data_3WK5 # _entry.id 3WK5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.360 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3WK5 pdb_00003wk5 10.2210/pdb3wk5/pdb RCSB RCSB096436 ? ? WWPDB D_1000096436 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3WK4 . unspecified PDB 3WK6 . unspecified PDB 3WK7 . unspecified PDB 3WK8 . unspecified PDB 3WK9 . unspecified PDB 3WKA . unspecified PDB 3WKB . unspecified PDB 3WKC . unspecified PDB 3WKD . unspecified PDB 3WKE . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3WK5 _pdbx_database_status.recvd_initial_deposition_date 2013-10-17 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Amano, Y.' 1 'Yamaguchi, T.' 2 'Tanabe, E.' 3 # _citation.id primary _citation.title 'Structural insights into binding of inhibitors to soluble epoxide hydrolase gained by fragment screening and X-ray crystallography.' _citation.journal_abbrev Bioorg.Med.Chem. _citation.journal_volume 22 _citation.page_first 2427 _citation.page_last 2434 _citation.year 2014 _citation.journal_id_ASTM BMECEP _citation.country UK _citation.journal_id_ISSN 1464-3391 _citation.journal_id_CSD 1200 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24656800 _citation.pdbx_database_id_DOI 10.1016/j.bmc.2014.03.001 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Amano, Y.' 1 ? primary 'Yamaguchi, T.' 2 ? primary 'Tanabe, E.' 3 ? # _cell.entry_id 3WK5 _cell.length_a 91.930 _cell.length_b 91.930 _cell.length_c 243.847 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3WK5 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bifunctional epoxide hydrolase 2' 63514.512 1 '3.3.2.10, 3.1.3.76' ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 non-polymer syn '2-cyclopentyl-N-(1,3-thiazol-2-yl)acetamide' 210.296 1 ? ? ? ? 5 water nat water 18.015 10 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytosolic epoxide hydrolase 2, CEH, Epoxide hydratase, Soluble epoxide hydrolase, SEH, Lipid-phosphate phosphatase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKV CLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVK PEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTF LDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQN LSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMHHHHH H ; _entity_poly.pdbx_seq_one_letter_code_can ;MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKV CLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVK PEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTF LDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQN LSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMHHHHH H ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 LEU n 1 4 ARG n 1 5 ALA n 1 6 ALA n 1 7 VAL n 1 8 PHE n 1 9 ASP n 1 10 LEU n 1 11 ASP n 1 12 GLY n 1 13 VAL n 1 14 LEU n 1 15 ALA n 1 16 LEU n 1 17 PRO n 1 18 ALA n 1 19 VAL n 1 20 PHE n 1 21 GLY n 1 22 VAL n 1 23 LEU n 1 24 GLY n 1 25 ARG n 1 26 THR n 1 27 GLU n 1 28 GLU n 1 29 ALA n 1 30 LEU n 1 31 ALA n 1 32 LEU n 1 33 PRO n 1 34 ARG n 1 35 GLY n 1 36 LEU n 1 37 LEU n 1 38 ASN n 1 39 ASP n 1 40 ALA n 1 41 PHE n 1 42 GLN n 1 43 LYS n 1 44 GLY n 1 45 GLY n 1 46 PRO n 1 47 GLU n 1 48 GLY n 1 49 ALA n 1 50 THR n 1 51 THR n 1 52 ARG n 1 53 LEU n 1 54 MET n 1 55 LYS n 1 56 GLY n 1 57 GLU n 1 58 ILE n 1 59 THR n 1 60 LEU n 1 61 SER n 1 62 GLN n 1 63 TRP n 1 64 ILE n 1 65 PRO n 1 66 LEU n 1 67 MET n 1 68 GLU n 1 69 GLU n 1 70 ASN n 1 71 CYS n 1 72 ARG n 1 73 LYS n 1 74 CYS n 1 75 SER n 1 76 GLU n 1 77 THR n 1 78 ALA n 1 79 LYS n 1 80 VAL n 1 81 CYS n 1 82 LEU n 1 83 PRO n 1 84 LYS n 1 85 ASN n 1 86 PHE n 1 87 SER n 1 88 ILE n 1 89 LYS n 1 90 GLU n 1 91 ILE n 1 92 PHE n 1 93 ASP n 1 94 LYS n 1 95 ALA n 1 96 ILE n 1 97 SER n 1 98 ALA n 1 99 ARG n 1 100 LYS n 1 101 ILE n 1 102 ASN n 1 103 ARG n 1 104 PRO n 1 105 MET n 1 106 LEU n 1 107 GLN n 1 108 ALA n 1 109 ALA n 1 110 LEU n 1 111 MET n 1 112 LEU n 1 113 ARG n 1 114 LYS n 1 115 LYS n 1 116 GLY n 1 117 PHE n 1 118 THR n 1 119 THR n 1 120 ALA n 1 121 ILE n 1 122 LEU n 1 123 THR n 1 124 ASN n 1 125 THR n 1 126 TRP n 1 127 LEU n 1 128 ASP n 1 129 ASP n 1 130 ARG n 1 131 ALA n 1 132 GLU n 1 133 ARG n 1 134 ASP n 1 135 GLY n 1 136 LEU n 1 137 ALA n 1 138 GLN n 1 139 LEU n 1 140 MET n 1 141 CYS n 1 142 GLU n 1 143 LEU n 1 144 LYS n 1 145 MET n 1 146 HIS n 1 147 PHE n 1 148 ASP n 1 149 PHE n 1 150 LEU n 1 151 ILE n 1 152 GLU n 1 153 SER n 1 154 CYS n 1 155 GLN n 1 156 VAL n 1 157 GLY n 1 158 MET n 1 159 VAL n 1 160 LYS n 1 161 PRO n 1 162 GLU n 1 163 PRO n 1 164 GLN n 1 165 ILE n 1 166 TYR n 1 167 LYS n 1 168 PHE n 1 169 LEU n 1 170 LEU n 1 171 ASP n 1 172 THR n 1 173 LEU n 1 174 LYS n 1 175 ALA n 1 176 SER n 1 177 PRO n 1 178 SER n 1 179 GLU n 1 180 VAL n 1 181 VAL n 1 182 PHE n 1 183 LEU n 1 184 ASP n 1 185 ASP n 1 186 ILE n 1 187 GLY n 1 188 ALA n 1 189 ASN n 1 190 LEU n 1 191 LYS n 1 192 PRO n 1 193 ALA n 1 194 ARG n 1 195 ASP n 1 196 LEU n 1 197 GLY n 1 198 MET n 1 199 VAL n 1 200 THR n 1 201 ILE n 1 202 LEU n 1 203 VAL n 1 204 GLN n 1 205 ASP n 1 206 THR n 1 207 ASP n 1 208 THR n 1 209 ALA n 1 210 LEU n 1 211 LYS n 1 212 GLU n 1 213 LEU n 1 214 GLU n 1 215 LYS n 1 216 VAL n 1 217 THR n 1 218 GLY n 1 219 ILE n 1 220 GLN n 1 221 LEU n 1 222 LEU n 1 223 ASN n 1 224 THR n 1 225 PRO n 1 226 ALA n 1 227 PRO n 1 228 LEU n 1 229 PRO n 1 230 THR n 1 231 SER n 1 232 CYS n 1 233 ASN n 1 234 PRO n 1 235 SER n 1 236 ASP n 1 237 MET n 1 238 SER n 1 239 HIS n 1 240 GLY n 1 241 TYR n 1 242 VAL n 1 243 THR n 1 244 VAL n 1 245 LYS n 1 246 PRO n 1 247 ARG n 1 248 VAL n 1 249 ARG n 1 250 LEU n 1 251 HIS n 1 252 PHE n 1 253 VAL n 1 254 GLU n 1 255 LEU n 1 256 GLY n 1 257 SER n 1 258 GLY n 1 259 PRO n 1 260 ALA n 1 261 VAL n 1 262 CYS n 1 263 LEU n 1 264 CYS n 1 265 HIS n 1 266 GLY n 1 267 PHE n 1 268 PRO n 1 269 GLU n 1 270 SER n 1 271 TRP n 1 272 TYR n 1 273 SER n 1 274 TRP n 1 275 ARG n 1 276 TYR n 1 277 GLN n 1 278 ILE n 1 279 PRO n 1 280 ALA n 1 281 LEU n 1 282 ALA n 1 283 GLN n 1 284 ALA n 1 285 GLY n 1 286 TYR n 1 287 ARG n 1 288 VAL n 1 289 LEU n 1 290 ALA n 1 291 MET n 1 292 ASP n 1 293 MET n 1 294 LYS n 1 295 GLY n 1 296 TYR n 1 297 GLY n 1 298 GLU n 1 299 SER n 1 300 SER n 1 301 ALA n 1 302 PRO n 1 303 PRO n 1 304 GLU n 1 305 ILE n 1 306 GLU n 1 307 GLU n 1 308 TYR n 1 309 CYS n 1 310 MET n 1 311 GLU n 1 312 VAL n 1 313 LEU n 1 314 CYS n 1 315 LYS n 1 316 GLU n 1 317 MET n 1 318 VAL n 1 319 THR n 1 320 PHE n 1 321 LEU n 1 322 ASP n 1 323 LYS n 1 324 LEU n 1 325 GLY n 1 326 LEU n 1 327 SER n 1 328 GLN n 1 329 ALA n 1 330 VAL n 1 331 PHE n 1 332 ILE n 1 333 GLY n 1 334 HIS n 1 335 ASP n 1 336 TRP n 1 337 GLY n 1 338 GLY n 1 339 MET n 1 340 LEU n 1 341 VAL n 1 342 TRP n 1 343 TYR n 1 344 MET n 1 345 ALA n 1 346 LEU n 1 347 PHE n 1 348 TYR n 1 349 PRO n 1 350 GLU n 1 351 ARG n 1 352 VAL n 1 353 ARG n 1 354 ALA n 1 355 VAL n 1 356 ALA n 1 357 SER n 1 358 LEU n 1 359 ASN n 1 360 THR n 1 361 PRO n 1 362 PHE n 1 363 ILE n 1 364 PRO n 1 365 ALA n 1 366 ASN n 1 367 PRO n 1 368 ASN n 1 369 MET n 1 370 SER n 1 371 PRO n 1 372 LEU n 1 373 GLU n 1 374 SER n 1 375 ILE n 1 376 LYS n 1 377 ALA n 1 378 ASN n 1 379 PRO n 1 380 VAL n 1 381 PHE n 1 382 ASP n 1 383 TYR n 1 384 GLN n 1 385 LEU n 1 386 TYR n 1 387 PHE n 1 388 GLN n 1 389 GLU n 1 390 PRO n 1 391 GLY n 1 392 VAL n 1 393 ALA n 1 394 GLU n 1 395 ALA n 1 396 GLU n 1 397 LEU n 1 398 GLU n 1 399 GLN n 1 400 ASN n 1 401 LEU n 1 402 SER n 1 403 ARG n 1 404 THR n 1 405 PHE n 1 406 LYS n 1 407 SER n 1 408 LEU n 1 409 PHE n 1 410 ARG n 1 411 ALA n 1 412 SER n 1 413 ASP n 1 414 GLU n 1 415 SER n 1 416 VAL n 1 417 LEU n 1 418 SER n 1 419 MET n 1 420 HIS n 1 421 LYS n 1 422 VAL n 1 423 CYS n 1 424 GLU n 1 425 ALA n 1 426 GLY n 1 427 GLY n 1 428 LEU n 1 429 PHE n 1 430 VAL n 1 431 ASN n 1 432 SER n 1 433 PRO n 1 434 GLU n 1 435 GLU n 1 436 PRO n 1 437 SER n 1 438 LEU n 1 439 SER n 1 440 ARG n 1 441 MET n 1 442 VAL n 1 443 THR n 1 444 GLU n 1 445 GLU n 1 446 GLU n 1 447 ILE n 1 448 GLN n 1 449 PHE n 1 450 TYR n 1 451 VAL n 1 452 GLN n 1 453 GLN n 1 454 PHE n 1 455 LYS n 1 456 LYS n 1 457 SER n 1 458 GLY n 1 459 PHE n 1 460 ARG n 1 461 GLY n 1 462 PRO n 1 463 LEU n 1 464 ASN n 1 465 TRP n 1 466 TYR n 1 467 ARG n 1 468 ASN n 1 469 MET n 1 470 GLU n 1 471 ARG n 1 472 ASN n 1 473 TRP n 1 474 LYS n 1 475 TRP n 1 476 ALA n 1 477 CYS n 1 478 LYS n 1 479 SER n 1 480 LEU n 1 481 GLY n 1 482 ARG n 1 483 LYS n 1 484 ILE n 1 485 LEU n 1 486 ILE n 1 487 PRO n 1 488 ALA n 1 489 LEU n 1 490 MET n 1 491 VAL n 1 492 THR n 1 493 ALA n 1 494 GLU n 1 495 LYS n 1 496 ASP n 1 497 PHE n 1 498 VAL n 1 499 LEU n 1 500 VAL n 1 501 PRO n 1 502 GLN n 1 503 MET n 1 504 SER n 1 505 GLN n 1 506 HIS n 1 507 MET n 1 508 GLU n 1 509 ASP n 1 510 TRP n 1 511 ILE n 1 512 PRO n 1 513 HIS n 1 514 LEU n 1 515 LYS n 1 516 ARG n 1 517 GLY n 1 518 HIS n 1 519 ILE n 1 520 GLU n 1 521 ASP n 1 522 CYS n 1 523 GLY n 1 524 HIS n 1 525 TRP n 1 526 THR n 1 527 GLN n 1 528 MET n 1 529 ASP n 1 530 LYS n 1 531 PRO n 1 532 THR n 1 533 GLU n 1 534 VAL n 1 535 ASN n 1 536 GLN n 1 537 ILE n 1 538 LEU n 1 539 ILE n 1 540 LYS n 1 541 TRP n 1 542 LEU n 1 543 ASP n 1 544 SER n 1 545 ASP n 1 546 ALA n 1 547 ARG n 1 548 ASN n 1 549 PRO n 1 550 PRO n 1 551 VAL n 1 552 VAL n 1 553 SER n 1 554 LYS n 1 555 MET n 1 556 HIS n 1 557 HIS n 1 558 HIS n 1 559 HIS n 1 560 HIS n 1 561 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EPHX2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HYES_HUMAN _struct_ref.pdbx_db_accession P34913 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKV CLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVK PEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTF LDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQN LSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3WK5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 555 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P34913 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 555 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 555 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3WK5 HIS A 556 ? UNP P34913 ? ? 'expression tag' 556 1 1 3WK5 HIS A 557 ? UNP P34913 ? ? 'expression tag' 557 2 1 3WK5 HIS A 558 ? UNP P34913 ? ? 'expression tag' 558 3 1 3WK5 HIS A 559 ? UNP P34913 ? ? 'expression tag' 559 4 1 3WK5 HIS A 560 ? UNP P34913 ? ? 'expression tag' 560 5 1 3WK5 HIS A 561 ? UNP P34913 ? ? 'expression tag' 561 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 S0C non-polymer . '2-cyclopentyl-N-(1,3-thiazol-2-yl)acetamide' ? 'C10 H14 N2 O S' 210.296 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3WK5 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_percent_sol 47.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details ;0.1M Potassium phosphate, 0.2M Ammonium dihydrogen phosphate, 25%w/v PEG 3350, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 90 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 270' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NE3A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline AR-NE3A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0000 # _reflns.entry_id 3WK5 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.84 _reflns.d_resolution_high 2.77 _reflns.number_obs 15390 _reflns.number_all ? _reflns.percent_possible_obs 99.63 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.773 _reflns_shell.d_res_low 2.845 _reflns_shell.percent_possible_all 99.57 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3WK5 _refine.ls_number_reflns_obs 15390 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.84 _refine.ls_d_res_high 2.77 _refine.ls_percent_reflns_obs 99.63 _refine.ls_R_factor_obs 0.18458 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18098 _refine.ls_R_factor_R_free 0.25252 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 817 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.949 _refine.correlation_coeff_Fo_to_Fc_free 0.905 _refine.B_iso_mean 41.624 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] -0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.379 _refine.overall_SU_ML 0.271 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 13.928 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 4323 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 4353 _refine_hist.d_res_high 2.77 _refine_hist.d_res_low 30.84 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.012 0.019 ? 4447 ? 'X-RAY DIFFRACTION' r_bond_other_d ? ? ? ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.743 1.975 ? 6025 ? 'X-RAY DIFFRACTION' r_angle_other_deg ? ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.596 5.000 ? 545 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 34.658 24.167 ? 192 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 19.416 15.000 ? 783 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 21.425 15.000 ? 26 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.111 0.200 ? 659 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.007 0.021 ? 3348 ? 'X-RAY DIFFRACTION' r_gen_planes_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_scbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_long_range_B_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_long_range_B_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.773 _refine_ls_shell.d_res_low 2.845 _refine_ls_shell.number_reflns_R_work 1083 _refine_ls_shell.R_factor_R_work 0.285 _refine_ls_shell.percent_reflns_obs 99.57 _refine_ls_shell.R_factor_R_free 0.337 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 70 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? # _struct.entry_id 3WK5 _struct.title 'Crystal structure of soluble epoxide hydrolase in complex with fragment inhibitor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3WK5 _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' _struct_keywords.text 'Hydrolase, HYDROLASE-HYDROLASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 18 ? LEU A 30 ? ALA A 18 LEU A 30 1 ? 13 HELX_P HELX_P2 2 GLY A 35 ? LYS A 43 ? GLY A 35 LYS A 43 1 ? 9 HELX_P HELX_P3 3 GLY A 44 ? GLU A 47 ? GLY A 44 GLU A 47 5 ? 4 HELX_P HELX_P4 4 GLY A 48 ? LYS A 55 ? GLY A 48 LYS A 55 1 ? 8 HELX_P HELX_P5 5 THR A 59 ? ALA A 78 ? THR A 59 ALA A 78 1 ? 20 HELX_P HELX_P6 6 SER A 87 ? ARG A 99 ? SER A 87 ARG A 99 1 ? 13 HELX_P HELX_P7 7 ASN A 102 ? LYS A 115 ? ASN A 102 LYS A 115 1 ? 14 HELX_P HELX_P8 8 ARG A 133 ? MET A 145 ? ARG A 133 MET A 145 1 ? 13 HELX_P HELX_P9 9 SER A 153 ? GLY A 157 ? SER A 153 GLY A 157 1 ? 5 HELX_P HELX_P10 10 GLU A 162 ? LYS A 174 ? GLU A 162 LYS A 174 1 ? 13 HELX_P HELX_P11 11 ILE A 186 ? GLY A 197 ? ILE A 186 GLY A 197 1 ? 12 HELX_P HELX_P12 12 ASP A 205 ? GLY A 218 ? ASP A 205 GLY A 218 1 ? 14 HELX_P HELX_P13 13 ASN A 233 ? MET A 237 ? ASN A 233 MET A 237 5 ? 5 HELX_P HELX_P14 14 SER A 270 ? ARG A 275 ? SER A 270 ARG A 275 5 ? 6 HELX_P HELX_P15 15 TYR A 276 ? ALA A 284 ? TYR A 276 ALA A 284 1 ? 9 HELX_P HELX_P16 16 ILE A 305 ? TYR A 308 ? ILE A 305 TYR A 308 5 ? 4 HELX_P HELX_P17 17 CYS A 309 ? GLY A 325 ? CYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P18 18 ASP A 335 ? TYR A 348 ? ASP A 335 TYR A 348 1 ? 14 HELX_P HELX_P19 19 SER A 370 ? ALA A 377 ? SER A 370 ALA A 377 1 ? 8 HELX_P HELX_P20 20 ASN A 378 ? VAL A 380 ? ASN A 378 VAL A 380 5 ? 3 HELX_P HELX_P21 21 PHE A 381 ? PHE A 387 ? PHE A 381 PHE A 387 1 ? 7 HELX_P HELX_P22 22 GLY A 391 ? ASN A 400 ? GLY A 391 ASN A 400 1 ? 10 HELX_P HELX_P23 23 ASN A 400 ? PHE A 409 ? ASN A 400 PHE A 409 1 ? 10 HELX_P HELX_P24 24 ALA A 411 ? SER A 415 ? ALA A 411 SER A 415 5 ? 5 HELX_P HELX_P25 25 LYS A 421 ? GLY A 426 ? LYS A 421 GLY A 426 1 ? 6 HELX_P HELX_P26 26 THR A 443 ? GLY A 458 ? THR A 443 GLY A 458 1 ? 16 HELX_P HELX_P27 27 PHE A 459 ? TRP A 465 ? PHE A 459 TRP A 465 1 ? 7 HELX_P HELX_P28 28 ASN A 468 ? LYS A 478 ? ASN A 468 LYS A 478 1 ? 11 HELX_P HELX_P29 29 VAL A 500 ? GLN A 505 ? VAL A 500 GLN A 505 5 ? 6 HELX_P HELX_P30 30 HIS A 506 ? TRP A 510 ? HIS A 506 TRP A 510 5 ? 5 HELX_P HELX_P31 31 TRP A 525 ? LYS A 530 ? TRP A 525 LYS A 530 1 ? 6 HELX_P HELX_P32 32 LYS A 530 ? ALA A 546 ? LYS A 530 ALA A 546 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 9 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 9 A MG 601 1_555 ? ? ? ? ? ? ? 2.264 ? ? metalc2 metalc ? ? A ASP 11 O ? ? ? 1_555 B MG . MG ? ? A ASP 11 A MG 601 1_555 ? ? ? ? ? ? ? 2.225 ? ? metalc3 metalc ? ? A ASP 185 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 185 A MG 601 1_555 ? ? ? ? ? ? ? 2.092 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 C PO4 . O1 ? ? A MG 601 A PO4 602 1_555 ? ? ? ? ? ? ? 2.110 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 16 A . ? LEU 16 A PRO 17 A ? PRO 17 A 1 -10.13 2 LYS 160 A . ? LYS 160 A PRO 161 A ? PRO 161 A 1 1.04 3 PHE 267 A . ? PHE 267 A PRO 268 A ? PRO 268 A 1 -11.10 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? parallel C 4 5 ? parallel C 5 6 ? parallel C 6 7 ? parallel C 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 149 ? GLU A 152 ? PHE A 149 GLU A 152 A 2 THR A 118 ? THR A 123 ? THR A 118 THR A 123 A 3 ALA A 5 ? PHE A 8 ? ALA A 5 PHE A 8 A 4 VAL A 180 ? ASP A 184 ? VAL A 180 ASP A 184 A 5 VAL A 199 ? LEU A 202 ? VAL A 199 LEU A 202 B 1 ALA A 15 ? LEU A 16 ? ALA A 15 LEU A 16 B 2 LYS A 100 ? ILE A 101 ? LYS A 100 ILE A 101 C 1 SER A 238 ? LYS A 245 ? SER A 238 LYS A 245 C 2 VAL A 248 ? LEU A 255 ? VAL A 248 LEU A 255 C 3 ARG A 287 ? ASP A 292 ? ARG A 287 ASP A 292 C 4 ALA A 260 ? CYS A 264 ? ALA A 260 CYS A 264 C 5 ALA A 329 ? HIS A 334 ? ALA A 329 HIS A 334 C 6 VAL A 352 ? LEU A 358 ? VAL A 352 LEU A 358 C 7 ALA A 488 ? ALA A 493 ? ALA A 488 ALA A 493 C 8 LYS A 515 ? ILE A 519 ? LYS A 515 ILE A 519 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 151 ? O ILE A 151 N ILE A 121 ? N ILE A 121 A 2 3 O ALA A 120 ? O ALA A 120 N PHE A 8 ? N PHE A 8 A 3 4 N VAL A 7 ? N VAL A 7 O VAL A 181 ? O VAL A 181 A 4 5 N ASP A 184 ? N ASP A 184 O ILE A 201 ? O ILE A 201 B 1 2 N LEU A 16 ? N LEU A 16 O LYS A 100 ? O LYS A 100 C 1 2 N GLY A 240 ? N GLY A 240 O PHE A 252 ? O PHE A 252 C 2 3 N VAL A 253 ? N VAL A 253 O ALA A 290 ? O ALA A 290 C 3 4 O LEU A 289 ? O LEU A 289 N VAL A 261 ? N VAL A 261 C 4 5 N CYS A 262 ? N CYS A 262 O VAL A 330 ? O VAL A 330 C 5 6 N PHE A 331 ? N PHE A 331 O ALA A 354 ? O ALA A 354 C 6 7 N SER A 357 ? N SER A 357 O VAL A 491 ? O VAL A 491 C 7 8 N ALA A 488 ? N ALA A 488 O LYS A 515 ? O LYS A 515 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 601 ? 4 'BINDING SITE FOR RESIDUE MG A 601' AC2 Software A PO4 602 ? 7 'BINDING SITE FOR RESIDUE PO4 A 602' AC3 Software A S0C 603 ? 6 'BINDING SITE FOR RESIDUE S0C A 603' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 9 ? ASP A 9 . ? 1_555 ? 2 AC1 4 ASP A 11 ? ASP A 11 . ? 1_555 ? 3 AC1 4 ASP A 185 ? ASP A 185 . ? 1_555 ? 4 AC1 4 PO4 C . ? PO4 A 602 . ? 1_555 ? 5 AC2 7 ASP A 9 ? ASP A 9 . ? 1_555 ? 6 AC2 7 LEU A 10 ? LEU A 10 . ? 1_555 ? 7 AC2 7 ASP A 11 ? ASP A 11 . ? 1_555 ? 8 AC2 7 THR A 123 ? THR A 123 . ? 1_555 ? 9 AC2 7 ASN A 124 ? ASN A 124 . ? 1_555 ? 10 AC2 7 LYS A 160 ? LYS A 160 . ? 1_555 ? 11 AC2 7 MG B . ? MG A 601 . ? 1_555 ? 12 AC3 6 ASP A 335 ? ASP A 335 . ? 1_555 ? 13 AC3 6 TRP A 336 ? TRP A 336 . ? 1_555 ? 14 AC3 6 TYR A 383 ? TYR A 383 . ? 1_555 ? 15 AC3 6 GLN A 384 ? GLN A 384 . ? 1_555 ? 16 AC3 6 TYR A 466 ? TYR A 466 . ? 1_555 ? 17 AC3 6 HIS A 524 ? HIS A 524 . ? 1_555 ? # _database_PDB_matrix.entry_id 3WK5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3WK5 _atom_sites.fract_transf_matrix[1][1] 0.010878 _atom_sites.fract_transf_matrix[1][2] 0.006280 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012561 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004101 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 CYS 141 141 141 CYS CYS A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 HIS 146 146 146 HIS HIS A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 PHE 149 149 149 PHE PHE A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 CYS 154 154 154 CYS CYS A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 MET 158 158 158 MET MET A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 PRO 177 177 177 PRO PRO A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ASP 184 184 184 ASP ASP A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 GLN 204 204 204 GLN GLN A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 LEU 210 210 210 LEU LEU A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 ASN 223 223 223 ASN ASN A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 PRO 229 229 229 PRO PRO A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 SER 231 231 231 SER SER A . n A 1 232 CYS 232 232 232 CYS CYS A . n A 1 233 ASN 233 233 233 ASN ASN A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 MET 237 237 237 MET MET A . n A 1 238 SER 238 238 238 SER SER A . n A 1 239 HIS 239 239 239 HIS HIS A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 TYR 241 241 241 TYR TYR A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 THR 243 243 243 THR THR A . n A 1 244 VAL 244 244 244 VAL VAL A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 PRO 246 246 246 PRO PRO A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 ARG 249 249 249 ARG ARG A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 HIS 251 251 251 HIS HIS A . n A 1 252 PHE 252 252 252 PHE PHE A . n A 1 253 VAL 253 253 253 VAL VAL A . n A 1 254 GLU 254 254 254 GLU GLU A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 SER 257 257 257 SER SER A . n A 1 258 GLY 258 258 258 GLY GLY A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 CYS 262 262 262 CYS CYS A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 CYS 264 264 264 CYS CYS A . n A 1 265 HIS 265 265 265 HIS HIS A . n A 1 266 GLY 266 266 266 GLY GLY A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 PRO 268 268 268 PRO PRO A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 TRP 271 271 271 TRP TRP A . n A 1 272 TYR 272 272 272 TYR TYR A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 TRP 274 274 274 TRP TRP A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 TYR 276 276 276 TYR TYR A . n A 1 277 GLN 277 277 277 GLN GLN A . n A 1 278 ILE 278 278 278 ILE ILE A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 LEU 281 281 281 LEU LEU A . n A 1 282 ALA 282 282 282 ALA ALA A . n A 1 283 GLN 283 283 283 GLN GLN A . n A 1 284 ALA 284 284 284 ALA ALA A . n A 1 285 GLY 285 285 285 GLY GLY A . n A 1 286 TYR 286 286 286 TYR TYR A . n A 1 287 ARG 287 287 287 ARG ARG A . n A 1 288 VAL 288 288 288 VAL VAL A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 MET 291 291 291 MET MET A . n A 1 292 ASP 292 292 292 ASP ASP A . n A 1 293 MET 293 293 293 MET MET A . n A 1 294 LYS 294 294 294 LYS LYS A . n A 1 295 GLY 295 295 295 GLY GLY A . n A 1 296 TYR 296 296 296 TYR TYR A . n A 1 297 GLY 297 297 297 GLY GLY A . n A 1 298 GLU 298 298 298 GLU GLU A . n A 1 299 SER 299 299 299 SER SER A . n A 1 300 SER 300 300 300 SER SER A . n A 1 301 ALA 301 301 301 ALA ALA A . n A 1 302 PRO 302 302 302 PRO PRO A . n A 1 303 PRO 303 303 303 PRO PRO A . n A 1 304 GLU 304 304 304 GLU GLU A . n A 1 305 ILE 305 305 305 ILE ILE A . n A 1 306 GLU 306 306 306 GLU GLU A . n A 1 307 GLU 307 307 307 GLU GLU A . n A 1 308 TYR 308 308 308 TYR TYR A . n A 1 309 CYS 309 309 309 CYS CYS A . n A 1 310 MET 310 310 310 MET MET A . n A 1 311 GLU 311 311 311 GLU GLU A . n A 1 312 VAL 312 312 312 VAL VAL A . n A 1 313 LEU 313 313 313 LEU LEU A . n A 1 314 CYS 314 314 314 CYS CYS A . n A 1 315 LYS 315 315 315 LYS LYS A . n A 1 316 GLU 316 316 316 GLU GLU A . n A 1 317 MET 317 317 317 MET MET A . n A 1 318 VAL 318 318 318 VAL VAL A . n A 1 319 THR 319 319 319 THR THR A . n A 1 320 PHE 320 320 320 PHE PHE A . n A 1 321 LEU 321 321 321 LEU LEU A . n A 1 322 ASP 322 322 322 ASP ASP A . n A 1 323 LYS 323 323 323 LYS LYS A . n A 1 324 LEU 324 324 324 LEU LEU A . n A 1 325 GLY 325 325 325 GLY GLY A . n A 1 326 LEU 326 326 326 LEU LEU A . n A 1 327 SER 327 327 327 SER SER A . n A 1 328 GLN 328 328 328 GLN GLN A . n A 1 329 ALA 329 329 329 ALA ALA A . n A 1 330 VAL 330 330 330 VAL VAL A . n A 1 331 PHE 331 331 331 PHE PHE A . n A 1 332 ILE 332 332 332 ILE ILE A . n A 1 333 GLY 333 333 333 GLY GLY A . n A 1 334 HIS 334 334 334 HIS HIS A . n A 1 335 ASP 335 335 335 ASP ASP A . n A 1 336 TRP 336 336 336 TRP TRP A . n A 1 337 GLY 337 337 337 GLY GLY A . n A 1 338 GLY 338 338 338 GLY GLY A . n A 1 339 MET 339 339 339 MET MET A . n A 1 340 LEU 340 340 340 LEU LEU A . n A 1 341 VAL 341 341 341 VAL VAL A . n A 1 342 TRP 342 342 342 TRP TRP A . n A 1 343 TYR 343 343 343 TYR TYR A . n A 1 344 MET 344 344 344 MET MET A . n A 1 345 ALA 345 345 345 ALA ALA A . n A 1 346 LEU 346 346 346 LEU LEU A . n A 1 347 PHE 347 347 347 PHE PHE A . n A 1 348 TYR 348 348 348 TYR TYR A . n A 1 349 PRO 349 349 349 PRO PRO A . n A 1 350 GLU 350 350 350 GLU GLU A . n A 1 351 ARG 351 351 351 ARG ARG A . n A 1 352 VAL 352 352 352 VAL VAL A . n A 1 353 ARG 353 353 353 ARG ARG A . n A 1 354 ALA 354 354 354 ALA ALA A . n A 1 355 VAL 355 355 355 VAL VAL A . n A 1 356 ALA 356 356 356 ALA ALA A . n A 1 357 SER 357 357 357 SER SER A . n A 1 358 LEU 358 358 358 LEU LEU A . n A 1 359 ASN 359 359 359 ASN ASN A . n A 1 360 THR 360 360 360 THR THR A . n A 1 361 PRO 361 361 361 PRO PRO A . n A 1 362 PHE 362 362 362 PHE PHE A . n A 1 363 ILE 363 363 363 ILE ILE A . n A 1 364 PRO 364 364 364 PRO PRO A . n A 1 365 ALA 365 365 365 ALA ALA A . n A 1 366 ASN 366 366 366 ASN ASN A . n A 1 367 PRO 367 367 367 PRO PRO A . n A 1 368 ASN 368 368 368 ASN ASN A . n A 1 369 MET 369 369 369 MET MET A . n A 1 370 SER 370 370 370 SER SER A . n A 1 371 PRO 371 371 371 PRO PRO A . n A 1 372 LEU 372 372 372 LEU LEU A . n A 1 373 GLU 373 373 373 GLU GLU A . n A 1 374 SER 374 374 374 SER SER A . n A 1 375 ILE 375 375 375 ILE ILE A . n A 1 376 LYS 376 376 376 LYS LYS A . n A 1 377 ALA 377 377 377 ALA ALA A . n A 1 378 ASN 378 378 378 ASN ASN A . n A 1 379 PRO 379 379 379 PRO PRO A . n A 1 380 VAL 380 380 380 VAL VAL A . n A 1 381 PHE 381 381 381 PHE PHE A . n A 1 382 ASP 382 382 382 ASP ASP A . n A 1 383 TYR 383 383 383 TYR TYR A . n A 1 384 GLN 384 384 384 GLN GLN A . n A 1 385 LEU 385 385 385 LEU LEU A . n A 1 386 TYR 386 386 386 TYR TYR A . n A 1 387 PHE 387 387 387 PHE PHE A . n A 1 388 GLN 388 388 388 GLN GLN A . n A 1 389 GLU 389 389 389 GLU GLU A . n A 1 390 PRO 390 390 390 PRO PRO A . n A 1 391 GLY 391 391 391 GLY GLY A . n A 1 392 VAL 392 392 392 VAL VAL A . n A 1 393 ALA 393 393 393 ALA ALA A . n A 1 394 GLU 394 394 394 GLU GLU A . n A 1 395 ALA 395 395 395 ALA ALA A . n A 1 396 GLU 396 396 396 GLU GLU A . n A 1 397 LEU 397 397 397 LEU LEU A . n A 1 398 GLU 398 398 398 GLU GLU A . n A 1 399 GLN 399 399 399 GLN GLN A . n A 1 400 ASN 400 400 400 ASN ASN A . n A 1 401 LEU 401 401 401 LEU LEU A . n A 1 402 SER 402 402 402 SER SER A . n A 1 403 ARG 403 403 403 ARG ARG A . n A 1 404 THR 404 404 404 THR THR A . n A 1 405 PHE 405 405 405 PHE PHE A . n A 1 406 LYS 406 406 406 LYS LYS A . n A 1 407 SER 407 407 407 SER SER A . n A 1 408 LEU 408 408 408 LEU LEU A . n A 1 409 PHE 409 409 409 PHE PHE A . n A 1 410 ARG 410 410 410 ARG ARG A . n A 1 411 ALA 411 411 411 ALA ALA A . n A 1 412 SER 412 412 412 SER SER A . n A 1 413 ASP 413 413 413 ASP ASP A . n A 1 414 GLU 414 414 414 GLU GLU A . n A 1 415 SER 415 415 415 SER SER A . n A 1 416 VAL 416 416 416 VAL VAL A . n A 1 417 LEU 417 417 417 LEU LEU A . n A 1 418 SER 418 418 418 SER SER A . n A 1 419 MET 419 419 419 MET MET A . n A 1 420 HIS 420 420 420 HIS HIS A . n A 1 421 LYS 421 421 421 LYS LYS A . n A 1 422 VAL 422 422 422 VAL VAL A . n A 1 423 CYS 423 423 423 CYS CYS A . n A 1 424 GLU 424 424 424 GLU GLU A . n A 1 425 ALA 425 425 425 ALA ALA A . n A 1 426 GLY 426 426 426 GLY GLY A . n A 1 427 GLY 427 427 427 GLY GLY A . n A 1 428 LEU 428 428 428 LEU LEU A . n A 1 429 PHE 429 429 429 PHE PHE A . n A 1 430 VAL 430 430 430 VAL VAL A . n A 1 431 ASN 431 431 431 ASN ASN A . n A 1 432 SER 432 432 432 SER SER A . n A 1 433 PRO 433 433 433 PRO PRO A . n A 1 434 GLU 434 434 434 GLU GLU A . n A 1 435 GLU 435 435 435 GLU GLU A . n A 1 436 PRO 436 436 436 PRO PRO A . n A 1 437 SER 437 437 437 SER SER A . n A 1 438 LEU 438 438 438 LEU LEU A . n A 1 439 SER 439 439 439 SER SER A . n A 1 440 ARG 440 440 440 ARG ARG A . n A 1 441 MET 441 441 441 MET MET A . n A 1 442 VAL 442 442 442 VAL VAL A . n A 1 443 THR 443 443 443 THR THR A . n A 1 444 GLU 444 444 444 GLU GLU A . n A 1 445 GLU 445 445 445 GLU GLU A . n A 1 446 GLU 446 446 446 GLU GLU A . n A 1 447 ILE 447 447 447 ILE ILE A . n A 1 448 GLN 448 448 448 GLN GLN A . n A 1 449 PHE 449 449 449 PHE PHE A . n A 1 450 TYR 450 450 450 TYR TYR A . n A 1 451 VAL 451 451 451 VAL VAL A . n A 1 452 GLN 452 452 452 GLN GLN A . n A 1 453 GLN 453 453 453 GLN GLN A . n A 1 454 PHE 454 454 454 PHE PHE A . n A 1 455 LYS 455 455 455 LYS LYS A . n A 1 456 LYS 456 456 456 LYS LYS A . n A 1 457 SER 457 457 457 SER SER A . n A 1 458 GLY 458 458 458 GLY GLY A . n A 1 459 PHE 459 459 459 PHE PHE A . n A 1 460 ARG 460 460 460 ARG ARG A . n A 1 461 GLY 461 461 461 GLY GLY A . n A 1 462 PRO 462 462 462 PRO PRO A . n A 1 463 LEU 463 463 463 LEU LEU A . n A 1 464 ASN 464 464 464 ASN ASN A . n A 1 465 TRP 465 465 465 TRP TRP A . n A 1 466 TYR 466 466 466 TYR TYR A . n A 1 467 ARG 467 467 467 ARG ARG A . n A 1 468 ASN 468 468 468 ASN ASN A . n A 1 469 MET 469 469 469 MET MET A . n A 1 470 GLU 470 470 470 GLU GLU A . n A 1 471 ARG 471 471 471 ARG ARG A . n A 1 472 ASN 472 472 472 ASN ASN A . n A 1 473 TRP 473 473 473 TRP TRP A . n A 1 474 LYS 474 474 474 LYS LYS A . n A 1 475 TRP 475 475 475 TRP TRP A . n A 1 476 ALA 476 476 476 ALA ALA A . n A 1 477 CYS 477 477 477 CYS CYS A . n A 1 478 LYS 478 478 478 LYS LYS A . n A 1 479 SER 479 479 479 SER SER A . n A 1 480 LEU 480 480 480 LEU LEU A . n A 1 481 GLY 481 481 481 GLY GLY A . n A 1 482 ARG 482 482 482 ARG ARG A . n A 1 483 LYS 483 483 483 LYS LYS A . n A 1 484 ILE 484 484 484 ILE ILE A . n A 1 485 LEU 485 485 485 LEU LEU A . n A 1 486 ILE 486 486 486 ILE ILE A . n A 1 487 PRO 487 487 487 PRO PRO A . n A 1 488 ALA 488 488 488 ALA ALA A . n A 1 489 LEU 489 489 489 LEU LEU A . n A 1 490 MET 490 490 490 MET MET A . n A 1 491 VAL 491 491 491 VAL VAL A . n A 1 492 THR 492 492 492 THR THR A . n A 1 493 ALA 493 493 493 ALA ALA A . n A 1 494 GLU 494 494 494 GLU GLU A . n A 1 495 LYS 495 495 495 LYS LYS A . n A 1 496 ASP 496 496 496 ASP ASP A . n A 1 497 PHE 497 497 497 PHE PHE A . n A 1 498 VAL 498 498 498 VAL VAL A . n A 1 499 LEU 499 499 499 LEU LEU A . n A 1 500 VAL 500 500 500 VAL VAL A . n A 1 501 PRO 501 501 501 PRO PRO A . n A 1 502 GLN 502 502 502 GLN GLN A . n A 1 503 MET 503 503 503 MET MET A . n A 1 504 SER 504 504 504 SER SER A . n A 1 505 GLN 505 505 505 GLN GLN A . n A 1 506 HIS 506 506 506 HIS HIS A . n A 1 507 MET 507 507 507 MET MET A . n A 1 508 GLU 508 508 508 GLU GLU A . n A 1 509 ASP 509 509 509 ASP ASP A . n A 1 510 TRP 510 510 510 TRP TRP A . n A 1 511 ILE 511 511 511 ILE ILE A . n A 1 512 PRO 512 512 512 PRO PRO A . n A 1 513 HIS 513 513 513 HIS HIS A . n A 1 514 LEU 514 514 514 LEU LEU A . n A 1 515 LYS 515 515 515 LYS LYS A . n A 1 516 ARG 516 516 516 ARG ARG A . n A 1 517 GLY 517 517 517 GLY GLY A . n A 1 518 HIS 518 518 518 HIS HIS A . n A 1 519 ILE 519 519 519 ILE ILE A . n A 1 520 GLU 520 520 520 GLU GLU A . n A 1 521 ASP 521 521 521 ASP ASP A . n A 1 522 CYS 522 522 522 CYS CYS A . n A 1 523 GLY 523 523 523 GLY GLY A . n A 1 524 HIS 524 524 524 HIS HIS A . n A 1 525 TRP 525 525 525 TRP TRP A . n A 1 526 THR 526 526 526 THR THR A . n A 1 527 GLN 527 527 527 GLN GLN A . n A 1 528 MET 528 528 528 MET MET A . n A 1 529 ASP 529 529 529 ASP ASP A . n A 1 530 LYS 530 530 530 LYS LYS A . n A 1 531 PRO 531 531 531 PRO PRO A . n A 1 532 THR 532 532 532 THR THR A . n A 1 533 GLU 533 533 533 GLU GLU A . n A 1 534 VAL 534 534 534 VAL VAL A . n A 1 535 ASN 535 535 535 ASN ASN A . n A 1 536 GLN 536 536 536 GLN GLN A . n A 1 537 ILE 537 537 537 ILE ILE A . n A 1 538 LEU 538 538 538 LEU LEU A . n A 1 539 ILE 539 539 539 ILE ILE A . n A 1 540 LYS 540 540 540 LYS LYS A . n A 1 541 TRP 541 541 541 TRP TRP A . n A 1 542 LEU 542 542 542 LEU LEU A . n A 1 543 ASP 543 543 543 ASP ASP A . n A 1 544 SER 544 544 544 SER SER A . n A 1 545 ASP 545 545 545 ASP ASP A . n A 1 546 ALA 546 546 546 ALA ALA A . n A 1 547 ARG 547 547 547 ARG ARG A . n A 1 548 ASN 548 548 ? ? ? A . n A 1 549 PRO 549 549 ? ? ? A . n A 1 550 PRO 550 550 ? ? ? A . n A 1 551 VAL 551 551 ? ? ? A . n A 1 552 VAL 552 552 ? ? ? A . n A 1 553 SER 553 553 ? ? ? A . n A 1 554 LYS 554 554 ? ? ? A . n A 1 555 MET 555 555 ? ? ? A . n A 1 556 HIS 556 556 ? ? ? A . n A 1 557 HIS 557 557 ? ? ? A . n A 1 558 HIS 558 558 ? ? ? A . n A 1 559 HIS 559 559 ? ? ? A . n A 1 560 HIS 560 560 ? ? ? A . n A 1 561 HIS 561 561 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 601 782 MG MG A . C 3 PO4 1 602 783 PO4 PO4 A . D 4 S0C 1 603 1 S0C S0C A . E 5 HOH 1 701 1 HOH HOH A . E 5 HOH 2 702 2 HOH HOH A . E 5 HOH 3 703 3 HOH HOH A . E 5 HOH 4 704 4 HOH HOH A . E 5 HOH 5 705 5 HOH HOH A . E 5 HOH 6 706 6 HOH HOH A . E 5 HOH 7 707 7 HOH HOH A . E 5 HOH 8 708 8 HOH HOH A . E 5 HOH 9 709 9 HOH HOH A . E 5 HOH 10 710 10 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4960 ? 1 MORE -51 ? 1 'SSA (A^2)' 42660 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_455 -x+y-1,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 -91.9300000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 121.9235000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 9 ? A ASP 9 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O ? A ASP 11 ? A ASP 11 ? 1_555 73.6 ? 2 OD2 ? A ASP 9 ? A ASP 9 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 72.7 ? 3 O ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 83.8 ? 4 OD2 ? A ASP 9 ? A ASP 9 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O1 ? C PO4 . ? A PO4 602 ? 1_555 84.1 ? 5 O ? A ASP 11 ? A ASP 11 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O1 ? C PO4 . ? A PO4 602 ? 1_555 109.7 ? 6 OD1 ? A ASP 185 ? A ASP 185 ? 1_555 MG ? B MG . ? A MG 601 ? 1_555 O1 ? C PO4 . ? A PO4 602 ? 1_555 148.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-16 2 'Structure model' 1 1 2022-08-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' pdbx_struct_conn_angle 4 2 'Structure model' struct_conn 5 2 'Structure model' struct_ref_seq_dif 6 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_database_2.pdbx_DOI' 6 2 'Structure model' '_database_2.pdbx_database_accession' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 2 'Structure model' '_pdbx_struct_conn_angle.value' 20 2 'Structure model' '_struct_conn.pdbx_dist_value' 21 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 2 'Structure model' '_struct_ref_seq_dif.details' 33 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 34 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 35 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 AMoRE phasing . ? 2 REFMAC refinement 5.7.0029 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 183 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 183 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 183 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 130.25 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 14.95 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 10 ? ? -96.13 -86.64 2 1 ASP A 11 ? ? -46.40 107.90 3 1 VAL A 13 ? ? -129.56 -64.30 4 1 PRO A 177 ? ? -34.63 -34.53 5 1 GLN A 204 ? ? -100.25 -95.43 6 1 GLU A 269 ? ? -128.84 -140.49 7 1 SER A 273 ? ? -57.51 -8.12 8 1 ASP A 335 ? ? 59.78 -131.42 9 1 ASN A 359 ? ? 76.96 -39.16 10 1 MET A 369 ? ? -168.50 115.35 11 1 ASP A 521 ? ? 73.17 35.50 12 1 LYS A 530 ? ? -142.29 52.34 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 MET _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 291 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 292 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 144.07 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 548 ? A ASN 548 3 1 Y 1 A PRO 549 ? A PRO 549 4 1 Y 1 A PRO 550 ? A PRO 550 5 1 Y 1 A VAL 551 ? A VAL 551 6 1 Y 1 A VAL 552 ? A VAL 552 7 1 Y 1 A SER 553 ? A SER 553 8 1 Y 1 A LYS 554 ? A LYS 554 9 1 Y 1 A MET 555 ? A MET 555 10 1 Y 1 A HIS 556 ? A HIS 556 11 1 Y 1 A HIS 557 ? A HIS 557 12 1 Y 1 A HIS 558 ? A HIS 558 13 1 Y 1 A HIS 559 ? A HIS 559 14 1 Y 1 A HIS 560 ? A HIS 560 15 1 Y 1 A HIS 561 ? A HIS 561 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'PHOSPHATE ION' PO4 4 '2-cyclopentyl-N-(1,3-thiazol-2-yl)acetamide' S0C 5 water HOH #