? ? metalc6 metalc ? ? A HIS 94 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 94 A ZN 189 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc7 metalc ? ? A CYS 107 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 107 A ZN 189 1_555 ? ? ? ? ? ? ? 2.318 ? ? metalc8 metalc ? ? A CYS 109 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 109 A ZN 189 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc9 metalc ? ? A ASP 136 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 136 A MG 188 1_555 ? ? ? ? ? ? ? 2.471 ? ? metalc10 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 188 A HOH 222 1_555 ? ? ? ? ? ? ? 2.576 ? ? metalc11 metalc ? ? B MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 188 A HOH 257 1_555 ? ? ? ? ? ? ? 2.499 ? ? metalc12 metalc ? ? B MG . MG ? ? ? 1_555 E GMB . OP4 ? ? A MG 188 A GMB 3523 1_555 ? ? ? ? ? ? ? 2.239 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 111 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 111 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 112 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 112 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.27 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 88 ? CYS A 92 ? GLY A 88 CYS A 92 A 2 ALA A 48 ? ASN A 54 ? ALA A 48 ASN A 54 A 3 ALA A 7 ? LEU A 10 ? ALA A 7 LEU A 10 A 4 TYR A 132 ? GLY A 135 ? TYR A 132 GLY A 135 A 5 THR A 151 ? VAL A 155 ? THR A 151 VAL A 155 A 6 TRP A 171 ? LEU A 173 ? TRP A 171 LEU A 173 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 90 ? O TYR A 90 N VAL A 51 ? N VAL A 51 A 2 3 O VAL A 52 ? O VAL A 52 N LEU A 10 ? N LEU A 10 A 3 4 N PHE A 9 ? N PHE A 9 O TYR A 132 ? O TYR A 132 A 4 5 N MSE A 133 ? N MSE A 133 O VAL A 153 ? O VAL A 153 A 5 6 N LEU A 154 ? N LEU A 154 O LEU A 173 ? O LEU A 173 # _atom_sites.entry_id 3L8G _atom_sites.fract_transf_matrix[1][1] 0.015706 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019390 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019163 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N NA O P S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 MSE 39 39 39 MSE MSE A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 MSE 45 45 45 MSE MSE A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 TRP 74 74 74 TRP TRP A . n A 1 75 MSE 75 75 75 MSE MSE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 CYS 92 92 92 CYS CYS A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 MSE 116 116 116 MSE MSE A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 MSE 128 128 128 MSE MSE A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 MSE 133 133 133 MSE MSE A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 MSE 141 141 141 MSE MSE A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 TRP 171 171 171 TRP TRP A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 GLN 186 186 186 GLN GLN A . n A 1 187 GLN 187 187 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 188 187 MG MG A . C 3 ZN 1 189 188 ZN ZN A . D 4 NA 1 190 189 NA NA A . E 5 GMB 1 3523 3523 GMB GMB A . F 6 HOH 1 191 1 HOH HOH A . F 6 HOH 2 192 2 HOH HOH A . F 6 HOH 3 193 3 HOH HOH A . F 6 HOH 4 194 4 HOH HOH A . F 6 HOH 5 195 5 HOH HOH A . F 6 HOH 6 196 6 HOH HOH A . F 6 HOH 7 197 7 HOH HOH A . F 6 HOH 8 198 8 HOH HOH A . F 6 HOH 9 199 9 HOH HOH A . F 6 HOH 10 200 10 HOH HOH A . F 6 HOH 11 201 11 HOH HOH A . F 6 HOH 12 202 12 HOH HOH A . F 6 HOH 13 203 13 HOH HOH A . F 6 HOH 14 204 14 HOH HOH A . F 6 HOH 15 205 15 HOH HOH A . F 6 HOH 16 206 16 HOH HOH A . F 6 HOH 17 207 17 HOH HOH A . F 6 HOH 18 208 18 HOH HOH A . F 6 HOH 19 209 19 HOH HOH A . F 6 HOH 20 210 20 HOH HOH A . F 6 HOH 21 211 21 HOH HOH A . F 6 HOH 22 212 22 HOH HOH A . F 6 HOH 23 213 23 HOH HOH A . F 6 HOH 24 214 24 HOH HOH A . F 6 HOH 25 215 25 HOH HOH A . F 6 HOH 26 216 26 HOH HOH A . F 6 HOH 27 217 27 HOH HOH A . F 6 HOH 28 218 28 HOH HOH A . F 6 HOH 29 219 29 HOH HOH A . F 6 HOH 30 220 30 HOH HOH A . F 6 HOH 31 221 31 HOH HOH A . F 6 HOH 32 222 32 HOH HOH A . F 6 HOH 33 223 33 HOH HOH A . F 6 HOH 34 224 34 HOH HOH A . F 6 HOH 35 225 35 HOH HOH A . F 6 HOH 36 226 36 HOH HOH A . F 6 HOH 37 227 37 HOH HOH A . F 6 HOH 38 228 38 HOH HOH A . F 6 HOH 39 229 39 HOH HOH A . F 6 HOH 40 230 40 HOH HOH A . F 6 HOH 41 231 41 HOH HOH A . F 6 HOH 42 232 42 HOH HOH A . F 6 HOH 43 233 43 HOH HOH A . F 6 HOH 44 234 44 HOH HOH A . F 6 HOH 45 235 45 HOH HOH A . F 6 HOH 46 236 46 HOH HOH A . F 6 HOH 47 237 47 HOH HOH A . F 6 HOH 48 238 48 HOH HOH A . F 6 HOH 49 239 49 HOH HOH A . F 6 HOH 50 240 50 HOH HOH A . F 6 HOH 51 241 51 HOH HOH A . F 6 HOH 52 242 52 HOH HOH A . F 6 HOH 53 243 53 HOH HOH A . F 6 HOH 54 244 54 HOH HOH A . F 6 HOH 55 245 55 HOH HOH A . F 6 HOH 56 246 56 HOH HOH A . F 6 HOH 57 247 57 HOH HOH A . F 6 HOH 58 248 58 HOH HOH A . F 6 HOH 59 249 59 HOH HOH A . F 6 HOH 60 250 60 HOH HOH A . F 6 HOH 61 251 61 HOH HOH A . F 6 HOH 62 252 62 HOH HOH A . F 6 HOH 63 253 63 HOH HOH A . F 6 HOH 64 254 64 HOH HOH A . F 6 HOH 65 255 65 HOH HOH A . F 6 HOH 66 256 66 HOH HOH A . F 6 HOH 67 257 67 HOH HOH A . F 6 HOH 68 258 68 HOH HOH A . F 6 HOH 69 259 69 HOH HOH A . F 6 HOH 70 260 70 HOH HOH A . F 6 HOH 71 261 71 HOH HOH A . F 6 HOH 72 262 72 HOH HOH A . F 6 HOH 73 263 73 HOH HOH A . F 6 HOH 74 264 74 HOH HOH A . F 6 HOH 75 265 75 HOH HOH A . F 6 HOH 76 266 76 HOH HOH A . F 6 HOH 77 267 77 HOH HOH A . F 6 HOH 78 268 78 HOH HOH A . F 6 HOH 79 269 79 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 39 A MSE 39 ? MET SELENOMETHIONINE 2 A MSE 45 A MSE 45 ? MET SELENOMETHIONINE 3 A MSE 75 A MSE 75 ? MET SELENOMETHIONINE 4 A MSE 116 A MSE 116 ? MET SELENOMETHIONINE 5 A MSE 128 A MSE 128 ? MET SELENOMETHIONINE 6 A MSE 133 A MSE 133 ? MET SELENOMETHIONINE 7 A MSE 141 A MSE 141 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OD1 ? A ASP 11 ? A ASP 11 ? 1_555 51.7 ? 2 OD2 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? A ASP 13 ? A ASP 13 ? 1_555 87.8 ? 3 OD1 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? A ASP 13 ? A ASP 13 ? 1_555 91.0 ? 4 OD2 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 76.6 ? 5 OD1 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 122.9 ? 6 O ? A ASP 13 ? A ASP 13 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 111.6 ? 7 OD2 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? F HOH . ? A HOH 222 ? 1_555 146.1 ? 8 OD1 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? F HOH . ? A HOH 222 ? 1_555 152.3 ? 9 O ? A ASP 13 ? A ASP 13 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? F HOH . ? A HOH 222 ? 1_555 73.2 ? 10 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? F HOH . ? A HOH 222 ? 1_555 84.5 ? 11 OD2 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? F HOH . ? A HOH 257 ? 1_555 107.0 ? 12 OD1 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? F HOH . ? A HOH 257 ? 1_555 89.4 ? 13 O ? A ASP 13 ? A ASP 13 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? F HOH . ? A HOH 257 ? 1_555 161.1 ? 14 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? F HOH . ? A HOH 257 ? 1_555 83.8 ? 15 O ? F HOH . ? A HOH 222 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 O ? F HOH . ? A HOH 257 ? 1_555 98.5 ? 16 OD2 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OP4 ? E GMB . ? A GMB 3523 ? 1_555 111.0 ? 17 OD1 ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OP4 ? E GMB . ? A GMB 3523 ? 1_555 59.5 ? 18 O ? A ASP 13 ? A ASP 13 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OP4 ? E GMB . ? A GMB 3523 ? 1_555 89.7 ? 19 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OP4 ? E GMB . ? A GMB 3523 ? 1_555 158.0 ? 20 O ? F HOH . ? A HOH 222 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OP4 ? E GMB . ? A GMB 3523 ? 1_555 97.0 ? 21 O ? F HOH . ? A HOH 257 ? 1_555 MG ? B MG . ? A MG 188 ? 1_555 OP4 ? E GMB . ? A GMB 3523 ? 1_555 74.2 ? 22 SG ? A CYS 92 ? A CYS 92 ? 1_555 ZN ? C ZN . ? A ZN 189 ? 1_555 ND1 ? A HIS 94 ? A HIS 94 ? 1_555 112.8 ? 23 SG ? A CYS 92 ? A CYS 92 ? 1_555 ZN ? C ZN . ? A ZN 189 ? 1_555 SG ? A CYS 107 ? A CYS 107 ? 1_555 106.6 ? 24 ND1 ? A HIS 94 ? A HIS 94 ? 1_555 ZN ? C ZN . ? A ZN 189 ? 1_555 SG ? A CYS 107 ? A CYS 107 ? 1_555 100.6 ? 25 SG ? A CYS 92 ? A CYS 92 ? 1_555 ZN ? C ZN . ? A ZN 189 ? 1_555 SG ? A CYS 109 ? A CYS 109 ? 1_555 119.3 ? 26 ND1 ? A HIS 94 ? A HIS 94 ? 1_555 ZN ? C ZN . ? A ZN 189 ? 1_555 SG ? A CYS 109 ? A CYS 109 ? 1_555 105.3 ? 27 SG ? A CYS 107 ? A CYS 107 ? 1_555 ZN ? C ZN . ? A ZN 189 ? 1_555 SG ? A CYS 109 ? A CYS 109 ? 1_555 110.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-02-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-11-01 4 'Structure model' 1 3 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' chem_comp 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_site 6 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_chem_comp.type' 2 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 PHENIX 1.5_2 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 4 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 CrystalClear . ? ? ? ? 'data collection' ? ? ? 6 PHASER . ? ? ? ? phasing ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 12 ? ? -98.11 -74.29 2 1 HIS A 24 ? ? -152.17 -3.50 3 1 GLN A 105 ? ? 177.13 159.69 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A GLN 187 ? A GLN 187 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'ZINC ION' ZN 4 'SODIUM ION' NA 5 1,7-di-O-phosphono-L-glycero-beta-D-manno-heptopyranose GMB 6 water HOH #