data_3ZUC # _entry.id 3ZUC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3ZUC pdb_00003zuc 10.2210/pdb3zuc/pdb PDBE EBI-49049 ? ? WWPDB D_1290049049 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 3ZQW unspecified 'STRUCTURE OF CBM3B OF MAJOR SCAFFOLDIN SUBUNIT SCAA FROM ACETIVIBRIO CELLULOLYTICUS' PDB 3ZU8 unspecified 'STRUCTURE OF CBM3B OF MAJOR SCAFFOLDIN SUBUNIT SCAA FROM ACETIVIBRIO CELLULOLYTICUS DETERMINED ON THE NIKEL ABSORPTION EDGE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3ZUC _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2011-07-18 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yaniv, O.' 1 'Halfon, Y.' 2 'Lamed, R.' 3 'Frolow, F.' 4 # _citation.id primary _citation.title 'Structure of Cbm3B of the Major Scaffoldin Subunit Scaa from Acetivibrio Cellulolyticus' _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_volume 68 _citation.page_first 8 _citation.page_last ? _citation.year 2012 _citation.journal_id_ASTM ? _citation.country DK _citation.journal_id_ISSN 1744-3091 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22232162 _citation.pdbx_database_id_DOI 10.1107/S174430911104807X # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yaniv, O.' 1 ? primary 'Halfon, Y.' 2 ? primary 'Shimon, L.J.W.' 3 ? primary 'Bayer, E.A.' 4 ? primary 'Lamed, R.' 5 ? primary 'Frolow, F.' 6 ? # _cell.entry_id 3ZUC _cell.length_a 52.697 _cell.length_b 52.697 _cell.length_c 194.159 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 3ZUC _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CELLULOSOMAL SCAFFOLDIN' 16788.248 1 ? ? 'RESIDUES 973-1121' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 5 non-polymer syn 'PENTAETHYLENE GLYCOL' 238.278 1 ? ? ? ? 6 water nat water 18.015 311 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FAMILY 3B CARBOHYDRATE BINDING MODULE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMNLKVEFFNAGTQAQSNSIYPKFRLTNTGSNAINLADVKLHYYFTVDGDKAQTFWCDWSPVGSSNVTGTFVKMNPTT TGADQYLEIAFSSAAGTLAANTSIEVQGRFAKSDWTNYNQADDYSFNSSATTYTSWDKVTAYSAEGLIWGIEP ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMNLKVEFFNAGTQAQSNSIYPKFRLTNTGSNAINLADVKLHYYFTVDGDKAQTFWCDWSPVGSSNVTGTFVKMNPTT TGADQYLEIAFSSAAGTLAANTSIEVQGRFAKSDWTNYNQADDYSFNSSATTYTSWDKVTAYSAEGLIWGIEP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASN n 1 6 LEU n 1 7 LYS n 1 8 VAL n 1 9 GLU n 1 10 PHE n 1 11 PHE n 1 12 ASN n 1 13 ALA n 1 14 GLY n 1 15 THR n 1 16 GLN n 1 17 ALA n 1 18 GLN n 1 19 SER n 1 20 ASN n 1 21 SER n 1 22 ILE n 1 23 TYR n 1 24 PRO n 1 25 LYS n 1 26 PHE n 1 27 ARG n 1 28 LEU n 1 29 THR n 1 30 ASN n 1 31 THR n 1 32 GLY n 1 33 SER n 1 34 ASN n 1 35 ALA n 1 36 ILE n 1 37 ASN n 1 38 LEU n 1 39 ALA n 1 40 ASP n 1 41 VAL n 1 42 LYS n 1 43 LEU n 1 44 HIS n 1 45 TYR n 1 46 TYR n 1 47 PHE n 1 48 THR n 1 49 VAL n 1 50 ASP n 1 51 GLY n 1 52 ASP n 1 53 LYS n 1 54 ALA n 1 55 GLN n 1 56 THR n 1 57 PHE n 1 58 TRP n 1 59 CYS n 1 60 ASP n 1 61 TRP n 1 62 SER n 1 63 PRO n 1 64 VAL n 1 65 GLY n 1 66 SER n 1 67 SER n 1 68 ASN n 1 69 VAL n 1 70 THR n 1 71 GLY n 1 72 THR n 1 73 PHE n 1 74 VAL n 1 75 LYS n 1 76 MET n 1 77 ASN n 1 78 PRO n 1 79 THR n 1 80 THR n 1 81 THR n 1 82 GLY n 1 83 ALA n 1 84 ASP n 1 85 GLN n 1 86 TYR n 1 87 LEU n 1 88 GLU n 1 89 ILE n 1 90 ALA n 1 91 PHE n 1 92 SER n 1 93 SER n 1 94 ALA n 1 95 ALA n 1 96 GLY n 1 97 THR n 1 98 LEU n 1 99 ALA n 1 100 ALA n 1 101 ASN n 1 102 THR n 1 103 SER n 1 104 ILE n 1 105 GLU n 1 106 VAL n 1 107 GLN n 1 108 GLY n 1 109 ARG n 1 110 PHE n 1 111 ALA n 1 112 LYS n 1 113 SER n 1 114 ASP n 1 115 TRP n 1 116 THR n 1 117 ASN n 1 118 TYR n 1 119 ASN n 1 120 GLN n 1 121 ALA n 1 122 ASP n 1 123 ASP n 1 124 TYR n 1 125 SER n 1 126 PHE n 1 127 ASN n 1 128 SER n 1 129 SER n 1 130 ALA n 1 131 THR n 1 132 THR n 1 133 TYR n 1 134 THR n 1 135 SER n 1 136 TRP n 1 137 ASP n 1 138 LYS n 1 139 VAL n 1 140 THR n 1 141 ALA n 1 142 TYR n 1 143 SER n 1 144 ALA n 1 145 GLU n 1 146 GLY n 1 147 LEU n 1 148 ILE n 1 149 TRP n 1 150 GLY n 1 151 ILE n 1 152 GLU n 1 153 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ACETIVIBRIO CELLULOLYTICUS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 35830 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 33288 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant RIL _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET28A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9RPL0_9FIRM _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9RPL0 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3ZUC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9RPL0 _struct_ref_seq.db_align_beg 973 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 153 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3ZUC GLY A 1 ? UNP Q9RPL0 ? ? 'expression tag' 1 1 1 3ZUC SER A 2 ? UNP Q9RPL0 ? ? 'expression tag' 2 2 1 3ZUC HIS A 3 ? UNP Q9RPL0 ? ? 'expression tag' 3 3 1 3ZUC MET A 4 ? UNP Q9RPL0 ? ? 'expression tag' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1PE non-polymer . 'PENTAETHYLENE GLYCOL' PEG400 'C10 H22 O6' 238.278 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3ZUC _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_percent_sol 45.2 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.9 M AMMONIUM SULFATE,0.1 M HEPES PH 7.5 0.5% (W/V) POLYETHYLENE GLYCOL 400 0.2M NICKEL CHLORIDE' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2011-06-25 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(311) MONOCHROMATOR' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength 0.97625 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 3ZUC _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.00 _reflns.number_obs 87445 _reflns.number_all ? _reflns.percent_possible_obs 98.4 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 33.20 _reflns.B_iso_Wilson_estimate 8.24 _reflns.pdbx_redundancy 7.6 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.00 _reflns_shell.d_res_low 1.02 _reflns_shell.percent_possible_all 82.2 _reflns_shell.Rmerge_I_obs 0.57 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.60 _reflns_shell.pdbx_redundancy 5.8 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 3ZUC _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 159400 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.426 _refine.ls_d_res_high 1.001 _refine.ls_percent_reflns_obs 98.08 _refine.ls_R_factor_obs 0.1251 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1249 _refine.ls_R_factor_R_free 0.1360 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 2.3 _refine.ls_number_reflns_R_free 3719 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 12.80 _refine.aniso_B[1][1] -1.4100 _refine.aniso_B[2][2] -1.4100 _refine.aniso_B[3][3] 2.8200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.498 _refine.solvent_model_param_bsol 75.879 _refine.pdbx_solvent_vdw_probe_radii 0.45 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.60 _refine.pdbx_ls_cross_valid_method ? _refine.details '159400 REFLECTIONS USED IN REFINEMENT USING SEPARATED FRIEDEL PAIRS' _refine.pdbx_starting_model 'PDB ENTRY 3ZQW' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.21 _refine.pdbx_overall_phase_error 10.62 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1187 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 311 _refine_hist.number_atoms_total 1520 _refine_hist.d_res_high 1.001 _refine_hist.d_res_low 44.426 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.011 ? ? 1369 'X-RAY DIFFRACTION' ? f_angle_d 1.402 ? ? 1877 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.715 ? ? 479 'X-RAY DIFFRACTION' ? f_chiral_restr 0.101 ? ? 195 'X-RAY DIFFRACTION' ? f_plane_restr 0.009 ? ? 249 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.0011 1.0137 4611 0.3467 77.00 0.3591 . . 112 . . 'X-RAY DIFFRACTION' . 1.0137 1.0271 5144 0.2981 88.00 0.2730 . . 121 . . 'X-RAY DIFFRACTION' . 1.0271 1.0411 5454 0.2569 93.00 0.2818 . . 134 . . 'X-RAY DIFFRACTION' . 1.0411 1.0560 5677 0.2206 96.00 0.2439 . . 135 . . 'X-RAY DIFFRACTION' . 1.0560 1.0718 5816 0.1878 99.00 0.1812 . . 141 . . 'X-RAY DIFFRACTION' . 1.0718 1.0885 5796 0.1483 99.00 0.1698 . . 138 . . 'X-RAY DIFFRACTION' . 1.0885 1.1064 5806 0.1306 99.00 0.1426 . . 137 . . 'X-RAY DIFFRACTION' . 1.1064 1.1255 5852 0.1211 99.00 0.1471 . . 136 . . 'X-RAY DIFFRACTION' . 1.1255 1.1459 5866 0.1088 99.00 0.1357 . . 135 . . 'X-RAY DIFFRACTION' . 1.1459 1.1680 5839 0.1066 100.00 0.1204 . . 142 . . 'X-RAY DIFFRACTION' . 1.1680 1.1918 5844 0.1016 100.00 0.1307 . . 144 . . 'X-RAY DIFFRACTION' . 1.1918 1.2177 5854 0.1025 100.00 0.1199 . . 144 . . 'X-RAY DIFFRACTION' . 1.2177 1.2461 5850 0.1004 100.00 0.1172 . . 140 . . 'X-RAY DIFFRACTION' . 1.2461 1.2772 5857 0.1010 100.00 0.1054 . . 143 . . 'X-RAY DIFFRACTION' . 1.2772 1.3118 5886 0.1001 100.00 0.1265 . . 141 . . 'X-RAY DIFFRACTION' . 1.3118 1.3504 5904 0.0988 100.00 0.1164 . . 144 . . 'X-RAY DIFFRACTION' . 1.3504 1.3940 5850 0.0975 100.00 0.1044 . . 138 . . 'X-RAY DIFFRACTION' . 1.3940 1.4438 5848 0.0956 100.00 0.1043 . . 137 . . 'X-RAY DIFFRACTION' . 1.4438 1.5016 5942 0.0928 100.00 0.1110 . . 139 . . 'X-RAY DIFFRACTION' . 1.5016 1.5699 5823 0.0938 100.00 0.1188 . . 139 . . 'X-RAY DIFFRACTION' . 1.5699 1.6527 5911 0.0929 100.00 0.1212 . . 138 . . 'X-RAY DIFFRACTION' . 1.6527 1.7563 5883 0.1000 100.00 0.1053 . . 143 . . 'X-RAY DIFFRACTION' . 1.7563 1.8919 5850 0.1031 100.00 0.1159 . . 140 . . 'X-RAY DIFFRACTION' . 1.8919 2.0822 5890 0.1049 100.00 0.1310 . . 136 . . 'X-RAY DIFFRACTION' . 2.0822 2.3835 5871 0.1174 100.00 0.1103 . . 135 . . 'X-RAY DIFFRACTION' . 2.3835 3.0029 5861 0.1375 100.00 0.1621 . . 146 . . 'X-RAY DIFFRACTION' . 3.0029 44.4700 5896 0.1590 100.00 0.1493 . . 141 . . # _struct.entry_id 3ZUC _struct.title ;Structure of CBM3b of major scaffoldin subunit ScaA from Acetivibrio cellulolyticus determined from the crystals grown in the presence of Nickel ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3ZUC _struct_keywords.pdbx_keywords 'CRYSTALLINE CELLULOSE-BINDING PROTEIN' _struct_keywords.text 'CRYSTALLINE CELLULOSE-BINDING PROTEIN, SUGAR BINDING PROTEIN, CELLULOSOME' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 65 ? SER A 67 ? GLY A 65 SER A 67 5 ? 3 HELX_P HELX_P2 2 SER A 93 ? ALA A 95 ? SER A 93 ALA A 95 5 ? 3 HELX_P HELX_P3 3 ALA A 121 ? ASP A 123 ? ALA A 121 ASP A 123 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 3 ND1 ? ? ? 1_555 D NI . NI ? ? A HIS 3 A NI 1156 1_555 ? ? ? ? ? ? ? 1.948 ? ? metalc2 metalc ? ? A THR 48 O ? ? ? 1_555 B CA . CA ? ? A THR 48 A CA 1154 1_555 ? ? ? ? ? ? ? 2.486 ? ? metalc3 metalc ? ? A THR 48 OG1 ? ? ? 1_555 B CA . CA ? ? A THR 48 A CA 1154 1_555 ? ? ? ? ? ? ? 2.388 ? ? metalc4 metalc ? ? A ASP 50 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 50 A CA 1154 1_555 ? ? ? ? ? ? ? 2.315 ? ? metalc5 metalc ? ? A ASN 119 O ? ? ? 1_555 B CA . CA ? ? A ASN 119 A CA 1154 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc6 metalc ? ? A ASP 122 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 122 A CA 1154 1_555 ? ? ? ? ? ? ? 2.412 ? ? metalc7 metalc ? ? A ASP 123 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 123 A CA 1154 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc8 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1154 A HOH 2152 1_555 ? ? ? ? ? ? ? 2.469 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 77 A . ? ASN 77 A PRO 78 A ? PRO 78 A 1 -6.49 2 ASN 77 A . ? ASN 77 A PRO 78 A ? PRO 78 A 1 5.13 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 2 ? AC ? 2 ? AD ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel AD 1 2 ? anti-parallel AD 2 3 ? anti-parallel AD 3 4 ? anti-parallel AD 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLN A 55 ? TRP A 61 ? GLN A 55 TRP A 61 AA 2 THR A 102 ? LYS A 112 ? THR A 102 LYS A 112 AA 3 PRO A 24 ? ASN A 30 ? PRO A 24 ASN A 30 AA 4 LEU A 6 ? ASN A 12 ? LEU A 6 ASN A 12 AA 5 THR A 134 ? SER A 135 ? THR A 134 SER A 135 AB 1 GLN A 18 ? SER A 19 ? GLN A 18 SER A 19 AB 2 TYR A 118 ? ASN A 119 ? TYR A 118 ASN A 119 AC 1 ILE A 36 ? ASN A 37 ? ILE A 36 ASN A 37 AC 2 THR A 97 ? LEU A 98 ? THR A 97 LEU A 98 AD 1 VAL A 69 ? THR A 80 ? VAL A 69 THR A 80 AD 2 ALA A 83 ? PHE A 91 ? ALA A 83 PHE A 91 AD 3 LYS A 42 ? PHE A 47 ? LYS A 42 PHE A 47 AD 4 THR A 140 ? SER A 143 ? THR A 140 SER A 143 AD 5 GLY A 146 ? TRP A 149 ? GLY A 146 TRP A 149 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ASP A 60 ? N ASP A 60 O GLN A 107 ? O GLN A 107 AA 2 3 N GLY A 108 ? N GLY A 108 O PRO A 24 ? O PRO A 24 AA 3 4 N THR A 29 ? N THR A 29 O LYS A 7 ? O LYS A 7 AA 4 5 N PHE A 10 ? N PHE A 10 O THR A 134 ? O THR A 134 AB 1 2 N SER A 19 ? N SER A 19 O TYR A 118 ? O TYR A 118 AC 1 2 N ILE A 36 ? N ILE A 36 O LEU A 98 ? O LEU A 98 AD 1 2 N THR A 80 ? N THR A 80 O ALA A 83 ? O ALA A 83 AD 2 3 N ILE A 89 ? N ILE A 89 O LEU A 43 ? O LEU A 43 AD 3 4 N HIS A 44 ? N HIS A 44 O THR A 140 ? O THR A 140 AD 4 5 N SER A 143 ? N SER A 143 O GLY A 146 ? O GLY A 146 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 1154 ? 6 'BINDING SITE FOR RESIDUE CA A 1154' AC2 Software A EDO 1155 ? 7 'BINDING SITE FOR RESIDUE EDO A 1155' AC3 Software A NI 1156 ? 5 'BINDING SITE FOR RESIDUE NI A 1156' AC4 Software A 1PE 1157 ? 8 'BINDING SITE FOR RESIDUE 1PE A 1157' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 THR A 48 ? THR A 48 . ? 1_555 ? 2 AC1 6 ASP A 50 ? ASP A 50 . ? 1_555 ? 3 AC1 6 ASN A 119 ? ASN A 119 . ? 1_555 ? 4 AC1 6 ASP A 122 ? ASP A 122 . ? 1_555 ? 5 AC1 6 ASP A 123 ? ASP A 123 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 2152 . ? 1_555 ? 7 AC2 7 HIS A 44 ? HIS A 44 . ? 1_555 ? 8 AC2 7 TYR A 46 ? TYR A 46 . ? 1_555 ? 9 AC2 7 TYR A 86 ? TYR A 86 . ? 1_555 ? 10 AC2 7 TYR A 142 ? TYR A 142 . ? 1_555 ? 11 AC2 7 GLU A 152 ? GLU A 152 . ? 1_555 ? 12 AC2 7 HOH F . ? HOH A 2306 . ? 8_675 ? 13 AC2 7 HOH F . ? HOH A 2310 . ? 1_555 ? 14 AC3 5 GLY A 1 ? GLY A 1 . ? 1_555 ? 15 AC3 5 SER A 2 ? SER A 2 . ? 1_555 ? 16 AC3 5 HIS A 3 ? HIS A 3 . ? 1_555 ? 17 AC3 5 MET A 4 ? MET A 4 . ? 1_555 ? 18 AC3 5 GLU A 145 ? GLU A 145 . ? 10_664 ? 19 AC4 8 LYS A 42 ? LYS A 42 . ? 1_555 ? 20 AC4 8 LYS A 42 ? LYS A 42 . ? 8_675 ? 21 AC4 8 TYR A 142 ? TYR A 142 . ? 8_675 ? 22 AC4 8 SER A 143 ? SER A 143 . ? 1_555 ? 23 AC4 8 HOH F . ? HOH A 2230 . ? 8_675 ? 24 AC4 8 HOH F . ? HOH A 2230 . ? 1_555 ? 25 AC4 8 HOH F . ? HOH A 2311 . ? 8_675 ? 26 AC4 8 HOH F . ? HOH A 2311 . ? 1_555 ? # _database_PDB_matrix.entry_id 3ZUC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3ZUC _atom_sites.fract_transf_matrix[1][1] 0.018976 _atom_sites.fract_transf_matrix[1][2] 0.010956 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021912 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005150 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 TRP 58 58 58 TRP TRP A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 SER 135 135 135 SER SER A . n A 1 136 TRP 136 136 136 TRP TRP A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 TYR 142 142 142 TYR TYR A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 TRP 149 149 149 TRP TRP A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 PRO 153 153 153 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 1154 1154 CA CA A . C 3 EDO 1 1155 1155 EDO EDO A . D 4 NI 1 1156 1156 NI NI A . E 5 1PE 1 1157 1157 1PE 1PE A . F 6 HOH 1 2001 2001 HOH HOH A . F 6 HOH 2 2002 2002 HOH HOH A . F 6 HOH 3 2003 2003 HOH HOH A . F 6 HOH 4 2004 2004 HOH HOH A . F 6 HOH 5 2005 2005 HOH HOH A . F 6 HOH 6 2006 2006 HOH HOH A . F 6 HOH 7 2007 2007 HOH HOH A . F 6 HOH 8 2008 2008 HOH HOH A . F 6 HOH 9 2009 2009 HOH HOH A . F 6 HOH 10 2010 2010 HOH HOH A . F 6 HOH 11 2011 2011 HOH HOH A . F 6 HOH 12 2012 2012 HOH HOH A . F 6 HOH 13 2013 2013 HOH HOH A . F 6 HOH 14 2014 2014 HOH HOH A . F 6 HOH 15 2015 2015 HOH HOH A . F 6 HOH 16 2016 2016 HOH HOH A . F 6 HOH 17 2017 2017 HOH HOH A . F 6 HOH 18 2018 2018 HOH HOH A . F 6 HOH 19 2019 2019 HOH HOH A . F 6 HOH 20 2020 2020 HOH HOH A . F 6 HOH 21 2021 2021 HOH HOH A . F 6 HOH 22 2022 2022 HOH HOH A . F 6 HOH 23 2023 2023 HOH HOH A . F 6 HOH 24 2024 2024 HOH HOH A . F 6 HOH 25 2025 2025 HOH HOH A . F 6 HOH 26 2026 2026 HOH HOH A . F 6 HOH 27 2027 2027 HOH HOH A . F 6 HOH 28 2028 2028 HOH HOH A . F 6 HOH 29 2029 2029 HOH HOH A . F 6 HOH 30 2030 2030 HOH HOH A . F 6 HOH 31 2031 2031 HOH HOH A . F 6 HOH 32 2032 2032 HOH HOH A . F 6 HOH 33 2033 2033 HOH HOH A . F 6 HOH 34 2034 2034 HOH HOH A . F 6 HOH 35 2035 2035 HOH HOH A . F 6 HOH 36 2036 2036 HOH HOH A . F 6 HOH 37 2037 2037 HOH HOH A . F 6 HOH 38 2038 2038 HOH HOH A . F 6 HOH 39 2039 2039 HOH HOH A . F 6 HOH 40 2040 2040 HOH HOH A . F 6 HOH 41 2041 2041 HOH HOH A . F 6 HOH 42 2042 2042 HOH HOH A . F 6 HOH 43 2043 2043 HOH HOH A . F 6 HOH 44 2044 2044 HOH HOH A . F 6 HOH 45 2045 2045 HOH HOH A . F 6 HOH 46 2046 2046 HOH HOH A . F 6 HOH 47 2047 2047 HOH HOH A . F 6 HOH 48 2048 2048 HOH HOH A . F 6 HOH 49 2049 2049 HOH HOH A . F 6 HOH 50 2050 2050 HOH HOH A . F 6 HOH 51 2051 2051 HOH HOH A . F 6 HOH 52 2052 2052 HOH HOH A . F 6 HOH 53 2053 2053 HOH HOH A . F 6 HOH 54 2054 2054 HOH HOH A . F 6 HOH 55 2055 2055 HOH HOH A . F 6 HOH 56 2056 2056 HOH HOH A . F 6 HOH 57 2057 2057 HOH HOH A . F 6 HOH 58 2058 2058 HOH HOH A . F 6 HOH 59 2059 2059 HOH HOH A . F 6 HOH 60 2060 2060 HOH HOH A . F 6 HOH 61 2061 2061 HOH HOH A . F 6 HOH 62 2062 2062 HOH HOH A . F 6 HOH 63 2063 2063 HOH HOH A . F 6 HOH 64 2064 2064 HOH HOH A . F 6 HOH 65 2065 2065 HOH HOH A . F 6 HOH 66 2066 2066 HOH HOH A . F 6 HOH 67 2067 2067 HOH HOH A . F 6 HOH 68 2068 2068 HOH HOH A . F 6 HOH 69 2069 2069 HOH HOH A . F 6 HOH 70 2070 2070 HOH HOH A . F 6 HOH 71 2071 2071 HOH HOH A . F 6 HOH 72 2072 2072 HOH HOH A . F 6 HOH 73 2073 2073 HOH HOH A . F 6 HOH 74 2074 2074 HOH HOH A . F 6 HOH 75 2075 2075 HOH HOH A . F 6 HOH 76 2076 2076 HOH HOH A . F 6 HOH 77 2077 2077 HOH HOH A . F 6 HOH 78 2078 2078 HOH HOH A . F 6 HOH 79 2079 2079 HOH HOH A . F 6 HOH 80 2080 2080 HOH HOH A . F 6 HOH 81 2081 2081 HOH HOH A . F 6 HOH 82 2082 2082 HOH HOH A . F 6 HOH 83 2083 2083 HOH HOH A . F 6 HOH 84 2084 2084 HOH HOH A . F 6 HOH 85 2085 2085 HOH HOH A . F 6 HOH 86 2086 2086 HOH HOH A . F 6 HOH 87 2087 2087 HOH HOH A . F 6 HOH 88 2088 2088 HOH HOH A . F 6 HOH 89 2089 2089 HOH HOH A . F 6 HOH 90 2090 2090 HOH HOH A . F 6 HOH 91 2091 2091 HOH HOH A . F 6 HOH 92 2092 2092 HOH HOH A . F 6 HOH 93 2093 2093 HOH HOH A . F 6 HOH 94 2094 2094 HOH HOH A . F 6 HOH 95 2095 2095 HOH HOH A . F 6 HOH 96 2096 2096 HOH HOH A . F 6 HOH 97 2097 2097 HOH HOH A . F 6 HOH 98 2098 2098 HOH HOH A . F 6 HOH 99 2099 2099 HOH HOH A . F 6 HOH 100 2100 2100 HOH HOH A . F 6 HOH 101 2101 2101 HOH HOH A . F 6 HOH 102 2102 2102 HOH HOH A . F 6 HOH 103 2103 2103 HOH HOH A . F 6 HOH 104 2104 2104 HOH HOH A . F 6 HOH 105 2105 2105 HOH HOH A . F 6 HOH 106 2106 2106 HOH HOH A . F 6 HOH 107 2107 2107 HOH HOH A . F 6 HOH 108 2108 2108 HOH HOH A . F 6 HOH 109 2109 2109 HOH HOH A . F 6 HOH 110 2110 2110 HOH HOH A . F 6 HOH 111 2111 2111 HOH HOH A . F 6 HOH 112 2112 2112 HOH HOH A . F 6 HOH 113 2113 2113 HOH HOH A . F 6 HOH 114 2114 2114 HOH HOH A . F 6 HOH 115 2115 2115 HOH HOH A . F 6 HOH 116 2116 2116 HOH HOH A . F 6 HOH 117 2117 2117 HOH HOH A . F 6 HOH 118 2118 2118 HOH HOH A . F 6 HOH 119 2119 2119 HOH HOH A . F 6 HOH 120 2120 2120 HOH HOH A . F 6 HOH 121 2121 2121 HOH HOH A . F 6 HOH 122 2122 2122 HOH HOH A . F 6 HOH 123 2123 2123 HOH HOH A . F 6 HOH 124 2124 2124 HOH HOH A . F 6 HOH 125 2125 2125 HOH HOH A . F 6 HOH 126 2126 2126 HOH HOH A . F 6 HOH 127 2127 2127 HOH HOH A . F 6 HOH 128 2128 2128 HOH HOH A . F 6 HOH 129 2129 2129 HOH HOH A . F 6 HOH 130 2130 2130 HOH HOH A . F 6 HOH 131 2131 2131 HOH HOH A . F 6 HOH 132 2132 2132 HOH HOH A . F 6 HOH 133 2133 2133 HOH HOH A . F 6 HOH 134 2134 2134 HOH HOH A . F 6 HOH 135 2135 2135 HOH HOH A . F 6 HOH 136 2136 2136 HOH HOH A . F 6 HOH 137 2137 2137 HOH HOH A . F 6 HOH 138 2138 2138 HOH HOH A . F 6 HOH 139 2139 2139 HOH HOH A . F 6 HOH 140 2140 2140 HOH HOH A . F 6 HOH 141 2141 2141 HOH HOH A . F 6 HOH 142 2142 2142 HOH HOH A . F 6 HOH 143 2143 2143 HOH HOH A . F 6 HOH 144 2144 2144 HOH HOH A . F 6 HOH 145 2145 2145 HOH HOH A . F 6 HOH 146 2146 2146 HOH HOH A . F 6 HOH 147 2147 2147 HOH HOH A . F 6 HOH 148 2148 2148 HOH HOH A . F 6 HOH 149 2149 2149 HOH HOH A . F 6 HOH 150 2150 2150 HOH HOH A . F 6 HOH 151 2151 2151 HOH HOH A . F 6 HOH 152 2152 2152 HOH HOH A . F 6 HOH 153 2153 2153 HOH HOH A . F 6 HOH 154 2154 2154 HOH HOH A . F 6 HOH 155 2155 2155 HOH HOH A . F 6 HOH 156 2156 2156 HOH HOH A . F 6 HOH 157 2157 2157 HOH HOH A . F 6 HOH 158 2158 2158 HOH HOH A . F 6 HOH 159 2159 2159 HOH HOH A . F 6 HOH 160 2160 2160 HOH HOH A . F 6 HOH 161 2161 2161 HOH HOH A . F 6 HOH 162 2162 2162 HOH HOH A . F 6 HOH 163 2163 2163 HOH HOH A . F 6 HOH 164 2164 2164 HOH HOH A . F 6 HOH 165 2165 2165 HOH HOH A . F 6 HOH 166 2166 2166 HOH HOH A . F 6 HOH 167 2167 2167 HOH HOH A . F 6 HOH 168 2168 2168 HOH HOH A . F 6 HOH 169 2169 2169 HOH HOH A . F 6 HOH 170 2170 2170 HOH HOH A . F 6 HOH 171 2171 2171 HOH HOH A . F 6 HOH 172 2172 2172 HOH HOH A . F 6 HOH 173 2173 2173 HOH HOH A . F 6 HOH 174 2174 2174 HOH HOH A . F 6 HOH 175 2175 2175 HOH HOH A . F 6 HOH 176 2176 2176 HOH HOH A . F 6 HOH 177 2177 2177 HOH HOH A . F 6 HOH 178 2178 2178 HOH HOH A . F 6 HOH 179 2179 2179 HOH HOH A . F 6 HOH 180 2180 2180 HOH HOH A . F 6 HOH 181 2181 2181 HOH HOH A . F 6 HOH 182 2182 2182 HOH HOH A . F 6 HOH 183 2183 2183 HOH HOH A . F 6 HOH 184 2184 2184 HOH HOH A . F 6 HOH 185 2185 2185 HOH HOH A . F 6 HOH 186 2186 2186 HOH HOH A . F 6 HOH 187 2187 2187 HOH HOH A . F 6 HOH 188 2188 2188 HOH HOH A . F 6 HOH 189 2189 2189 HOH HOH A . F 6 HOH 190 2190 2190 HOH HOH A . F 6 HOH 191 2191 2191 HOH HOH A . F 6 HOH 192 2192 2192 HOH HOH A . F 6 HOH 193 2193 2193 HOH HOH A . F 6 HOH 194 2194 2194 HOH HOH A . F 6 HOH 195 2195 2195 HOH HOH A . F 6 HOH 196 2196 2196 HOH HOH A . F 6 HOH 197 2197 2197 HOH HOH A . F 6 HOH 198 2198 2198 HOH HOH A . F 6 HOH 199 2199 2199 HOH HOH A . F 6 HOH 200 2200 2200 HOH HOH A . F 6 HOH 201 2201 2201 HOH HOH A . F 6 HOH 202 2202 2202 HOH HOH A . F 6 HOH 203 2203 2203 HOH HOH A . F 6 HOH 204 2204 2204 HOH HOH A . F 6 HOH 205 2205 2205 HOH HOH A . F 6 HOH 206 2206 2206 HOH HOH A . F 6 HOH 207 2207 2207 HOH HOH A . F 6 HOH 208 2208 2208 HOH HOH A . F 6 HOH 209 2209 2209 HOH HOH A . F 6 HOH 210 2210 2210 HOH HOH A . F 6 HOH 211 2211 2211 HOH HOH A . F 6 HOH 212 2212 2212 HOH HOH A . F 6 HOH 213 2213 2213 HOH HOH A . F 6 HOH 214 2214 2214 HOH HOH A . F 6 HOH 215 2215 2215 HOH HOH A . F 6 HOH 216 2216 2216 HOH HOH A . F 6 HOH 217 2217 2217 HOH HOH A . F 6 HOH 218 2218 2218 HOH HOH A . F 6 HOH 219 2219 2219 HOH HOH A . F 6 HOH 220 2220 2220 HOH HOH A . F 6 HOH 221 2221 2221 HOH HOH A . F 6 HOH 222 2222 2222 HOH HOH A . F 6 HOH 223 2223 2223 HOH HOH A . F 6 HOH 224 2224 2224 HOH HOH A . F 6 HOH 225 2225 2225 HOH HOH A . F 6 HOH 226 2226 2226 HOH HOH A . F 6 HOH 227 2227 2227 HOH HOH A . F 6 HOH 228 2228 2228 HOH HOH A . F 6 HOH 229 2229 2229 HOH HOH A . F 6 HOH 230 2230 2230 HOH HOH A . F 6 HOH 231 2231 2231 HOH HOH A . F 6 HOH 232 2232 2232 HOH HOH A . F 6 HOH 233 2233 2233 HOH HOH A . F 6 HOH 234 2234 2234 HOH HOH A . F 6 HOH 235 2235 2235 HOH HOH A . F 6 HOH 236 2236 2236 HOH HOH A . F 6 HOH 237 2237 2237 HOH HOH A . F 6 HOH 238 2238 2238 HOH HOH A . F 6 HOH 239 2239 2239 HOH HOH A . F 6 HOH 240 2240 2240 HOH HOH A . F 6 HOH 241 2241 2241 HOH HOH A . F 6 HOH 242 2242 2242 HOH HOH A . F 6 HOH 243 2243 2243 HOH HOH A . F 6 HOH 244 2244 2244 HOH HOH A . F 6 HOH 245 2245 2245 HOH HOH A . F 6 HOH 246 2246 2246 HOH HOH A . F 6 HOH 247 2247 2247 HOH HOH A . F 6 HOH 248 2248 2248 HOH HOH A . F 6 HOH 249 2249 2249 HOH HOH A . F 6 HOH 250 2250 2250 HOH HOH A . F 6 HOH 251 2251 2251 HOH HOH A . F 6 HOH 252 2252 2252 HOH HOH A . F 6 HOH 253 2253 2253 HOH HOH A . F 6 HOH 254 2254 2254 HOH HOH A . F 6 HOH 255 2255 2255 HOH HOH A . F 6 HOH 256 2256 2256 HOH HOH A . F 6 HOH 257 2257 2257 HOH HOH A . F 6 HOH 258 2258 2258 HOH HOH A . F 6 HOH 259 2259 2259 HOH HOH A . F 6 HOH 260 2260 2260 HOH HOH A . F 6 HOH 261 2261 2261 HOH HOH A . F 6 HOH 262 2262 2262 HOH HOH A . F 6 HOH 263 2263 2263 HOH HOH A . F 6 HOH 264 2264 2264 HOH HOH A . F 6 HOH 265 2265 2265 HOH HOH A . F 6 HOH 266 2266 2266 HOH HOH A . F 6 HOH 267 2267 2267 HOH HOH A . F 6 HOH 268 2268 2268 HOH HOH A . F 6 HOH 269 2269 2269 HOH HOH A . F 6 HOH 270 2270 2270 HOH HOH A . F 6 HOH 271 2271 2271 HOH HOH A . F 6 HOH 272 2272 2272 HOH HOH A . F 6 HOH 273 2273 2273 HOH HOH A . F 6 HOH 274 2274 2274 HOH HOH A . F 6 HOH 275 2275 2275 HOH HOH A . F 6 HOH 276 2276 2276 HOH HOH A . F 6 HOH 277 2277 2277 HOH HOH A . F 6 HOH 278 2278 2278 HOH HOH A . F 6 HOH 279 2279 2279 HOH HOH A . F 6 HOH 280 2280 2280 HOH HOH A . F 6 HOH 281 2281 2281 HOH HOH A . F 6 HOH 282 2282 2282 HOH HOH A . F 6 HOH 283 2283 2283 HOH HOH A . F 6 HOH 284 2284 2284 HOH HOH A . F 6 HOH 285 2285 2285 HOH HOH A . F 6 HOH 286 2286 2286 HOH HOH A . F 6 HOH 287 2287 2287 HOH HOH A . F 6 HOH 288 2288 2288 HOH HOH A . F 6 HOH 289 2289 2289 HOH HOH A . F 6 HOH 290 2290 2290 HOH HOH A . F 6 HOH 291 2291 2291 HOH HOH A . F 6 HOH 292 2292 2292 HOH HOH A . F 6 HOH 293 2293 2293 HOH HOH A . F 6 HOH 294 2294 2294 HOH HOH A . F 6 HOH 295 2295 2295 HOH HOH A . F 6 HOH 296 2296 2296 HOH HOH A . F 6 HOH 297 2297 2297 HOH HOH A . F 6 HOH 298 2298 2298 HOH HOH A . F 6 HOH 299 2299 2299 HOH HOH A . F 6 HOH 300 2300 2300 HOH HOH A . F 6 HOH 301 2301 2301 HOH HOH A . F 6 HOH 302 2302 2302 HOH HOH A . F 6 HOH 303 2303 2303 HOH HOH A . F 6 HOH 304 2304 2304 HOH HOH A . F 6 HOH 305 2305 2305 HOH HOH A . F 6 HOH 306 2306 2306 HOH HOH A . F 6 HOH 307 2307 2307 HOH HOH A . F 6 HOH 308 2308 2308 HOH HOH A . F 6 HOH 309 2309 2309 HOH HOH A . F 6 HOH 310 2310 2310 HOH HOH A . F 6 HOH 311 2311 2311 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2101 ? F HOH . 2 1 A HOH 2311 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OG1 ? A THR 48 ? A THR 48 ? 1_555 71.6 ? 2 O ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 82.0 ? 3 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 99.2 ? 4 O ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? A ASN 119 ? A ASN 119 ? 1_555 141.6 ? 5 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? A ASN 119 ? A ASN 119 ? 1_555 146.6 ? 6 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? A ASN 119 ? A ASN 119 ? 1_555 85.8 ? 7 O ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 144.6 ? 8 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 73.5 ? 9 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 109.4 ? 10 O ? A ASN 119 ? A ASN 119 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 73.7 ? 11 O ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 86.9 ? 12 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 86.6 ? 13 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 165.1 ? 14 O ? A ASN 119 ? A ASN 119 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 96.9 ? 15 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 85.4 ? 16 O ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2152 ? 1_555 69.0 ? 17 OG1 ? A THR 48 ? A THR 48 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2152 ? 1_555 138.0 ? 18 OD2 ? A ASP 50 ? A ASP 50 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2152 ? 1_555 89.1 ? 19 O ? A ASN 119 ? A ASN 119 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2152 ? 1_555 74.6 ? 20 OD1 ? A ASP 122 ? A ASP 122 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2152 ? 1_555 141.6 ? 21 OD1 ? A ASP 123 ? A ASP 123 ? 1_555 CA ? B CA . ? A CA 1154 ? 1_555 O ? F HOH . ? A HOH 2152 ? 1_555 77.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-01-11 2 'Structure model' 1 1 2012-04-11 3 'Structure model' 1 2 2017-03-29 4 'Structure model' 2 0 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Other 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status 6 4 'Structure model' pdbx_initial_refinement_model 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' pdbx_struct_special_symmetry 9 4 'Structure model' struct_conn 10 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_sf' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.value' 21 4 'Structure model' '_struct_conn.pdbx_dist_value' 22 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 34 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 35 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 36 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 MOSFLM 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 MOLREP phasing . ? 4 # _pdbx_entry_details.entry_id 3ZUC _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;NICKEL (II) ION (NI): CRYSTALS WERE GROWN IN THE PRESENCE OF NICKEL IONS ; _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2010 ? ? O A HOH 2011 ? ? 1.77 2 1 OD1 A ASN 77 ? B O A HOH 2209 ? ? 1.86 3 1 OG1 A THR 132 ? ? O A HOH 2285 ? ? 1.98 4 1 O A HOH 2158 ? ? O A HOH 2160 ? ? 1.99 5 1 O A HOH 2014 ? ? O A HOH 2017 ? ? 2.02 6 1 OG A SER 135 ? A O A HOH 2034 ? ? 2.02 7 1 O A HOH 2139 ? ? O A HOH 2140 ? ? 2.04 8 1 O A HOH 2153 ? ? O A HOH 2162 ? ? 2.07 9 1 O A HOH 2042 ? ? O A HOH 2043 ? ? 2.07 10 1 O A HOH 2285 ? ? O A HOH 2288 ? ? 2.08 11 1 O A HOH 2071 ? ? O A HOH 2263 ? ? 2.08 12 1 O A HIS 3 ? ? O A HOH 2017 ? ? 2.12 13 1 O A HOH 2080 ? ? O A HOH 2081 ? ? 2.14 14 1 O A HOH 2153 ? ? O A HOH 2164 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 2054 ? ? 1_555 O A HOH 2054 ? ? 8_675 1.79 2 1 O A HOH 2168 ? ? 1_555 O A HOH 2208 ? ? 12_575 1.83 3 1 O A HOH 2218 ? ? 1_555 O A HOH 2218 ? ? 12_575 1.90 4 1 O A HOH 2213 ? ? 1_555 O A HOH 2301 ? ? 8_675 2.00 5 1 O A HOH 2239 ? ? 1_555 O A HOH 2286 ? ? 8_665 2.07 6 1 O A HOH 2068 ? ? 1_555 O A HOH 2207 ? ? 12_575 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -171.98 1.48 2 1 ARG A 109 ? B -173.20 142.62 3 1 SER A 143 ? ? -114.05 -168.56 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 108 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 B _pdbx_validate_peptide_omega.auth_comp_id_2 ARG _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 109 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 B _pdbx_validate_peptide_omega.omega -147.41 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2127 ? 6.36 . 2 1 O ? A HOH 2128 ? 6.71 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 1PE OH2 O N N 1 1PE C12 C N N 2 1PE C22 C N N 3 1PE OH3 O N N 4 1PE C13 C N N 5 1PE C23 C N N 6 1PE OH4 O N N 7 1PE C14 C N N 8 1PE C24 C N N 9 1PE OH5 O N N 10 1PE C15 C N N 11 1PE C25 C N N 12 1PE OH6 O N N 13 1PE C16 C N N 14 1PE C26 C N N 15 1PE OH7 O N N 16 1PE HO2 H N N 17 1PE H121 H N N 18 1PE H122 H N N 19 1PE H221 H N N 20 1PE H222 H N N 21 1PE H131 H N N 22 1PE H132 H N N 23 1PE H231 H N N 24 1PE H232 H N N 25 1PE H141 H N N 26 1PE H142 H N N 27 1PE H241 H N N 28 1PE H242 H N N 29 1PE H151 H N N 30 1PE H152 H N N 31 1PE H251 H N N 32 1PE H252 H N N 33 1PE H161 H N N 34 1PE H162 H N N 35 1PE H261 H N N 36 1PE H262 H N N 37 1PE HO7 H N N 38 ALA N N N N 39 ALA CA C N S 40 ALA C C N N 41 ALA O O N N 42 ALA CB C N N 43 ALA OXT O N N 44 ALA H H N N 45 ALA H2 H N N 46 ALA HA H N N 47 ALA HB1 H N N 48 ALA HB2 H N N 49 ALA HB3 H N N 50 ALA HXT H N N 51 ARG N N N N 52 ARG CA C N S 53 ARG C C N N 54 ARG O O N N 55 ARG CB C N N 56 ARG CG C N N 57 ARG CD C N N 58 ARG NE N N N 59 ARG CZ C N N 60 ARG NH1 N N N 61 ARG NH2 N N N 62 ARG OXT O N N 63 ARG H H N N 64 ARG H2 H N N 65 ARG HA H N N 66 ARG HB2 H N N 67 ARG HB3 H N N 68 ARG HG2 H N N 69 ARG HG3 H N N 70 ARG HD2 H N N 71 ARG HD3 H N N 72 ARG HE H N N 73 ARG HH11 H N N 74 ARG HH12 H N N 75 ARG HH21 H N N 76 ARG HH22 H N N 77 ARG HXT H N N 78 ASN N N N N 79 ASN CA C N S 80 ASN C C N N 81 ASN O O N N 82 ASN CB C N N 83 ASN CG C N N 84 ASN OD1 O N N 85 ASN ND2 N N N 86 ASN OXT O N N 87 ASN H H N N 88 ASN H2 H N N 89 ASN HA H N N 90 ASN HB2 H N N 91 ASN HB3 H N N 92 ASN HD21 H N N 93 ASN HD22 H N N 94 ASN HXT H N N 95 ASP N N N N 96 ASP CA C N S 97 ASP C C N N 98 ASP O O N N 99 ASP CB C N N 100 ASP CG C N N 101 ASP OD1 O N N 102 ASP OD2 O N N 103 ASP OXT O N N 104 ASP H H N N 105 ASP H2 H N N 106 ASP HA H N N 107 ASP HB2 H N N 108 ASP HB3 H N N 109 ASP HD2 H N N 110 ASP HXT H N N 111 CA CA CA N N 112 CYS N N N N 113 CYS CA C N R 114 CYS C C N N 115 CYS O O N N 116 CYS CB C N N 117 CYS SG S N N 118 CYS OXT O N N 119 CYS H H N N 120 CYS H2 H N N 121 CYS HA H N N 122 CYS HB2 H N N 123 CYS HB3 H N N 124 CYS HG H N N 125 CYS HXT H N N 126 EDO C1 C N N 127 EDO O1 O N N 128 EDO C2 C N N 129 EDO O2 O N N 130 EDO H11 H N N 131 EDO H12 H N N 132 EDO HO1 H N N 133 EDO H21 H N N 134 EDO H22 H N N 135 EDO HO2 H N N 136 GLN N N N N 137 GLN CA C N S 138 GLN C C N N 139 GLN O O N N 140 GLN CB C N N 141 GLN CG C N N 142 GLN CD C N N 143 GLN OE1 O N N 144 GLN NE2 N N N 145 GLN OXT O N N 146 GLN H H N N 147 GLN H2 H N N 148 GLN HA H N N 149 GLN HB2 H N N 150 GLN HB3 H N N 151 GLN HG2 H N N 152 GLN HG3 H N N 153 GLN HE21 H N N 154 GLN HE22 H N N 155 GLN HXT H N N 156 GLU N N N N 157 GLU CA C N S 158 GLU C C N N 159 GLU O O N N 160 GLU CB C N N 161 GLU CG C N N 162 GLU CD C N N 163 GLU OE1 O N N 164 GLU OE2 O N N 165 GLU OXT O N N 166 GLU H H N N 167 GLU H2 H N N 168 GLU HA H N N 169 GLU HB2 H N N 170 GLU HB3 H N N 171 GLU HG2 H N N 172 GLU HG3 H N N 173 GLU HE2 H N N 174 GLU HXT H N N 175 GLY N N N N 176 GLY CA C N N 177 GLY C C N N 178 GLY O O N N 179 GLY OXT O N N 180 GLY H H N N 181 GLY H2 H N N 182 GLY HA2 H N N 183 GLY HA3 H N N 184 GLY HXT H N N 185 HIS N N N N 186 HIS CA C N S 187 HIS C C N N 188 HIS O O N N 189 HIS CB C N N 190 HIS CG C Y N 191 HIS ND1 N Y N 192 HIS CD2 C Y N 193 HIS CE1 C Y N 194 HIS NE2 N Y N 195 HIS OXT O N N 196 HIS H H N N 197 HIS H2 H N N 198 HIS HA H N N 199 HIS HB2 H N N 200 HIS HB3 H N N 201 HIS HD1 H N N 202 HIS HD2 H N N 203 HIS HE1 H N N 204 HIS HE2 H N N 205 HIS HXT H N N 206 HOH O O N N 207 HOH H1 H N N 208 HOH H2 H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 NI NI NI N N 299 PHE N N N N 300 PHE CA C N S 301 PHE C C N N 302 PHE O O N N 303 PHE CB C N N 304 PHE CG C Y N 305 PHE CD1 C Y N 306 PHE CD2 C Y N 307 PHE CE1 C Y N 308 PHE CE2 C Y N 309 PHE CZ C Y N 310 PHE OXT O N N 311 PHE H H N N 312 PHE H2 H N N 313 PHE HA H N N 314 PHE HB2 H N N 315 PHE HB3 H N N 316 PHE HD1 H N N 317 PHE HD2 H N N 318 PHE HE1 H N N 319 PHE HE2 H N N 320 PHE HZ H N N 321 PHE HXT H N N 322 PRO N N N N 323 PRO CA C N S 324 PRO C C N N 325 PRO O O N N 326 PRO CB C N N 327 PRO CG C N N 328 PRO CD C N N 329 PRO OXT O N N 330 PRO H H N N 331 PRO HA H N N 332 PRO HB2 H N N 333 PRO HB3 H N N 334 PRO HG2 H N N 335 PRO HG3 H N N 336 PRO HD2 H N N 337 PRO HD3 H N N 338 PRO HXT H N N 339 SER N N N N 340 SER CA C N S 341 SER C C N N 342 SER O O N N 343 SER CB C N N 344 SER OG O N N 345 SER OXT O N N 346 SER H H N N 347 SER H2 H N N 348 SER HA H N N 349 SER HB2 H N N 350 SER HB3 H N N 351 SER HG H N N 352 SER HXT H N N 353 THR N N N N 354 THR CA C N S 355 THR C C N N 356 THR O O N N 357 THR CB C N R 358 THR OG1 O N N 359 THR CG2 C N N 360 THR OXT O N N 361 THR H H N N 362 THR H2 H N N 363 THR HA H N N 364 THR HB H N N 365 THR HG1 H N N 366 THR HG21 H N N 367 THR HG22 H N N 368 THR HG23 H N N 369 THR HXT H N N 370 TRP N N N N 371 TRP CA C N S 372 TRP C C N N 373 TRP O O N N 374 TRP CB C N N 375 TRP CG C Y N 376 TRP CD1 C Y N 377 TRP CD2 C Y N 378 TRP NE1 N Y N 379 TRP CE2 C Y N 380 TRP CE3 C Y N 381 TRP CZ2 C Y N 382 TRP CZ3 C Y N 383 TRP CH2 C Y N 384 TRP OXT O N N 385 TRP H H N N 386 TRP H2 H N N 387 TRP HA H N N 388 TRP HB2 H N N 389 TRP HB3 H N N 390 TRP HD1 H N N 391 TRP HE1 H N N 392 TRP HE3 H N N 393 TRP HZ2 H N N 394 TRP HZ3 H N N 395 TRP HH2 H N N 396 TRP HXT H N N 397 TYR N N N N 398 TYR CA C N S 399 TYR C C N N 400 TYR O O N N 401 TYR CB C N N 402 TYR CG C Y N 403 TYR CD1 C Y N 404 TYR CD2 C Y N 405 TYR CE1 C Y N 406 TYR CE2 C Y N 407 TYR CZ C Y N 408 TYR OH O N N 409 TYR OXT O N N 410 TYR H H N N 411 TYR H2 H N N 412 TYR HA H N N 413 TYR HB2 H N N 414 TYR HB3 H N N 415 TYR HD1 H N N 416 TYR HD2 H N N 417 TYR HE1 H N N 418 TYR HE2 H N N 419 TYR HH H N N 420 TYR HXT H N N 421 VAL N N N N 422 VAL CA C N S 423 VAL C C N N 424 VAL O O N N 425 VAL CB C N N 426 VAL CG1 C N N 427 VAL CG2 C N N 428 VAL OXT O N N 429 VAL H H N N 430 VAL H2 H N N 431 VAL HA H N N 432 VAL HB H N N 433 VAL HG11 H N N 434 VAL HG12 H N N 435 VAL HG13 H N N 436 VAL HG21 H N N 437 VAL HG22 H N N 438 VAL HG23 H N N 439 VAL HXT H N N 440 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 1PE OH2 C12 sing N N 1 1PE OH2 HO2 sing N N 2 1PE C12 C22 sing N N 3 1PE C12 H121 sing N N 4 1PE C12 H122 sing N N 5 1PE C22 OH3 sing N N 6 1PE C22 H221 sing N N 7 1PE C22 H222 sing N N 8 1PE OH3 C23 sing N N 9 1PE C13 C23 sing N N 10 1PE C13 OH4 sing N N 11 1PE C13 H131 sing N N 12 1PE C13 H132 sing N N 13 1PE C23 H231 sing N N 14 1PE C23 H232 sing N N 15 1PE OH4 C24 sing N N 16 1PE C14 C24 sing N N 17 1PE C14 OH5 sing N N 18 1PE C14 H141 sing N N 19 1PE C14 H142 sing N N 20 1PE C24 H241 sing N N 21 1PE C24 H242 sing N N 22 1PE OH5 C25 sing N N 23 1PE C15 C25 sing N N 24 1PE C15 OH6 sing N N 25 1PE C15 H151 sing N N 26 1PE C15 H152 sing N N 27 1PE C25 H251 sing N N 28 1PE C25 H252 sing N N 29 1PE OH6 C26 sing N N 30 1PE C16 C26 sing N N 31 1PE C16 OH7 sing N N 32 1PE C16 H161 sing N N 33 1PE C16 H162 sing N N 34 1PE C26 H261 sing N N 35 1PE C26 H262 sing N N 36 1PE OH7 HO7 sing N N 37 ALA N CA sing N N 38 ALA N H sing N N 39 ALA N H2 sing N N 40 ALA CA C sing N N 41 ALA CA CB sing N N 42 ALA CA HA sing N N 43 ALA C O doub N N 44 ALA C OXT sing N N 45 ALA CB HB1 sing N N 46 ALA CB HB2 sing N N 47 ALA CB HB3 sing N N 48 ALA OXT HXT sing N N 49 ARG N CA sing N N 50 ARG N H sing N N 51 ARG N H2 sing N N 52 ARG CA C sing N N 53 ARG CA CB sing N N 54 ARG CA HA sing N N 55 ARG C O doub N N 56 ARG C OXT sing N N 57 ARG CB CG sing N N 58 ARG CB HB2 sing N N 59 ARG CB HB3 sing N N 60 ARG CG CD sing N N 61 ARG CG HG2 sing N N 62 ARG CG HG3 sing N N 63 ARG CD NE sing N N 64 ARG CD HD2 sing N N 65 ARG CD HD3 sing N N 66 ARG NE CZ sing N N 67 ARG NE HE sing N N 68 ARG CZ NH1 sing N N 69 ARG CZ NH2 doub N N 70 ARG NH1 HH11 sing N N 71 ARG NH1 HH12 sing N N 72 ARG NH2 HH21 sing N N 73 ARG NH2 HH22 sing N N 74 ARG OXT HXT sing N N 75 ASN N CA sing N N 76 ASN N H sing N N 77 ASN N H2 sing N N 78 ASN CA C sing N N 79 ASN CA CB sing N N 80 ASN CA HA sing N N 81 ASN C O doub N N 82 ASN C OXT sing N N 83 ASN CB CG sing N N 84 ASN CB HB2 sing N N 85 ASN CB HB3 sing N N 86 ASN CG OD1 doub N N 87 ASN CG ND2 sing N N 88 ASN ND2 HD21 sing N N 89 ASN ND2 HD22 sing N N 90 ASN OXT HXT sing N N 91 ASP N CA sing N N 92 ASP N H sing N N 93 ASP N H2 sing N N 94 ASP CA C sing N N 95 ASP CA CB sing N N 96 ASP CA HA sing N N 97 ASP C O doub N N 98 ASP C OXT sing N N 99 ASP CB CG sing N N 100 ASP CB HB2 sing N N 101 ASP CB HB3 sing N N 102 ASP CG OD1 doub N N 103 ASP CG OD2 sing N N 104 ASP OD2 HD2 sing N N 105 ASP OXT HXT sing N N 106 CYS N CA sing N N 107 CYS N H sing N N 108 CYS N H2 sing N N 109 CYS CA C sing N N 110 CYS CA CB sing N N 111 CYS CA HA sing N N 112 CYS C O doub N N 113 CYS C OXT sing N N 114 CYS CB SG sing N N 115 CYS CB HB2 sing N N 116 CYS CB HB3 sing N N 117 CYS SG HG sing N N 118 CYS OXT HXT sing N N 119 EDO C1 O1 sing N N 120 EDO C1 C2 sing N N 121 EDO C1 H11 sing N N 122 EDO C1 H12 sing N N 123 EDO O1 HO1 sing N N 124 EDO C2 O2 sing N N 125 EDO C2 H21 sing N N 126 EDO C2 H22 sing N N 127 EDO O2 HO2 sing N N 128 GLN N CA sing N N 129 GLN N H sing N N 130 GLN N H2 sing N N 131 GLN CA C sing N N 132 GLN CA CB sing N N 133 GLN CA HA sing N N 134 GLN C O doub N N 135 GLN C OXT sing N N 136 GLN CB CG sing N N 137 GLN CB HB2 sing N N 138 GLN CB HB3 sing N N 139 GLN CG CD sing N N 140 GLN CG HG2 sing N N 141 GLN CG HG3 sing N N 142 GLN CD OE1 doub N N 143 GLN CD NE2 sing N N 144 GLN NE2 HE21 sing N N 145 GLN NE2 HE22 sing N N 146 GLN OXT HXT sing N N 147 GLU N CA sing N N 148 GLU N H sing N N 149 GLU N H2 sing N N 150 GLU CA C sing N N 151 GLU CA CB sing N N 152 GLU CA HA sing N N 153 GLU C O doub N N 154 GLU C OXT sing N N 155 GLU CB CG sing N N 156 GLU CB HB2 sing N N 157 GLU CB HB3 sing N N 158 GLU CG CD sing N N 159 GLU CG HG2 sing N N 160 GLU CG HG3 sing N N 161 GLU CD OE1 doub N N 162 GLU CD OE2 sing N N 163 GLU OE2 HE2 sing N N 164 GLU OXT HXT sing N N 165 GLY N CA sing N N 166 GLY N H sing N N 167 GLY N H2 sing N N 168 GLY CA C sing N N 169 GLY CA HA2 sing N N 170 GLY CA HA3 sing N N 171 GLY C O doub N N 172 GLY C OXT sing N N 173 GLY OXT HXT sing N N 174 HIS N CA sing N N 175 HIS N H sing N N 176 HIS N H2 sing N N 177 HIS CA C sing N N 178 HIS CA CB sing N N 179 HIS CA HA sing N N 180 HIS C O doub N N 181 HIS C OXT sing N N 182 HIS CB CG sing N N 183 HIS CB HB2 sing N N 184 HIS CB HB3 sing N N 185 HIS CG ND1 sing Y N 186 HIS CG CD2 doub Y N 187 HIS ND1 CE1 doub Y N 188 HIS ND1 HD1 sing N N 189 HIS CD2 NE2 sing Y N 190 HIS CD2 HD2 sing N N 191 HIS CE1 NE2 sing Y N 192 HIS CE1 HE1 sing N N 193 HIS NE2 HE2 sing N N 194 HIS OXT HXT sing N N 195 HOH O H1 sing N N 196 HOH O H2 sing N N 197 ILE N CA sing N N 198 ILE N H sing N N 199 ILE N H2 sing N N 200 ILE CA C sing N N 201 ILE CA CB sing N N 202 ILE CA HA sing N N 203 ILE C O doub N N 204 ILE C OXT sing N N 205 ILE CB CG1 sing N N 206 ILE CB CG2 sing N N 207 ILE CB HB sing N N 208 ILE CG1 CD1 sing N N 209 ILE CG1 HG12 sing N N 210 ILE CG1 HG13 sing N N 211 ILE CG2 HG21 sing N N 212 ILE CG2 HG22 sing N N 213 ILE CG2 HG23 sing N N 214 ILE CD1 HD11 sing N N 215 ILE CD1 HD12 sing N N 216 ILE CD1 HD13 sing N N 217 ILE OXT HXT sing N N 218 LEU N CA sing N N 219 LEU N H sing N N 220 LEU N H2 sing N N 221 LEU CA C sing N N 222 LEU CA CB sing N N 223 LEU CA HA sing N N 224 LEU C O doub N N 225 LEU C OXT sing N N 226 LEU CB CG sing N N 227 LEU CB HB2 sing N N 228 LEU CB HB3 sing N N 229 LEU CG CD1 sing N N 230 LEU CG CD2 sing N N 231 LEU CG HG sing N N 232 LEU CD1 HD11 sing N N 233 LEU CD1 HD12 sing N N 234 LEU CD1 HD13 sing N N 235 LEU CD2 HD21 sing N N 236 LEU CD2 HD22 sing N N 237 LEU CD2 HD23 sing N N 238 LEU OXT HXT sing N N 239 LYS N CA sing N N 240 LYS N H sing N N 241 LYS N H2 sing N N 242 LYS CA C sing N N 243 LYS CA CB sing N N 244 LYS CA HA sing N N 245 LYS C O doub N N 246 LYS C OXT sing N N 247 LYS CB CG sing N N 248 LYS CB HB2 sing N N 249 LYS CB HB3 sing N N 250 LYS CG CD sing N N 251 LYS CG HG2 sing N N 252 LYS CG HG3 sing N N 253 LYS CD CE sing N N 254 LYS CD HD2 sing N N 255 LYS CD HD3 sing N N 256 LYS CE NZ sing N N 257 LYS CE HE2 sing N N 258 LYS CE HE3 sing N N 259 LYS NZ HZ1 sing N N 260 LYS NZ HZ2 sing N N 261 LYS NZ HZ3 sing N N 262 LYS OXT HXT sing N N 263 MET N CA sing N N 264 MET N H sing N N 265 MET N H2 sing N N 266 MET CA C sing N N 267 MET CA CB sing N N 268 MET CA HA sing N N 269 MET C O doub N N 270 MET C OXT sing N N 271 MET CB CG sing N N 272 MET CB HB2 sing N N 273 MET CB HB3 sing N N 274 MET CG SD sing N N 275 MET CG HG2 sing N N 276 MET CG HG3 sing N N 277 MET SD CE sing N N 278 MET CE HE1 sing N N 279 MET CE HE2 sing N N 280 MET CE HE3 sing N N 281 MET OXT HXT sing N N 282 PHE N CA sing N N 283 PHE N H sing N N 284 PHE N H2 sing N N 285 PHE CA C sing N N 286 PHE CA CB sing N N 287 PHE CA HA sing N N 288 PHE C O doub N N 289 PHE C OXT sing N N 290 PHE CB CG sing N N 291 PHE CB HB2 sing N N 292 PHE CB HB3 sing N N 293 PHE CG CD1 doub Y N 294 PHE CG CD2 sing Y N 295 PHE CD1 CE1 sing Y N 296 PHE CD1 HD1 sing N N 297 PHE CD2 CE2 doub Y N 298 PHE CD2 HD2 sing N N 299 PHE CE1 CZ doub Y N 300 PHE CE1 HE1 sing N N 301 PHE CE2 CZ sing Y N 302 PHE CE2 HE2 sing N N 303 PHE CZ HZ sing N N 304 PHE OXT HXT sing N N 305 PRO N CA sing N N 306 PRO N CD sing N N 307 PRO N H sing N N 308 PRO CA C sing N N 309 PRO CA CB sing N N 310 PRO CA HA sing N N 311 PRO C O doub N N 312 PRO C OXT sing N N 313 PRO CB CG sing N N 314 PRO CB HB2 sing N N 315 PRO CB HB3 sing N N 316 PRO CG CD sing N N 317 PRO CG HG2 sing N N 318 PRO CG HG3 sing N N 319 PRO CD HD2 sing N N 320 PRO CD HD3 sing N N 321 PRO OXT HXT sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TRP N CA sing N N 352 TRP N H sing N N 353 TRP N H2 sing N N 354 TRP CA C sing N N 355 TRP CA CB sing N N 356 TRP CA HA sing N N 357 TRP C O doub N N 358 TRP C OXT sing N N 359 TRP CB CG sing N N 360 TRP CB HB2 sing N N 361 TRP CB HB3 sing N N 362 TRP CG CD1 doub Y N 363 TRP CG CD2 sing Y N 364 TRP CD1 NE1 sing Y N 365 TRP CD1 HD1 sing N N 366 TRP CD2 CE2 doub Y N 367 TRP CD2 CE3 sing Y N 368 TRP NE1 CE2 sing Y N 369 TRP NE1 HE1 sing N N 370 TRP CE2 CZ2 sing Y N 371 TRP CE3 CZ3 doub Y N 372 TRP CE3 HE3 sing N N 373 TRP CZ2 CH2 doub Y N 374 TRP CZ2 HZ2 sing N N 375 TRP CZ3 CH2 sing Y N 376 TRP CZ3 HZ3 sing N N 377 TRP CH2 HH2 sing N N 378 TRP OXT HXT sing N N 379 TYR N CA sing N N 380 TYR N H sing N N 381 TYR N H2 sing N N 382 TYR CA C sing N N 383 TYR CA CB sing N N 384 TYR CA HA sing N N 385 TYR C O doub N N 386 TYR C OXT sing N N 387 TYR CB CG sing N N 388 TYR CB HB2 sing N N 389 TYR CB HB3 sing N N 390 TYR CG CD1 doub Y N 391 TYR CG CD2 sing Y N 392 TYR CD1 CE1 sing Y N 393 TYR CD1 HD1 sing N N 394 TYR CD2 CE2 doub Y N 395 TYR CD2 HD2 sing N N 396 TYR CE1 CZ doub Y N 397 TYR CE1 HE1 sing N N 398 TYR CE2 CZ sing Y N 399 TYR CE2 HE2 sing N N 400 TYR CZ OH sing N N 401 TYR OH HH sing N N 402 TYR OXT HXT sing N N 403 VAL N CA sing N N 404 VAL N H sing N N 405 VAL N H2 sing N N 406 VAL CA C sing N N 407 VAL CA CB sing N N 408 VAL CA HA sing N N 409 VAL C O doub N N 410 VAL C OXT sing N N 411 VAL CB CG1 sing N N 412 VAL CB CG2 sing N N 413 VAL CB HB sing N N 414 VAL CG1 HG11 sing N N 415 VAL CG1 HG12 sing N N 416 VAL CG1 HG13 sing N N 417 VAL CG2 HG21 sing N N 418 VAL CG2 HG22 sing N N 419 VAL CG2 HG23 sing N N 420 VAL OXT HXT sing N N 421 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 1,2-ETHANEDIOL EDO 4 'NICKEL (II) ION' NI 5 'PENTAETHYLENE GLYCOL' 1PE 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3ZQW _pdbx_initial_refinement_model.details 'PDB ENTRY 3ZQW' #