data_3ZTA # _entry.id 3ZTA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3ZTA PDBE EBI-48926 WWPDB D_1290048926 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 3ZTB unspecified 'THE BACTERIAL STRESSOSOME: A MODULAR SYSTEM THAT HAS BEEN ADAPTED TO CONTROL SECONDARY MESSENGER SIGNALING' PDB 3ZT9 unspecified 'THE BACTERIAL STRESSOSOME: A MODULAR SYSTEM THAT HAS BEEN ADAPTED TO CONTROL SECONDARY MESSENGER SIGNALING' PDB 3ZXN unspecified 'MOORELLA THERMOACETICA RSBS S58E' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3ZTA _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2011-07-06 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Quin, M.B.' 1 'Berrisford, J.M.' 2 'Newman, J.A.' 3 'Basle, A.' 4 'Lewis, R.J.' 5 'Marles-Wright, J.' 6 # _citation.id primary _citation.title 'The Bacterial Stressosome: A Modular System that Has Been Adapted to Control Secondary Messenger Signaling.' _citation.journal_abbrev Structure _citation.journal_volume 20 _citation.page_first 350 _citation.page_last ? _citation.year 2012 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22325782 _citation.pdbx_database_id_DOI 10.1016/J.STR.2012.01.003 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Quin, M.B.' 1 primary 'Berrisford, J.M.' 2 primary 'Newman, J.A.' 3 primary 'Basle, A.' 4 primary 'Lewis, R.J.' 5 primary 'Marles-Wright, J.' 6 # _cell.entry_id 3ZTA _cell.length_a 56.410 _cell.length_b 56.410 _cell.length_c 148.310 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3ZTA _symmetry.space_group_name_H-M 'P 43 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 95 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ANTI-SIGMA-FACTOR ANTAGONIST (STAS) DOMAIN PROTEIN' 16814.637 1 ? ? 'NON-HEME GLOBIN SIGNALLING DOMAIN, RESIDUES 1-146' ? 2 water nat water 18.015 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name MTR # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)DICGELKAENIVEKAINLLSKEDQAGVHFNEISALTRDFCRAILSDLEQSGFTTSELEKEIADKVKI(MSE)FAQ GYHIEVLQLILEKILDSFISVIREQYHDLQAAASYITTVRDHIFKGTSFLLK(MSE)ALQTQREVIQKQNEAL(MSE)EL ST ; _entity_poly.pdbx_seq_one_letter_code_can ;MDICGELKAENIVEKAINLLSKEDQAGVHFNEISALTRDFCRAILSDLEQSGFTTSELEKEIADKVKIMFAQGYHIEVLQ LILEKILDSFISVIREQYHDLQAAASYITTVRDHIFKGTSFLLKMALQTQREVIQKQNEALMELST ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASP n 1 3 ILE n 1 4 CYS n 1 5 GLY n 1 6 GLU n 1 7 LEU n 1 8 LYS n 1 9 ALA n 1 10 GLU n 1 11 ASN n 1 12 ILE n 1 13 VAL n 1 14 GLU n 1 15 LYS n 1 16 ALA n 1 17 ILE n 1 18 ASN n 1 19 LEU n 1 20 LEU n 1 21 SER n 1 22 LYS n 1 23 GLU n 1 24 ASP n 1 25 GLN n 1 26 ALA n 1 27 GLY n 1 28 VAL n 1 29 HIS n 1 30 PHE n 1 31 ASN n 1 32 GLU n 1 33 ILE n 1 34 SER n 1 35 ALA n 1 36 LEU n 1 37 THR n 1 38 ARG n 1 39 ASP n 1 40 PHE n 1 41 CYS n 1 42 ARG n 1 43 ALA n 1 44 ILE n 1 45 LEU n 1 46 SER n 1 47 ASP n 1 48 LEU n 1 49 GLU n 1 50 GLN n 1 51 SER n 1 52 GLY n 1 53 PHE n 1 54 THR n 1 55 THR n 1 56 SER n 1 57 GLU n 1 58 LEU n 1 59 GLU n 1 60 LYS n 1 61 GLU n 1 62 ILE n 1 63 ALA n 1 64 ASP n 1 65 LYS n 1 66 VAL n 1 67 LYS n 1 68 ILE n 1 69 MSE n 1 70 PHE n 1 71 ALA n 1 72 GLN n 1 73 GLY n 1 74 TYR n 1 75 HIS n 1 76 ILE n 1 77 GLU n 1 78 VAL n 1 79 LEU n 1 80 GLN n 1 81 LEU n 1 82 ILE n 1 83 LEU n 1 84 GLU n 1 85 LYS n 1 86 ILE n 1 87 LEU n 1 88 ASP n 1 89 SER n 1 90 PHE n 1 91 ILE n 1 92 SER n 1 93 VAL n 1 94 ILE n 1 95 ARG n 1 96 GLU n 1 97 GLN n 1 98 TYR n 1 99 HIS n 1 100 ASP n 1 101 LEU n 1 102 GLN n 1 103 ALA n 1 104 ALA n 1 105 ALA n 1 106 SER n 1 107 TYR n 1 108 ILE n 1 109 THR n 1 110 THR n 1 111 VAL n 1 112 ARG n 1 113 ASP n 1 114 HIS n 1 115 ILE n 1 116 PHE n 1 117 LYS n 1 118 GLY n 1 119 THR n 1 120 SER n 1 121 PHE n 1 122 LEU n 1 123 LEU n 1 124 LYS n 1 125 MSE n 1 126 ALA n 1 127 LEU n 1 128 GLN n 1 129 THR n 1 130 GLN n 1 131 ARG n 1 132 GLU n 1 133 VAL n 1 134 ILE n 1 135 GLN n 1 136 LYS n 1 137 GLN n 1 138 ASN n 1 139 GLU n 1 140 ALA n 1 141 LEU n 1 142 MSE n 1 143 GLU n 1 144 LEU n 1 145 SER n 1 146 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'MOORELLA THERMOACETICA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1525 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 39073 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI B' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 37762 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain B834 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2RIF4_MOOTA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q2RIF4 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ZTA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2RIF4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 146 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 146 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3ZTA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.83 _exptl_crystal.density_percent_sol 68 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.0 M AMMONIUM SULPHATE, 0.1 M BIS-TRIS PROPANE, PH 5.5, 1% PEG 3350.' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2009-02-18 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SINGLE CRYSTAL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9716 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_wavelength 0.9716 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 3ZTA _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 52.72 _reflns.d_resolution_high 2.70 _reflns.number_obs 12435 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 49.20 _reflns.B_iso_Wilson_estimate 56.69 _reflns.pdbx_redundancy 52.3 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.85 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.37 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 16.80 _reflns_shell.pdbx_redundancy 55.2 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3ZTA _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 12435 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 52.725 _refine.ls_d_res_high 2.700 _refine.ls_percent_reflns_obs 99.00 _refine.ls_R_factor_obs 0.2167 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2140 _refine.ls_R_factor_R_free 0.2751 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 591 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 68.8 _refine.aniso_B[1][1] -15.4950 _refine.aniso_B[2][2] -15.4950 _refine.aniso_B[3][3] 30.9901 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.360 _refine.solvent_model_param_bsol 53.141 _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 1.17 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.43 _refine.pdbx_overall_phase_error 28.63 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1113 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 1118 _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 52.725 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.012 ? ? 1219 'X-RAY DIFFRACTION' ? f_angle_d 0.734 ? ? 1514 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 16.222 ? ? 423 'X-RAY DIFFRACTION' ? f_chiral_restr 0.057 ? ? 180 'X-RAY DIFFRACTION' ? f_plane_restr 0.003 ? ? 192 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.7000 2.9717 2917 0.2816 97.00 0.3835 . . 138 . . 'X-RAY DIFFRACTION' . 2.9717 3.4017 2944 0.2453 99.00 0.2732 . . 158 . . 'X-RAY DIFFRACTION' . 3.4017 4.2855 2982 0.1962 100.00 0.2890 . . 152 . . 'X-RAY DIFFRACTION' . 4.2855 52.7350 3001 0.2000 100.00 0.2384 . . 143 . . # _struct.entry_id 3ZTA _struct.title 'The bacterial stressosome: a modular system that has been adapted to control secondary messenger signaling' _struct.pdbx_descriptor 'ANTI-SIGMA-FACTOR ANTAGONIST (STAS) DOMAIN PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ZTA _struct_keywords.pdbx_keywords SIGNALING _struct_keywords.text 'SIGNALING, SIGNAL TRANSDUCTION, PHOSPHORYLATION, PROTEIN-PROTEIN INTERACTION, TYPE 2C PHOSPHATASES, RSBS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 9 ? LYS A 22 ? ALA A 9 LYS A 22 1 ? 14 HELX_P HELX_P2 2 HIS A 29 ? GLU A 49 ? HIS A 29 GLU A 49 1 ? 21 HELX_P HELX_P3 3 THR A 55 ? GLY A 73 ? THR A 55 GLY A 73 1 ? 19 HELX_P HELX_P4 4 ILE A 76 ? TYR A 98 ? ILE A 76 TYR A 98 1 ? 23 HELX_P HELX_P5 5 ASP A 100 ? LEU A 144 ? ASP A 100 LEU A 144 1 ? 45 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ILE 68 C ? ? ? 1_555 A MSE 69 N ? ? A ILE 68 A MSE 69 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale ? ? A MSE 69 C ? ? ? 1_555 A PHE 70 N ? ? A MSE 69 A PHE 70 1_555 ? ? ? ? ? ? ? 1.326 ? covale3 covale ? ? A LYS 124 C ? ? ? 1_555 A MSE 125 N ? ? A LYS 124 A MSE 125 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale ? ? A MSE 125 C ? ? ? 1_555 A ALA 126 N ? ? A MSE 125 A ALA 126 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale ? ? A LEU 141 C ? ? ? 1_555 A MSE 142 N ? ? A LEU 141 A MSE 142 1_555 ? ? ? ? ? ? ? 1.332 ? covale6 covale ? ? A MSE 142 C ? ? ? 1_555 A GLU 143 N ? ? A MSE 142 A GLU 143 1_555 ? ? ? ? ? ? ? 1.325 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 3ZTA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3ZTA _atom_sites.fract_transf_matrix[1][1] 0.017727 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017727 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006743 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 ILE 3 3 ? ? ? A . n A 1 4 CYS 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 MSE 69 69 69 MSE MSE A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 MSE 125 125 125 MSE MSE A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLN 130 130 130 GLN GLN A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 MSE 142 142 142 MSE MSE A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 THR 146 146 146 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 69 A MSE 69 ? MET SELENOMETHIONINE 2 A MSE 125 A MSE 125 ? MET SELENOMETHIONINE 3 A MSE 142 A MSE 142 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2340 ? 1 MORE -16.8 ? 1 'SSA (A^2)' 14320 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 148.3100000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2002 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-02-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 14.5179 17.8586 78.4890 0.3464 0.2075 0.2638 0.0364 -0.1145 0.0240 1.4007 0.0124 1.4885 0.1221 -1.4406 -0.1264 -0.2769 -0.2827 -0.3735 0.1008 0.0752 -0.1597 0.4282 0.3085 -1.6634 'X-RAY DIFFRACTION' 2 ? refined 9.4334 28.0542 80.7389 0.5441 0.1950 0.5273 -0.0180 -0.2753 0.0190 0.3745 0.1027 0.4460 -0.1966 -0.4085 0.2135 -0.2164 0.0229 0.3508 0.1662 -0.0143 -0.3203 -0.5217 0.2992 -0.2599 'X-RAY DIFFRACTION' 3 ? refined 3.7263 11.4047 70.2298 0.6012 0.2171 0.5395 -0.0202 -0.2476 -0.0897 0.1393 0.8847 0.4265 0.1831 -0.0640 0.4169 -0.1461 0.1619 -0.0798 -0.3412 0.1146 -0.0620 -0.0611 -0.0631 0.8825 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 8:75)' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 76:100)' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 101:146)' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 SHELX phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 9 ? ? 48.68 -120.61 2 1 PHE A 53 ? ? 58.20 73.92 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2002 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 8.01 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A ILE 3 ? A ILE 3 4 1 Y 1 A CYS 4 ? A CYS 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A LEU 7 ? A LEU 7 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #