data_3DTI # _entry.id 3DTI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3DTI pdb_00003dti 10.2210/pdb3dti/pdb RCSB RCSB048468 ? ? WWPDB D_1000048468 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3DTE . unspecified PDB 3DTK . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3DTI _pdbx_database_status.recvd_initial_deposition_date 2008-07-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vujicic-Zagar, A.' 1 'Dulermo, R.' 2 'Le Gorrec, M.' 3 'Vannier, F.' 4 'Servant, P.' 5 'Sommer, S.' 6 'De Groot, A.' 7 'Serre, L.' 8 # _citation.id primary _citation.title 'Crystal structure of the IrrE protein, a central regulator of DNA damage repair in deinococcaceae' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 386 _citation.page_first 704 _citation.page_last 716 _citation.year 2009 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19150362 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.12.062 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vujicic-Zagar, A.' 1 ? primary 'Dulermo, R.' 2 ? primary 'Le Gorrec, M.' 3 ? primary 'Vannier, F.' 4 ? primary 'Servant, P.' 5 ? primary 'Sommer, S.' 6 ? primary 'de Groot, A.' 7 ? primary 'Serre, L.' 8 ? # _cell.entry_id 3DTI _cell.length_a 88.190 _cell.length_b 53.410 _cell.length_c 63.420 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3DTI _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'IRRE protein' 32337.150 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGENLYFQGMTDPAPPPTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDP EHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPT GRALAELARRADVSATSALYALAERTAPPVIYAVCALSRQEDEGEGGGAKELTVRASSASAGVKYSLSAGTPVPDDHPAA LALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALPAGRSEPDADKPEAPGDQS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGENLYFQGMTDPAPPPTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDP EHHVILINSQVRPERQRFTLAHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPT GRALAELARRADVSATSALYALAERTAPPVIYAVCALSRQEDEGEGGGAKELTVRASSASAGVKYSLSAGTPVPDDHPAA LALDTRLPLAQDSYVPFRSGRRMPAYVDAFPERQRVLVSFALPAGRSEPDADKPEAPGDQS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 GLU n 1 15 ASN n 1 16 LEU n 1 17 TYR n 1 18 PHE n 1 19 GLN n 1 20 GLY n 1 21 MET n 1 22 THR n 1 23 ASP n 1 24 PRO n 1 25 ALA n 1 26 PRO n 1 27 PRO n 1 28 PRO n 1 29 THR n 1 30 ALA n 1 31 LEU n 1 32 ALA n 1 33 ALA n 1 34 ALA n 1 35 LYS n 1 36 ALA n 1 37 ARG n 1 38 MET n 1 39 ARG n 1 40 GLU n 1 41 LEU n 1 42 ALA n 1 43 ALA n 1 44 SER n 1 45 TYR n 1 46 GLY n 1 47 ALA n 1 48 GLY n 1 49 LEU n 1 50 PRO n 1 51 GLY n 1 52 ARG n 1 53 ASP n 1 54 THR n 1 55 HIS n 1 56 SER n 1 57 LEU n 1 58 MET n 1 59 HIS n 1 60 GLY n 1 61 LEU n 1 62 ASP n 1 63 GLY n 1 64 ILE n 1 65 THR n 1 66 LEU n 1 67 THR n 1 68 PHE n 1 69 MET n 1 70 PRO n 1 71 MET n 1 72 GLY n 1 73 GLN n 1 74 ARG n 1 75 ASP n 1 76 GLY n 1 77 ALA n 1 78 TYR n 1 79 ASP n 1 80 PRO n 1 81 GLU n 1 82 HIS n 1 83 HIS n 1 84 VAL n 1 85 ILE n 1 86 LEU n 1 87 ILE n 1 88 ASN n 1 89 SER n 1 90 GLN n 1 91 VAL n 1 92 ARG n 1 93 PRO n 1 94 GLU n 1 95 ARG n 1 96 GLN n 1 97 ARG n 1 98 PHE n 1 99 THR n 1 100 LEU n 1 101 ALA n 1 102 HIS n 1 103 GLU n 1 104 ILE n 1 105 SER n 1 106 HIS n 1 107 ALA n 1 108 LEU n 1 109 LEU n 1 110 LEU n 1 111 GLY n 1 112 ASP n 1 113 ASP n 1 114 ASP n 1 115 LEU n 1 116 LEU n 1 117 SER n 1 118 ASP n 1 119 LEU n 1 120 HIS n 1 121 ASP n 1 122 GLU n 1 123 TYR n 1 124 GLU n 1 125 GLY n 1 126 ASP n 1 127 ARG n 1 128 LEU n 1 129 GLU n 1 130 GLN n 1 131 VAL n 1 132 ILE n 1 133 GLU n 1 134 THR n 1 135 LEU n 1 136 CYS n 1 137 ASN n 1 138 VAL n 1 139 GLY n 1 140 ALA n 1 141 ALA n 1 142 ALA n 1 143 LEU n 1 144 LEU n 1 145 MET n 1 146 PRO n 1 147 ALA n 1 148 GLU n 1 149 LEU n 1 150 ILE n 1 151 ASP n 1 152 ASP n 1 153 LEU n 1 154 LEU n 1 155 THR n 1 156 ARG n 1 157 PHE n 1 158 GLY n 1 159 PRO n 1 160 THR n 1 161 GLY n 1 162 ARG n 1 163 ALA n 1 164 LEU n 1 165 ALA n 1 166 GLU n 1 167 LEU n 1 168 ALA n 1 169 ARG n 1 170 ARG n 1 171 ALA n 1 172 ASP n 1 173 VAL n 1 174 SER n 1 175 ALA n 1 176 THR n 1 177 SER n 1 178 ALA n 1 179 LEU n 1 180 TYR n 1 181 ALA n 1 182 LEU n 1 183 ALA n 1 184 GLU n 1 185 ARG n 1 186 THR n 1 187 ALA n 1 188 PRO n 1 189 PRO n 1 190 VAL n 1 191 ILE n 1 192 TYR n 1 193 ALA n 1 194 VAL n 1 195 CYS n 1 196 ALA n 1 197 LEU n 1 198 SER n 1 199 ARG n 1 200 GLN n 1 201 GLU n 1 202 ASP n 1 203 GLU n 1 204 GLY n 1 205 GLU n 1 206 GLY n 1 207 GLY n 1 208 GLY n 1 209 ALA n 1 210 LYS n 1 211 GLU n 1 212 LEU n 1 213 THR n 1 214 VAL n 1 215 ARG n 1 216 ALA n 1 217 SER n 1 218 SER n 1 219 ALA n 1 220 SER n 1 221 ALA n 1 222 GLY n 1 223 VAL n 1 224 LYS n 1 225 TYR n 1 226 SER n 1 227 LEU n 1 228 SER n 1 229 ALA n 1 230 GLY n 1 231 THR n 1 232 PRO n 1 233 VAL n 1 234 PRO n 1 235 ASP n 1 236 ASP n 1 237 HIS n 1 238 PRO n 1 239 ALA n 1 240 ALA n 1 241 LEU n 1 242 ALA n 1 243 LEU n 1 244 ASP n 1 245 THR n 1 246 ARG n 1 247 LEU n 1 248 PRO n 1 249 LEU n 1 250 ALA n 1 251 GLN n 1 252 ASP n 1 253 SER n 1 254 TYR n 1 255 VAL n 1 256 PRO n 1 257 PHE n 1 258 ARG n 1 259 SER n 1 260 GLY n 1 261 ARG n 1 262 ARG n 1 263 MET n 1 264 PRO n 1 265 ALA n 1 266 TYR n 1 267 VAL n 1 268 ASP n 1 269 ALA n 1 270 PHE n 1 271 PRO n 1 272 GLU n 1 273 ARG n 1 274 GLN n 1 275 ARG n 1 276 VAL n 1 277 LEU n 1 278 VAL n 1 279 SER n 1 280 PHE n 1 281 ALA n 1 282 LEU n 1 283 PRO n 1 284 ALA n 1 285 GLY n 1 286 ARG n 1 287 SER n 1 288 GLU n 1 289 PRO n 1 290 ASP n 1 291 ALA n 1 292 ASP n 1 293 LYS n 1 294 PRO n 1 295 GLU n 1 296 ALA n 1 297 PRO n 1 298 GLY n 1 299 ASP n 1 300 GLN n 1 301 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene irrE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'deinococcus deserti' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 310783 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-TEV _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B5B9W8_9DEIO _struct_ref.pdbx_db_accession B5B9W8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTDPAPPPTALAAAKARMRELAASYGAGLPGRDTHSLMHGLDGITLTFMPMGQRDGAYDPEHHVILINSQVRPERQRFTL AHEISHALLLGDDDLLSDLHDEYEGDRLEQVIETLCNVGAAALLMPAELIDDLLTRFGPTGRALAELARRADVSATSALY ALAERTAPPVIYAVCALSRQEDEGEGGGAKELTVRASSASAGVKYSLSAGTPVPDDHPAALALDTRLPLAQDSYVPFRSG RRMPAYVDAFPERQRVLVSFALPAGRSEPDADKPEAPGDQS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3DTI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 301 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B5B9W8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 281 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 281 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3DTI MET A 1 ? UNP B5B9W8 ? ? 'expression tag' -19 1 1 3DTI GLY A 2 ? UNP B5B9W8 ? ? 'expression tag' -18 2 1 3DTI SER A 3 ? UNP B5B9W8 ? ? 'expression tag' -17 3 1 3DTI SER A 4 ? UNP B5B9W8 ? ? 'expression tag' -16 4 1 3DTI HIS A 5 ? UNP B5B9W8 ? ? 'expression tag' -15 5 1 3DTI HIS A 6 ? UNP B5B9W8 ? ? 'expression tag' -14 6 1 3DTI HIS A 7 ? UNP B5B9W8 ? ? 'expression tag' -13 7 1 3DTI HIS A 8 ? UNP B5B9W8 ? ? 'expression tag' -12 8 1 3DTI HIS A 9 ? UNP B5B9W8 ? ? 'expression tag' -11 9 1 3DTI HIS A 10 ? UNP B5B9W8 ? ? 'expression tag' -10 10 1 3DTI SER A 11 ? UNP B5B9W8 ? ? 'expression tag' -9 11 1 3DTI SER A 12 ? UNP B5B9W8 ? ? 'expression tag' -8 12 1 3DTI GLY A 13 ? UNP B5B9W8 ? ? 'expression tag' -7 13 1 3DTI GLU A 14 ? UNP B5B9W8 ? ? 'expression tag' -6 14 1 3DTI ASN A 15 ? UNP B5B9W8 ? ? 'expression tag' -5 15 1 3DTI LEU A 16 ? UNP B5B9W8 ? ? 'expression tag' -4 16 1 3DTI TYR A 17 ? UNP B5B9W8 ? ? 'expression tag' -3 17 1 3DTI PHE A 18 ? UNP B5B9W8 ? ? 'expression tag' -2 18 1 3DTI GLN A 19 ? UNP B5B9W8 ? ? 'expression tag' -1 19 1 3DTI GLY A 20 ? UNP B5B9W8 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 3DTI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_percent_sol 46.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 281 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '20% PEG 3350, 0.2M Potassium fluoride, pH 7.5, VAPOR DIFFUSION, temperature 281K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97618 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97618 # _reflns.entry_id 3DTI _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 3.5 _reflns.d_resolution_low 40 _reflns.number_all ? _reflns.number_obs 4071 _reflns.percent_possible_obs 99.4 _reflns.pdbx_Rmerge_I_obs 0.102 _reflns.pdbx_Rsym_value 0.077 _reflns.pdbx_netI_over_sigmaI 8.1 _reflns.B_iso_Wilson_estimate 63 _reflns.pdbx_redundancy 3.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.5 _reflns_shell.d_res_low 3.69 _reflns_shell.percent_possible_all 99.4 _reflns_shell.Rmerge_I_obs 0.48 _reflns_shell.pdbx_Rsym_value 0.364 _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy 3.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 579 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 3DTI _refine.ls_number_reflns_obs 3842 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 3.50 _refine.ls_percent_reflns_obs 99.16 _refine.ls_R_factor_obs 0.24451 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.24131 _refine.ls_R_factor_R_free 0.3142 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.5 _refine.ls_number_reflns_R_free 181 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.909 _refine.correlation_coeff_Fo_to_Fc_free 0.808 _refine.B_iso_mean 66.089 _refine.aniso_B[1][1] 3.02 _refine.aniso_B[2][2] -4.09 _refine.aniso_B[3][3] 1.07 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 'PDB ENTRY 3DTE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.775 _refine.overall_SU_ML 0.682 _refine.overall_SU_B 43.076 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1838 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1839 _refine_hist.d_res_high 3.50 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.010 0.021 ? 1880 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 1268 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.073 1.985 ? 2556 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.706 3.000 ? 3072 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.180 5.000 ? 241 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 33.675 22.346 ? 81 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 19.353 15.000 ? 290 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 10.656 15.000 ? 20 'X-RAY DIFFRACTION' ? r_chiral_restr 0.051 0.200 ? 296 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.003 0.020 ? 2113 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 385 'X-RAY DIFFRACTION' ? r_nbd_refined 0.282 0.300 ? 544 'X-RAY DIFFRACTION' ? r_nbd_other 0.230 0.300 ? 1347 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.198 0.500 ? 949 'X-RAY DIFFRACTION' ? r_nbtor_other 0.094 0.500 ? 1075 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.262 0.500 ? 105 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other 0.129 0.500 ? 10 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.167 0.300 ? 6 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.208 0.300 ? 16 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.177 0.500 ? 3 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.917 2.000 ? 1543 'X-RAY DIFFRACTION' ? r_mcbond_other 0.074 2.000 ? 485 'X-RAY DIFFRACTION' ? r_mcangle_it 1.047 3.000 ? 1942 'X-RAY DIFFRACTION' ? r_scbond_it 0.407 2.000 ? 737 'X-RAY DIFFRACTION' ? r_scangle_it 0.540 3.000 ? 614 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 3.500 _refine_ls_shell.d_res_low 3.588 _refine_ls_shell.number_reflns_R_work 275 _refine_ls_shell.R_factor_R_work 0.233 _refine_ls_shell.percent_reflns_obs 99.65 _refine_ls_shell.R_factor_R_free 0.297 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 13 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3DTI _struct.title 'Crystal structure of the IRRE protein, a central regulator of DNA damage repair in deinococcaceae' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3DTI _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'IrrE, Deinococcus, Radiotolerance, Gene regulation, Metallopeptidase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 29 ? GLY A 48 ? THR A 9 GLY A 28 1 ? 20 HELX_P HELX_P2 2 ASP A 53 ? GLY A 60 ? ASP A 33 GLY A 40 1 ? 8 HELX_P HELX_P3 3 ARG A 92 ? ASP A 112 ? ARG A 72 ASP A 92 1 ? 21 HELX_P HELX_P4 4 ASP A 112 ? TYR A 123 ? ASP A 92 TYR A 103 1 ? 12 HELX_P HELX_P5 5 GLY A 125 ? MET A 145 ? GLY A 105 MET A 125 1 ? 21 HELX_P HELX_P6 6 PRO A 146 ? GLY A 158 ? PRO A 126 GLY A 138 1 ? 13 HELX_P HELX_P7 7 THR A 160 ? ASP A 172 ? THR A 140 ASP A 152 1 ? 13 HELX_P HELX_P8 8 SER A 174 ? ARG A 185 ? SER A 154 ARG A 165 1 ? 12 HELX_P HELX_P9 9 HIS A 237 ? ALA A 242 ? HIS A 217 ALA A 222 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 102 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 82 A ZN 282 1_555 ? ? ? ? ? ? ? 2.071 ? ? metalc2 metalc ? ? A HIS 106 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 86 A ZN 282 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc3 metalc ? ? A GLU 133 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 113 A ZN 282 1_555 ? ? ? ? ? ? ? 2.003 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 65 ? MET A 69 ? THR A 45 MET A 49 A 2 VAL A 84 ? ASN A 88 ? VAL A 64 ASN A 68 A 3 GLY A 76 ? ASP A 79 ? GLY A 56 ASP A 59 B 1 THR A 213 ? ALA A 219 ? THR A 193 ALA A 199 B 2 VAL A 190 ? ALA A 196 ? VAL A 170 ALA A 176 B 3 ARG A 275 ? ALA A 281 ? ARG A 255 ALA A 261 B 4 ARG A 262 ? GLU A 272 ? ARG A 242 GLU A 252 B 5 ALA A 250 ? PRO A 256 ? ALA A 230 PRO A 236 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 67 ? N THR A 47 O ILE A 85 ? O ILE A 65 A 2 3 O VAL A 84 ? O VAL A 64 N ASP A 79 ? N ASP A 59 B 1 2 O SER A 218 ? O SER A 198 N TYR A 192 ? N TYR A 172 B 2 3 N ILE A 191 ? N ILE A 171 O PHE A 280 ? O PHE A 260 B 3 4 O ARG A 275 ? O ARG A 255 N GLU A 272 ? N GLU A 252 B 4 5 O MET A 263 ? O MET A 243 N VAL A 255 ? N VAL A 235 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 282 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 282' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 102 ? HIS A 82 . ? 1_555 ? 2 AC1 4 GLU A 103 ? GLU A 83 . ? 1_555 ? 3 AC1 4 HIS A 106 ? HIS A 86 . ? 1_555 ? 4 AC1 4 GLU A 133 ? GLU A 113 . ? 1_555 ? # _database_PDB_matrix.entry_id 3DTI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3DTI _atom_sites.fract_transf_matrix[1][1] 0.011339 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018723 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015768 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 GLU 14 -6 ? ? ? A . n A 1 15 ASN 15 -5 ? ? ? A . n A 1 16 LEU 16 -4 ? ? ? A . n A 1 17 TYR 17 -3 ? ? ? A . n A 1 18 PHE 18 -2 ? ? ? A . n A 1 19 GLN 19 -1 ? ? ? A . n A 1 20 GLY 20 0 ? ? ? A . n A 1 21 MET 21 1 ? ? ? A . n A 1 22 THR 22 2 ? ? ? A . n A 1 23 ASP 23 3 ? ? ? A . n A 1 24 PRO 24 4 ? ? ? A . n A 1 25 ALA 25 5 ? ? ? A . n A 1 26 PRO 26 6 ? ? ? A . n A 1 27 PRO 27 7 ? ? ? A . n A 1 28 PRO 28 8 8 PRO PRO A . n A 1 29 THR 29 9 9 THR THR A . n A 1 30 ALA 30 10 10 ALA ALA A . n A 1 31 LEU 31 11 11 LEU LEU A . n A 1 32 ALA 32 12 12 ALA ALA A . n A 1 33 ALA 33 13 13 ALA ALA A . n A 1 34 ALA 34 14 14 ALA ALA A . n A 1 35 LYS 35 15 15 LYS LYS A . n A 1 36 ALA 36 16 16 ALA ALA A . n A 1 37 ARG 37 17 17 ARG ARG A . n A 1 38 MET 38 18 18 MET MET A . n A 1 39 ARG 39 19 19 ARG ARG A . n A 1 40 GLU 40 20 20 GLU GLU A . n A 1 41 LEU 41 21 21 LEU LEU A . n A 1 42 ALA 42 22 22 ALA ALA A . n A 1 43 ALA 43 23 23 ALA ALA A . n A 1 44 SER 44 24 24 SER SER A . n A 1 45 TYR 45 25 25 TYR TYR A . n A 1 46 GLY 46 26 26 GLY GLY A . n A 1 47 ALA 47 27 27 ALA ALA A . n A 1 48 GLY 48 28 28 GLY GLY A . n A 1 49 LEU 49 29 29 LEU LEU A . n A 1 50 PRO 50 30 30 PRO PRO A . n A 1 51 GLY 51 31 31 GLY GLY A . n A 1 52 ARG 52 32 32 ARG ARG A . n A 1 53 ASP 53 33 33 ASP ASP A . n A 1 54 THR 54 34 34 THR THR A . n A 1 55 HIS 55 35 35 HIS HIS A . n A 1 56 SER 56 36 36 SER SER A . n A 1 57 LEU 57 37 37 LEU LEU A . n A 1 58 MET 58 38 38 MET MET A . n A 1 59 HIS 59 39 39 HIS HIS A . n A 1 60 GLY 60 40 40 GLY GLY A . n A 1 61 LEU 61 41 41 LEU LEU A . n A 1 62 ASP 62 42 42 ASP ASP A . n A 1 63 GLY 63 43 43 GLY GLY A . n A 1 64 ILE 64 44 44 ILE ILE A . n A 1 65 THR 65 45 45 THR THR A . n A 1 66 LEU 66 46 46 LEU LEU A . n A 1 67 THR 67 47 47 THR THR A . n A 1 68 PHE 68 48 48 PHE PHE A . n A 1 69 MET 69 49 49 MET MET A . n A 1 70 PRO 70 50 50 PRO PRO A . n A 1 71 MET 71 51 51 MET MET A . n A 1 72 GLY 72 52 52 GLY GLY A . n A 1 73 GLN 73 53 53 GLN GLN A . n A 1 74 ARG 74 54 54 ARG ARG A . n A 1 75 ASP 75 55 55 ASP ASP A . n A 1 76 GLY 76 56 56 GLY GLY A . n A 1 77 ALA 77 57 57 ALA ALA A . n A 1 78 TYR 78 58 58 TYR TYR A . n A 1 79 ASP 79 59 59 ASP ASP A . n A 1 80 PRO 80 60 60 PRO PRO A . n A 1 81 GLU 81 61 61 GLU GLU A . n A 1 82 HIS 82 62 62 HIS HIS A . n A 1 83 HIS 83 63 63 HIS HIS A . n A 1 84 VAL 84 64 64 VAL VAL A . n A 1 85 ILE 85 65 65 ILE ILE A . n A 1 86 LEU 86 66 66 LEU LEU A . n A 1 87 ILE 87 67 67 ILE ILE A . n A 1 88 ASN 88 68 68 ASN ASN A . n A 1 89 SER 89 69 69 SER SER A . n A 1 90 GLN 90 70 70 GLN GLN A . n A 1 91 VAL 91 71 71 VAL VAL A . n A 1 92 ARG 92 72 72 ARG ARG A . n A 1 93 PRO 93 73 73 PRO PRO A . n A 1 94 GLU 94 74 74 GLU GLU A . n A 1 95 ARG 95 75 75 ARG ARG A . n A 1 96 GLN 96 76 76 GLN GLN A . n A 1 97 ARG 97 77 77 ARG ARG A . n A 1 98 PHE 98 78 78 PHE PHE A . n A 1 99 THR 99 79 79 THR THR A . n A 1 100 LEU 100 80 80 LEU LEU A . n A 1 101 ALA 101 81 81 ALA ALA A . n A 1 102 HIS 102 82 82 HIS HIS A . n A 1 103 GLU 103 83 83 GLU GLU A . n A 1 104 ILE 104 84 84 ILE ILE A . n A 1 105 SER 105 85 85 SER SER A . n A 1 106 HIS 106 86 86 HIS HIS A . n A 1 107 ALA 107 87 87 ALA ALA A . n A 1 108 LEU 108 88 88 LEU LEU A . n A 1 109 LEU 109 89 89 LEU LEU A . n A 1 110 LEU 110 90 90 LEU LEU A . n A 1 111 GLY 111 91 91 GLY GLY A . n A 1 112 ASP 112 92 92 ASP ASP A . n A 1 113 ASP 113 93 93 ASP ASP A . n A 1 114 ASP 114 94 94 ASP ASP A . n A 1 115 LEU 115 95 95 LEU LEU A . n A 1 116 LEU 116 96 96 LEU LEU A . n A 1 117 SER 117 97 97 SER SER A . n A 1 118 ASP 118 98 98 ASP ASP A . n A 1 119 LEU 119 99 99 LEU LEU A . n A 1 120 HIS 120 100 100 HIS HIS A . n A 1 121 ASP 121 101 101 ASP ASP A . n A 1 122 GLU 122 102 102 GLU GLU A . n A 1 123 TYR 123 103 103 TYR TYR A . n A 1 124 GLU 124 104 104 GLU GLU A . n A 1 125 GLY 125 105 105 GLY GLY A . n A 1 126 ASP 126 106 106 ASP ASP A . n A 1 127 ARG 127 107 107 ARG ARG A . n A 1 128 LEU 128 108 108 LEU LEU A . n A 1 129 GLU 129 109 109 GLU GLU A . n A 1 130 GLN 130 110 110 GLN GLN A . n A 1 131 VAL 131 111 111 VAL VAL A . n A 1 132 ILE 132 112 112 ILE ILE A . n A 1 133 GLU 133 113 113 GLU GLU A . n A 1 134 THR 134 114 114 THR THR A . n A 1 135 LEU 135 115 115 LEU LEU A . n A 1 136 CYS 136 116 116 CYS CYS A . n A 1 137 ASN 137 117 117 ASN ASN A . n A 1 138 VAL 138 118 118 VAL VAL A . n A 1 139 GLY 139 119 119 GLY GLY A . n A 1 140 ALA 140 120 120 ALA ALA A . n A 1 141 ALA 141 121 121 ALA ALA A . n A 1 142 ALA 142 122 122 ALA ALA A . n A 1 143 LEU 143 123 123 LEU LEU A . n A 1 144 LEU 144 124 124 LEU LEU A . n A 1 145 MET 145 125 125 MET MET A . n A 1 146 PRO 146 126 126 PRO PRO A . n A 1 147 ALA 147 127 127 ALA ALA A . n A 1 148 GLU 148 128 128 GLU GLU A . n A 1 149 LEU 149 129 129 LEU LEU A . n A 1 150 ILE 150 130 130 ILE ILE A . n A 1 151 ASP 151 131 131 ASP ASP A . n A 1 152 ASP 152 132 132 ASP ASP A . n A 1 153 LEU 153 133 133 LEU LEU A . n A 1 154 LEU 154 134 134 LEU LEU A . n A 1 155 THR 155 135 135 THR THR A . n A 1 156 ARG 156 136 136 ARG ARG A . n A 1 157 PHE 157 137 137 PHE PHE A . n A 1 158 GLY 158 138 138 GLY GLY A . n A 1 159 PRO 159 139 139 PRO PRO A . n A 1 160 THR 160 140 140 THR THR A . n A 1 161 GLY 161 141 141 GLY GLY A . n A 1 162 ARG 162 142 142 ARG ARG A . n A 1 163 ALA 163 143 143 ALA ALA A . n A 1 164 LEU 164 144 144 LEU LEU A . n A 1 165 ALA 165 145 145 ALA ALA A . n A 1 166 GLU 166 146 146 GLU GLU A . n A 1 167 LEU 167 147 147 LEU LEU A . n A 1 168 ALA 168 148 148 ALA ALA A . n A 1 169 ARG 169 149 149 ARG ARG A . n A 1 170 ARG 170 150 150 ARG ARG A . n A 1 171 ALA 171 151 151 ALA ALA A . n A 1 172 ASP 172 152 152 ASP ASP A . n A 1 173 VAL 173 153 153 VAL VAL A . n A 1 174 SER 174 154 154 SER SER A . n A 1 175 ALA 175 155 155 ALA ALA A . n A 1 176 THR 176 156 156 THR THR A . n A 1 177 SER 177 157 157 SER SER A . n A 1 178 ALA 178 158 158 ALA ALA A . n A 1 179 LEU 179 159 159 LEU LEU A . n A 1 180 TYR 180 160 160 TYR TYR A . n A 1 181 ALA 181 161 161 ALA ALA A . n A 1 182 LEU 182 162 162 LEU LEU A . n A 1 183 ALA 183 163 163 ALA ALA A . n A 1 184 GLU 184 164 164 GLU GLU A . n A 1 185 ARG 185 165 165 ARG ARG A . n A 1 186 THR 186 166 166 THR THR A . n A 1 187 ALA 187 167 167 ALA ALA A . n A 1 188 PRO 188 168 168 PRO PRO A . n A 1 189 PRO 189 169 169 PRO PRO A . n A 1 190 VAL 190 170 170 VAL VAL A . n A 1 191 ILE 191 171 171 ILE ILE A . n A 1 192 TYR 192 172 172 TYR TYR A . n A 1 193 ALA 193 173 173 ALA ALA A . n A 1 194 VAL 194 174 174 VAL VAL A . n A 1 195 CYS 195 175 175 CYS CYS A . n A 1 196 ALA 196 176 176 ALA ALA A . n A 1 197 LEU 197 177 177 LEU LEU A . n A 1 198 SER 198 178 178 SER SER A . n A 1 199 ARG 199 179 ? ? ? A . n A 1 200 GLN 200 180 ? ? ? A . n A 1 201 GLU 201 181 ? ? ? A . n A 1 202 ASP 202 182 ? ? ? A . n A 1 203 GLU 203 183 ? ? ? A . n A 1 204 GLY 204 184 ? ? ? A . n A 1 205 GLU 205 185 ? ? ? A . n A 1 206 GLY 206 186 ? ? ? A . n A 1 207 GLY 207 187 ? ? ? A . n A 1 208 GLY 208 188 ? ? ? A . n A 1 209 ALA 209 189 ? ? ? A . n A 1 210 LYS 210 190 ? ? ? A . n A 1 211 GLU 211 191 ? ? ? A . n A 1 212 LEU 212 192 192 LEU LEU A . n A 1 213 THR 213 193 193 THR THR A . n A 1 214 VAL 214 194 194 VAL VAL A . n A 1 215 ARG 215 195 195 ARG ARG A . n A 1 216 ALA 216 196 196 ALA ALA A . n A 1 217 SER 217 197 197 SER SER A . n A 1 218 SER 218 198 198 SER SER A . n A 1 219 ALA 219 199 199 ALA ALA A . n A 1 220 SER 220 200 200 SER SER A . n A 1 221 ALA 221 201 201 ALA ALA A . n A 1 222 GLY 222 202 202 GLY ALA A . n A 1 223 VAL 223 203 203 VAL VAL A . n A 1 224 LYS 224 204 204 LYS LYS A . n A 1 225 TYR 225 205 205 TYR TYR A . n A 1 226 SER 226 206 206 SER SER A . n A 1 227 LEU 227 207 207 LEU LEU A . n A 1 228 SER 228 208 208 SER SER A . n A 1 229 ALA 229 209 209 ALA ALA A . n A 1 230 GLY 230 210 210 GLY GLY A . n A 1 231 THR 231 211 211 THR THR A . n A 1 232 PRO 232 212 212 PRO PRO A . n A 1 233 VAL 233 213 213 VAL VAL A . n A 1 234 PRO 234 214 214 PRO PRO A . n A 1 235 ASP 235 215 215 ASP ASP A . n A 1 236 ASP 236 216 216 ASP ASP A . n A 1 237 HIS 237 217 217 HIS HIS A . n A 1 238 PRO 238 218 218 PRO PRO A . n A 1 239 ALA 239 219 219 ALA ALA A . n A 1 240 ALA 240 220 220 ALA ALA A . n A 1 241 LEU 241 221 221 LEU LEU A . n A 1 242 ALA 242 222 222 ALA ALA A . n A 1 243 LEU 243 223 223 LEU LEU A . n A 1 244 ASP 244 224 224 ASP ASP A . n A 1 245 THR 245 225 225 THR THR A . n A 1 246 ARG 246 226 226 ARG ARG A . n A 1 247 LEU 247 227 227 LEU LEU A . n A 1 248 PRO 248 228 228 PRO PRO A . n A 1 249 LEU 249 229 229 LEU LEU A . n A 1 250 ALA 250 230 230 ALA ALA A . n A 1 251 GLN 251 231 231 GLN GLN A . n A 1 252 ASP 252 232 232 ASP ASP A . n A 1 253 SER 253 233 233 SER SER A . n A 1 254 TYR 254 234 234 TYR TYR A . n A 1 255 VAL 255 235 235 VAL VAL A . n A 1 256 PRO 256 236 236 PRO PRO A . n A 1 257 PHE 257 237 237 PHE PHE A . n A 1 258 ARG 258 238 238 ARG ARG A . n A 1 259 SER 259 239 239 SER SER A . n A 1 260 GLY 260 240 240 GLY GLY A . n A 1 261 ARG 261 241 241 ARG ARG A . n A 1 262 ARG 262 242 242 ARG ARG A . n A 1 263 MET 263 243 243 MET MET A . n A 1 264 PRO 264 244 244 PRO PRO A . n A 1 265 ALA 265 245 245 ALA ALA A . n A 1 266 TYR 266 246 246 TYR TYR A . n A 1 267 VAL 267 247 247 VAL VAL A . n A 1 268 ASP 268 248 248 ASP ASP A . n A 1 269 ALA 269 249 249 ALA ALA A . n A 1 270 PHE 270 250 250 PHE PHE A . n A 1 271 PRO 271 251 251 PRO PRO A . n A 1 272 GLU 272 252 252 GLU GLU A . n A 1 273 ARG 273 253 253 ARG ARG A . n A 1 274 GLN 274 254 254 GLN GLN A . n A 1 275 ARG 275 255 255 ARG ARG A . n A 1 276 VAL 276 256 256 VAL VAL A . n A 1 277 LEU 277 257 257 LEU LEU A . n A 1 278 VAL 278 258 258 VAL VAL A . n A 1 279 SER 279 259 259 SER SER A . n A 1 280 PHE 280 260 260 PHE PHE A . n A 1 281 ALA 281 261 261 ALA ALA A . n A 1 282 LEU 282 262 262 LEU LEU A . n A 1 283 PRO 283 263 263 PRO PRO A . n A 1 284 ALA 284 264 ? ? ? A . n A 1 285 GLY 285 265 ? ? ? A . n A 1 286 ARG 286 266 ? ? ? A . n A 1 287 SER 287 267 ? ? ? A . n A 1 288 GLU 288 268 ? ? ? A . n A 1 289 PRO 289 269 ? ? ? A . n A 1 290 ASP 290 270 ? ? ? A . n A 1 291 ALA 291 271 ? ? ? A . n A 1 292 ASP 292 272 ? ? ? A . n A 1 293 LYS 293 273 ? ? ? A . n A 1 294 PRO 294 274 ? ? ? A . n A 1 295 GLU 295 275 ? ? ? A . n A 1 296 ALA 296 276 ? ? ? A . n A 1 297 PRO 297 277 ? ? ? A . n A 1 298 GLY 298 278 ? ? ? A . n A 1 299 ASP 299 279 ? ? ? A . n A 1 300 GLN 300 280 ? ? ? A . n A 1 301 SER 301 281 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 282 _pdbx_nonpoly_scheme.auth_seq_num 264 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 102 ? A HIS 82 ? 1_555 ZN ? B ZN . ? A ZN 282 ? 1_555 NE2 ? A HIS 106 ? A HIS 86 ? 1_555 105.0 ? 2 NE2 ? A HIS 102 ? A HIS 82 ? 1_555 ZN ? B ZN . ? A ZN 282 ? 1_555 OE1 ? A GLU 133 ? A GLU 113 ? 1_555 99.6 ? 3 NE2 ? A HIS 106 ? A HIS 86 ? 1_555 ZN ? B ZN . ? A ZN 282 ? 1_555 OE1 ? A GLU 133 ? A GLU 113 ? 1_555 73.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-10 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2023-11-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' struct_ref_seq_dif 6 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 DNA 'data collection' . ? 2 XDS 'data reduction' . ? 3 SCALA 'data scaling' . ? 4 deduced phasing 'from 3DTE (crystals soaked in zinc)' ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 221 ? ? OG1 A THR 225 ? ? 2.03 2 1 OD2 A ASP 59 ? ? ND1 A HIS 62 ? ? 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 24 ? ? -72.11 -71.00 2 1 PRO A 30 ? ? -86.74 49.63 3 1 ASP A 98 ? ? -35.78 -31.32 4 1 ALA A 121 ? ? -26.68 -80.13 5 1 ALA A 201 ? ? 26.92 -110.45 6 1 ARG A 226 ? ? 2.16 60.56 7 1 ALA A 230 ? ? -161.12 110.68 8 1 SER A 233 ? ? 167.26 -135.31 9 1 ALA A 245 ? ? 179.56 160.26 10 1 ARG A 253 ? ? -27.20 80.48 11 1 GLN A 254 ? ? 88.58 -14.06 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id LEU _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 192 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id N _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id LEU _pdbx_unobs_or_zero_occ_atoms.label_seq_id 212 _pdbx_unobs_or_zero_occ_atoms.label_atom_id N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A GLU -6 ? A GLU 14 15 1 Y 1 A ASN -5 ? A ASN 15 16 1 Y 1 A LEU -4 ? A LEU 16 17 1 Y 1 A TYR -3 ? A TYR 17 18 1 Y 1 A PHE -2 ? A PHE 18 19 1 Y 1 A GLN -1 ? A GLN 19 20 1 Y 1 A GLY 0 ? A GLY 20 21 1 Y 1 A MET 1 ? A MET 21 22 1 Y 1 A THR 2 ? A THR 22 23 1 Y 1 A ASP 3 ? A ASP 23 24 1 Y 1 A PRO 4 ? A PRO 24 25 1 Y 1 A ALA 5 ? A ALA 25 26 1 Y 1 A PRO 6 ? A PRO 26 27 1 Y 1 A PRO 7 ? A PRO 27 28 1 Y 1 A ARG 179 ? A ARG 199 29 1 Y 1 A GLN 180 ? A GLN 200 30 1 Y 1 A GLU 181 ? A GLU 201 31 1 Y 1 A ASP 182 ? A ASP 202 32 1 Y 1 A GLU 183 ? A GLU 203 33 1 Y 1 A GLY 184 ? A GLY 204 34 1 Y 1 A GLU 185 ? A GLU 205 35 1 Y 1 A GLY 186 ? A GLY 206 36 1 Y 1 A GLY 187 ? A GLY 207 37 1 Y 1 A GLY 188 ? A GLY 208 38 1 Y 1 A ALA 189 ? A ALA 209 39 1 Y 1 A LYS 190 ? A LYS 210 40 1 Y 1 A GLU 191 ? A GLU 211 41 1 Y 1 A ALA 264 ? A ALA 284 42 1 Y 1 A GLY 265 ? A GLY 285 43 1 Y 1 A ARG 266 ? A ARG 286 44 1 Y 1 A SER 267 ? A SER 287 45 1 Y 1 A GLU 268 ? A GLU 288 46 1 Y 1 A PRO 269 ? A PRO 289 47 1 Y 1 A ASP 270 ? A ASP 290 48 1 Y 1 A ALA 271 ? A ALA 291 49 1 Y 1 A ASP 272 ? A ASP 292 50 1 Y 1 A LYS 273 ? A LYS 293 51 1 Y 1 A PRO 274 ? A PRO 294 52 1 Y 1 A GLU 275 ? A GLU 295 53 1 Y 1 A ALA 276 ? A ALA 296 54 1 Y 1 A PRO 277 ? A PRO 297 55 1 Y 1 A GLY 278 ? A GLY 298 56 1 Y 1 A ASP 279 ? A ASP 299 57 1 Y 1 A GLN 280 ? A GLN 300 58 1 Y 1 A SER 281 ? A SER 301 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 ZN ZN ZN N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3DTE _pdbx_initial_refinement_model.details 'PDB ENTRY 3DTE' #