data_3KA3 # _entry.id 3KA3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3KA3 pdb_00003ka3 10.2210/pdb3ka3/pdb RCSB RCSB055736 ? ? WWPDB D_1000055736 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-10-06 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-02-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' pdbx_struct_special_symmetry 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.value' 16 3 'Structure model' '_struct_conn.pdbx_dist_value' 17 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 3KA3 _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-10-18 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3KA4 'Frog M-ferritin with cobalt' unspecified PDB 3KA6 'Frog M-ferritin, EED mutant, with cobalt' unspecified PDB 3KA8 'Frog M-ferritin, EQH mutant, with cobalt' unspecified PDB 3KA9 'Frog M-ferritin, EEH mutant, with cobalt' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tosha, T.' 1 'Ng, H.L.' 2 'Theil, E.' 3 'Alber, T.' 4 'Bhattasali, O.' 5 # _citation.id primary _citation.title 'Moving Metal Ions through Ferritin-Protein Nanocages from Three-Fold Pores to Catalytic Sites.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 132 _citation.page_first 14562 _citation.page_last 14569 _citation.year 2010 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20866049 _citation.pdbx_database_id_DOI 10.1021/ja105583d # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tosha, T.' 1 ? primary 'Ng, H.L.' 2 ? primary 'Bhattasali, O.' 3 ? primary 'Alber, T.' 4 ? primary 'Theil, E.C.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin, middle subunit' 20623.182 1 1.16.3.1 ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 10 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 7 ? ? ? ? 4 water nat water 18.015 292 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Ferritin M, Ferritin H', Ferritin X ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQ DIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPEN GMGEYLFDKHSVKESS ; _entity_poly.pdbx_seq_one_letter_code_can ;MVSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQ DIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPEN GMGEYLFDKHSVKESS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 SER n 1 4 GLN n 1 5 VAL n 1 6 ARG n 1 7 GLN n 1 8 ASN n 1 9 TYR n 1 10 HIS n 1 11 SER n 1 12 ASP n 1 13 CYS n 1 14 GLU n 1 15 ALA n 1 16 ALA n 1 17 VAL n 1 18 ASN n 1 19 ARG n 1 20 MET n 1 21 LEU n 1 22 ASN n 1 23 LEU n 1 24 GLU n 1 25 LEU n 1 26 TYR n 1 27 ALA n 1 28 SER n 1 29 TYR n 1 30 THR n 1 31 TYR n 1 32 SER n 1 33 SER n 1 34 MET n 1 35 TYR n 1 36 ALA n 1 37 PHE n 1 38 PHE n 1 39 ASP n 1 40 ARG n 1 41 ASP n 1 42 ASP n 1 43 VAL n 1 44 ALA n 1 45 LEU n 1 46 HIS n 1 47 ASN n 1 48 VAL n 1 49 ALA n 1 50 GLU n 1 51 PHE n 1 52 PHE n 1 53 LYS n 1 54 GLU n 1 55 HIS n 1 56 SER n 1 57 HIS n 1 58 GLU n 1 59 GLU n 1 60 ARG n 1 61 GLU n 1 62 HIS n 1 63 ALA n 1 64 GLU n 1 65 LYS n 1 66 PHE n 1 67 MET n 1 68 LYS n 1 69 TYR n 1 70 GLN n 1 71 ASN n 1 72 LYS n 1 73 ARG n 1 74 GLY n 1 75 GLY n 1 76 ARG n 1 77 VAL n 1 78 VAL n 1 79 LEU n 1 80 GLN n 1 81 ASP n 1 82 ILE n 1 83 LYS n 1 84 LYS n 1 85 PRO n 1 86 GLU n 1 87 ARG n 1 88 ASP n 1 89 GLU n 1 90 TRP n 1 91 GLY n 1 92 ASN n 1 93 THR n 1 94 LEU n 1 95 GLU n 1 96 ALA n 1 97 MET n 1 98 GLN n 1 99 ALA n 1 100 ALA n 1 101 LEU n 1 102 GLN n 1 103 LEU n 1 104 GLU n 1 105 LYS n 1 106 THR n 1 107 VAL n 1 108 ASN n 1 109 GLN n 1 110 ALA n 1 111 LEU n 1 112 LEU n 1 113 ASP n 1 114 LEU n 1 115 HIS n 1 116 LYS n 1 117 LEU n 1 118 ALA n 1 119 THR n 1 120 ASP n 1 121 LYS n 1 122 VAL n 1 123 ASP n 1 124 PRO n 1 125 HIS n 1 126 LEU n 1 127 CYS n 1 128 ASP n 1 129 PHE n 1 130 LEU n 1 131 GLU n 1 132 SER n 1 133 GLU n 1 134 TYR n 1 135 LEU n 1 136 GLU n 1 137 GLU n 1 138 GLN n 1 139 VAL n 1 140 LYS n 1 141 ASP n 1 142 ILE n 1 143 LYS n 1 144 ARG n 1 145 ILE n 1 146 GLY n 1 147 ASP n 1 148 PHE n 1 149 ILE n 1 150 THR n 1 151 ASN n 1 152 LEU n 1 153 LYS n 1 154 ARG n 1 155 LEU n 1 156 GLY n 1 157 LEU n 1 158 PRO n 1 159 GLU n 1 160 ASN n 1 161 GLY n 1 162 MET n 1 163 GLY n 1 164 GLU n 1 165 TYR n 1 166 LEU n 1 167 PHE n 1 168 ASP n 1 169 LYS n 1 170 HIS n 1 171 SER n 1 172 VAL n 1 173 LYS n 1 174 GLU n 1 175 SER n 1 176 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name bullfrog _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rana catesbeiana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8400 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 VAL 2 1 1 VAL VAL A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 GLN 4 3 3 GLN GLN A . n A 1 5 VAL 5 4 4 VAL VAL A . n A 1 6 ARG 6 5 5 ARG ARG A . n A 1 7 GLN 7 6 6 GLN GLN A . n A 1 8 ASN 8 7 7 ASN ASN A . n A 1 9 TYR 9 8 8 TYR TYR A . n A 1 10 HIS 10 9 9 HIS HIS A . n A 1 11 SER 11 10 10 SER SER A . n A 1 12 ASP 12 11 11 ASP ASP A . n A 1 13 CYS 13 12 12 CYS CYS A . n A 1 14 GLU 14 13 13 GLU GLU A . n A 1 15 ALA 15 14 14 ALA ALA A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 VAL 17 16 16 VAL VAL A . n A 1 18 ASN 18 17 17 ASN ASN A . n A 1 19 ARG 19 18 18 ARG ARG A . n A 1 20 MET 20 19 19 MET MET A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 LEU 23 22 22 LEU LEU A . n A 1 24 GLU 24 23 23 GLU GLU A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 TYR 26 25 25 TYR TYR A . n A 1 27 ALA 27 26 26 ALA ALA A . n A 1 28 SER 28 27 27 SER SER A . n A 1 29 TYR 29 28 28 TYR TYR A . n A 1 30 THR 30 29 29 THR THR A . n A 1 31 TYR 31 30 30 TYR TYR A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 SER 33 32 32 SER SER A . n A 1 34 MET 34 33 33 MET MET A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 ALA 36 35 35 ALA ALA A . n A 1 37 PHE 37 36 36 PHE PHE A . n A 1 38 PHE 38 37 37 PHE PHE A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 ARG 40 39 39 ARG ARG A . n A 1 41 ASP 41 40 40 ASP ASP A . n A 1 42 ASP 42 41 41 ASP ASP A . n A 1 43 VAL 43 42 42 VAL VAL A . n A 1 44 ALA 44 43 43 ALA ALA A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 HIS 46 45 45 HIS HIS A . n A 1 47 ASN 47 46 46 ASN ASN A . n A 1 48 VAL 48 47 47 VAL VAL A . n A 1 49 ALA 49 48 48 ALA ALA A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 PHE 51 50 50 PHE PHE A . n A 1 52 PHE 52 51 51 PHE PHE A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 GLU 54 53 53 GLU GLU A . n A 1 55 HIS 55 54 54 HIS HIS A . n A 1 56 SER 56 55 55 SER SER A . n A 1 57 HIS 57 56 56 HIS HIS A . n A 1 58 GLU 58 57 57 GLU GLU A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 ARG 60 59 59 ARG ARG A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 HIS 62 61 61 HIS HIS A . n A 1 63 ALA 63 62 62 ALA ALA A . n A 1 64 GLU 64 63 63 GLU GLU A . n A 1 65 LYS 65 64 64 LYS LYS A . n A 1 66 PHE 66 65 65 PHE PHE A . n A 1 67 MET 67 66 66 MET MET A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 TYR 69 68 68 TYR TYR A . n A 1 70 GLN 70 69 69 GLN GLN A . n A 1 71 ASN 71 70 70 ASN ASN A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 ARG 73 72 72 ARG ARG A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 GLY 75 74 74 GLY GLY A . n A 1 76 ARG 76 75 75 ARG ARG A . n A 1 77 VAL 77 76 76 VAL VAL A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 LEU 79 78 78 LEU LEU A . n A 1 80 GLN 80 79 79 GLN GLN A . n A 1 81 ASP 81 80 80 ASP ASP A . n A 1 82 ILE 82 81 81 ILE ILE A . n A 1 83 LYS 83 82 82 LYS LYS A . n A 1 84 LYS 84 83 83 LYS LYS A . n A 1 85 PRO 85 84 84 PRO PRO A . n A 1 86 GLU 86 85 85 GLU GLU A . n A 1 87 ARG 87 86 86 ARG ARG A . n A 1 88 ASP 88 87 87 ASP ASP A . n A 1 89 GLU 89 88 88 GLU GLU A . n A 1 90 TRP 90 89 89 TRP TRP A . n A 1 91 GLY 91 90 90 GLY GLY A . n A 1 92 ASN 92 91 91 ASN ASN A . n A 1 93 THR 93 92 92 THR THR A . n A 1 94 LEU 94 93 93 LEU LEU A . n A 1 95 GLU 95 94 94 GLU GLU A . n A 1 96 ALA 96 95 95 ALA ALA A . n A 1 97 MET 97 96 96 MET MET A . n A 1 98 GLN 98 97 97 GLN GLN A . n A 1 99 ALA 99 98 98 ALA ALA A . n A 1 100 ALA 100 99 99 ALA ALA A . n A 1 101 LEU 101 100 100 LEU LEU A . n A 1 102 GLN 102 101 101 GLN GLN A . n A 1 103 LEU 103 102 102 LEU LEU A . n A 1 104 GLU 104 103 103 GLU GLU A . n A 1 105 LYS 105 104 104 LYS LYS A . n A 1 106 THR 106 105 105 THR THR A . n A 1 107 VAL 107 106 106 VAL VAL A . n A 1 108 ASN 108 107 107 ASN ASN A . n A 1 109 GLN 109 108 108 GLN GLN A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 LEU 111 110 110 LEU LEU A . n A 1 112 LEU 112 111 111 LEU LEU A . n A 1 113 ASP 113 112 112 ASP ASP A . n A 1 114 LEU 114 113 113 LEU LEU A . n A 1 115 HIS 115 114 114 HIS HIS A . n A 1 116 LYS 116 115 115 LYS LYS A . n A 1 117 LEU 117 116 116 LEU LEU A . n A 1 118 ALA 118 117 117 ALA ALA A . n A 1 119 THR 119 118 118 THR THR A . n A 1 120 ASP 120 119 119 ASP ASP A . n A 1 121 LYS 121 120 120 LYS LYS A . n A 1 122 VAL 122 121 121 VAL VAL A . n A 1 123 ASP 123 122 122 ASP ASP A . n A 1 124 PRO 124 123 123 PRO PRO A . n A 1 125 HIS 125 124 124 HIS HIS A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 CYS 127 126 126 CYS CYS A . n A 1 128 ASP 128 127 127 ASP ASP A . n A 1 129 PHE 129 128 128 PHE PHE A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 GLU 131 130 130 GLU GLU A . n A 1 132 SER 132 131 131 SER SER A . n A 1 133 GLU 133 132 132 GLU GLU A . n A 1 134 TYR 134 133 133 TYR TYR A . n A 1 135 LEU 135 134 134 LEU LEU A . n A 1 136 GLU 136 135 135 GLU GLU A . n A 1 137 GLU 137 136 136 GLU GLU A . n A 1 138 GLN 138 137 137 GLN GLN A . n A 1 139 VAL 139 138 138 VAL VAL A . n A 1 140 LYS 140 139 139 LYS LYS A . n A 1 141 ASP 141 140 140 ASP ASP A . n A 1 142 ILE 142 141 141 ILE ILE A . n A 1 143 LYS 143 142 142 LYS LYS A . n A 1 144 ARG 144 143 143 ARG ARG A . n A 1 145 ILE 145 144 144 ILE ILE A . n A 1 146 GLY 146 145 145 GLY GLY A . n A 1 147 ASP 147 146 146 ASP ASP A . n A 1 148 PHE 148 147 147 PHE PHE A . n A 1 149 ILE 149 148 148 ILE ILE A . n A 1 150 THR 150 149 149 THR THR A . n A 1 151 ASN 151 150 150 ASN ASN A . n A 1 152 LEU 152 151 151 LEU LEU A . n A 1 153 LYS 153 152 152 LYS LYS A . n A 1 154 ARG 154 153 153 ARG ARG A . n A 1 155 LEU 155 154 154 LEU LEU A . n A 1 156 GLY 156 155 155 GLY GLY A . n A 1 157 LEU 157 156 156 LEU LEU A . n A 1 158 PRO 158 157 157 PRO PRO A . n A 1 159 GLU 159 158 158 GLU GLU A . n A 1 160 ASN 160 159 159 ASN ASN A . n A 1 161 GLY 161 160 160 GLY GLY A . n A 1 162 MET 162 161 161 MET MET A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 GLU 164 163 163 GLU GLU A . n A 1 165 TYR 165 164 164 TYR TYR A . n A 1 166 LEU 166 165 165 LEU LEU A . n A 1 167 PHE 167 166 166 PHE PHE A . n A 1 168 ASP 168 167 167 ASP ASP A . n A 1 169 LYS 169 168 168 LYS LYS A . n A 1 170 HIS 170 169 169 HIS HIS A . n A 1 171 SER 171 170 170 SER SER A . n A 1 172 VAL 172 171 171 VAL VAL A . n A 1 173 LYS 173 172 172 LYS LYS A . n A 1 174 GLU 174 173 173 GLU GLU A . n A 1 175 SER 175 174 174 SER SER A . n A 1 176 SER 176 175 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 176 1 MG MG A . C 2 MG 1 177 2 MG MG A . D 2 MG 1 178 3 MG MG A . E 2 MG 1 179 4 MG MG A . F 2 MG 1 180 1 MG MG A . G 3 CL 1 181 1 CL CL A . H 3 CL 1 182 1 CL CL A . I 2 MG 1 183 1 MG MG A . J 3 CL 1 184 1 CL CL A . K 2 MG 1 185 1 MG MG A . L 2 MG 1 186 1 MG MG A . M 3 CL 1 187 1 CL CL A . N 3 CL 1 188 1 CL CL A . O 3 CL 1 189 1 CL CL A . P 2 MG 1 190 1 MG MG A . Q 3 CL 1 191 1 CL CL A . R 2 MG 1 192 1 MG MG A . S 4 HOH 1 193 2 HOH HOH A . S 4 HOH 2 194 194 HOH HOH A . S 4 HOH 3 195 195 HOH HOH A . S 4 HOH 4 196 196 HOH HOH A . S 4 HOH 5 197 197 HOH HOH A . S 4 HOH 6 198 198 HOH HOH A . S 4 HOH 7 199 199 HOH HOH A . S 4 HOH 8 200 200 HOH HOH A . S 4 HOH 9 201 3 HOH HOH A . S 4 HOH 10 202 202 HOH HOH A . S 4 HOH 11 203 203 HOH HOH A . S 4 HOH 12 204 204 HOH HOH A . S 4 HOH 13 205 205 HOH HOH A . S 4 HOH 14 206 6 HOH HOH A . S 4 HOH 15 207 207 HOH HOH A . S 4 HOH 16 208 208 HOH HOH A . S 4 HOH 17 209 209 HOH HOH A . S 4 HOH 18 210 210 HOH HOH A . S 4 HOH 19 211 7 HOH HOH A . S 4 HOH 20 212 212 HOH HOH A . S 4 HOH 21 213 9 HOH HOH A . S 4 HOH 22 214 214 HOH HOH A . S 4 HOH 23 215 215 HOH HOH A . S 4 HOH 24 216 10 HOH HOH A . S 4 HOH 25 217 11 HOH HOH A . S 4 HOH 26 218 218 HOH HOH A . S 4 HOH 27 219 12 HOH HOH A . S 4 HOH 28 220 13 HOH HOH A . S 4 HOH 29 221 221 HOH HOH A . S 4 HOH 30 222 222 HOH HOH A . S 4 HOH 31 223 223 HOH HOH A . S 4 HOH 32 224 224 HOH HOH A . S 4 HOH 33 225 225 HOH HOH A . S 4 HOH 34 226 226 HOH HOH A . S 4 HOH 35 227 227 HOH HOH A . S 4 HOH 36 228 228 HOH HOH A . S 4 HOH 37 229 229 HOH HOH A . S 4 HOH 38 230 230 HOH HOH A . S 4 HOH 39 231 231 HOH HOH A . S 4 HOH 40 232 232 HOH HOH A . S 4 HOH 41 233 233 HOH HOH A . S 4 HOH 42 234 234 HOH HOH A . S 4 HOH 43 235 235 HOH HOH A . S 4 HOH 44 236 236 HOH HOH A . S 4 HOH 45 237 237 HOH HOH A . S 4 HOH 46 238 238 HOH HOH A . S 4 HOH 47 239 239 HOH HOH A . S 4 HOH 48 240 240 HOH HOH A . S 4 HOH 49 241 241 HOH HOH A . S 4 HOH 50 242 242 HOH HOH A . S 4 HOH 51 243 243 HOH HOH A . S 4 HOH 52 244 244 HOH HOH A . S 4 HOH 53 245 245 HOH HOH A . S 4 HOH 54 246 246 HOH HOH A . S 4 HOH 55 247 247 HOH HOH A . S 4 HOH 56 248 14 HOH HOH A . S 4 HOH 57 249 15 HOH HOH A . S 4 HOH 58 250 250 HOH HOH A . S 4 HOH 59 251 251 HOH HOH A . S 4 HOH 60 252 252 HOH HOH A . S 4 HOH 61 253 253 HOH HOH A . S 4 HOH 62 254 16 HOH HOH A . S 4 HOH 63 255 255 HOH HOH A . S 4 HOH 64 256 256 HOH HOH A . S 4 HOH 65 257 257 HOH HOH A . S 4 HOH 66 258 258 HOH HOH A . S 4 HOH 67 259 259 HOH HOH A . S 4 HOH 68 260 260 HOH HOH A . S 4 HOH 69 261 261 HOH HOH A . S 4 HOH 70 262 17 HOH HOH A . S 4 HOH 71 263 263 HOH HOH A . S 4 HOH 72 264 18 HOH HOH A . S 4 HOH 73 265 20 HOH HOH A . S 4 HOH 74 266 266 HOH HOH A . S 4 HOH 75 267 267 HOH HOH A . S 4 HOH 76 268 268 HOH HOH A . S 4 HOH 77 269 269 HOH HOH A . S 4 HOH 78 270 270 HOH HOH A . S 4 HOH 79 271 271 HOH HOH A . S 4 HOH 80 272 272 HOH HOH A . S 4 HOH 81 273 273 HOH HOH A . S 4 HOH 82 274 274 HOH HOH A . S 4 HOH 83 275 21 HOH HOH A . S 4 HOH 84 276 276 HOH HOH A . S 4 HOH 85 277 277 HOH HOH A . S 4 HOH 86 278 23 HOH HOH A . S 4 HOH 87 279 24 HOH HOH A . S 4 HOH 88 280 280 HOH HOH A . S 4 HOH 89 281 281 HOH HOH A . S 4 HOH 90 282 282 HOH HOH A . S 4 HOH 91 283 25 HOH HOH A . S 4 HOH 92 284 284 HOH HOH A . S 4 HOH 93 285 285 HOH HOH A . S 4 HOH 94 286 286 HOH HOH A . S 4 HOH 95 287 287 HOH HOH A . S 4 HOH 96 288 288 HOH HOH A . S 4 HOH 97 289 289 HOH HOH A . S 4 HOH 98 290 290 HOH HOH A . S 4 HOH 99 291 26 HOH HOH A . S 4 HOH 100 292 292 HOH HOH A . S 4 HOH 101 293 293 HOH HOH A . S 4 HOH 102 294 294 HOH HOH A . S 4 HOH 103 295 295 HOH HOH A . S 4 HOH 104 296 296 HOH HOH A . S 4 HOH 105 297 27 HOH HOH A . S 4 HOH 106 298 298 HOH HOH A . S 4 HOH 107 299 299 HOH HOH A . S 4 HOH 108 300 300 HOH HOH A . S 4 HOH 109 301 301 HOH HOH A . S 4 HOH 110 302 28 HOH HOH A . S 4 HOH 111 303 29 HOH HOH A . S 4 HOH 112 304 304 HOH HOH A . S 4 HOH 113 305 305 HOH HOH A . S 4 HOH 114 306 306 HOH HOH A . S 4 HOH 115 307 307 HOH HOH A . S 4 HOH 116 308 308 HOH HOH A . S 4 HOH 117 309 30 HOH HOH A . S 4 HOH 118 310 31 HOH HOH A . S 4 HOH 119 311 311 HOH HOH A . S 4 HOH 120 312 312 HOH HOH A . S 4 HOH 121 313 313 HOH HOH A . S 4 HOH 122 314 314 HOH HOH A . S 4 HOH 123 315 315 HOH HOH A . S 4 HOH 124 316 32 HOH HOH A . S 4 HOH 125 317 317 HOH HOH A . S 4 HOH 126 318 318 HOH HOH A . S 4 HOH 127 319 319 HOH HOH A . S 4 HOH 128 320 320 HOH HOH A . S 4 HOH 129 321 321 HOH HOH A . S 4 HOH 130 322 33 HOH HOH A . S 4 HOH 131 323 34 HOH HOH A . S 4 HOH 132 324 35 HOH HOH A . S 4 HOH 133 325 325 HOH HOH A . S 4 HOH 134 326 326 HOH HOH A . S 4 HOH 135 327 327 HOH HOH A . S 4 HOH 136 328 328 HOH HOH A . S 4 HOH 137 329 36 HOH HOH A . S 4 HOH 138 330 330 HOH HOH A . S 4 HOH 139 331 331 HOH HOH A . S 4 HOH 140 332 332 HOH HOH A . S 4 HOH 141 333 333 HOH HOH A . S 4 HOH 142 334 334 HOH HOH A . S 4 HOH 143 335 335 HOH HOH A . S 4 HOH 144 336 336 HOH HOH A . S 4 HOH 145 337 337 HOH HOH A . S 4 HOH 146 338 338 HOH HOH A . S 4 HOH 147 339 37 HOH HOH A . S 4 HOH 148 340 340 HOH HOH A . S 4 HOH 149 341 38 HOH HOH A . S 4 HOH 150 342 342 HOH HOH A . S 4 HOH 151 343 343 HOH HOH A . S 4 HOH 152 344 39 HOH HOH A . S 4 HOH 153 345 40 HOH HOH A . S 4 HOH 154 346 41 HOH HOH A . S 4 HOH 155 347 42 HOH HOH A . S 4 HOH 156 348 43 HOH HOH A . S 4 HOH 157 349 44 HOH HOH A . S 4 HOH 158 350 45 HOH HOH A . S 4 HOH 159 351 46 HOH HOH A . S 4 HOH 160 352 47 HOH HOH A . S 4 HOH 161 353 48 HOH HOH A . S 4 HOH 162 354 49 HOH HOH A . S 4 HOH 163 355 50 HOH HOH A . S 4 HOH 164 356 51 HOH HOH A . S 4 HOH 165 357 52 HOH HOH A . S 4 HOH 166 358 53 HOH HOH A . S 4 HOH 167 359 54 HOH HOH A . S 4 HOH 168 360 55 HOH HOH A . S 4 HOH 169 361 56 HOH HOH A . S 4 HOH 170 362 57 HOH HOH A . S 4 HOH 171 363 58 HOH HOH A . S 4 HOH 172 364 59 HOH HOH A . S 4 HOH 173 365 60 HOH HOH A . S 4 HOH 174 366 61 HOH HOH A . S 4 HOH 175 367 62 HOH HOH A . S 4 HOH 176 368 63 HOH HOH A . S 4 HOH 177 369 64 HOH HOH A . S 4 HOH 178 370 65 HOH HOH A . S 4 HOH 179 371 66 HOH HOH A . S 4 HOH 180 372 67 HOH HOH A . S 4 HOH 181 373 69 HOH HOH A . S 4 HOH 182 374 70 HOH HOH A . S 4 HOH 183 375 71 HOH HOH A . S 4 HOH 184 376 72 HOH HOH A . S 4 HOH 185 377 73 HOH HOH A . S 4 HOH 186 378 75 HOH HOH A . S 4 HOH 187 379 76 HOH HOH A . S 4 HOH 188 380 77 HOH HOH A . S 4 HOH 189 381 78 HOH HOH A . S 4 HOH 190 382 79 HOH HOH A . S 4 HOH 191 383 80 HOH HOH A . S 4 HOH 192 384 83 HOH HOH A . S 4 HOH 193 385 84 HOH HOH A . S 4 HOH 194 386 85 HOH HOH A . S 4 HOH 195 387 86 HOH HOH A . S 4 HOH 196 388 87 HOH HOH A . S 4 HOH 197 389 88 HOH HOH A . S 4 HOH 198 390 89 HOH HOH A . S 4 HOH 199 391 90 HOH HOH A . S 4 HOH 200 392 91 HOH HOH A . S 4 HOH 201 393 92 HOH HOH A . S 4 HOH 202 394 93 HOH HOH A . S 4 HOH 203 395 94 HOH HOH A . S 4 HOH 204 396 95 HOH HOH A . S 4 HOH 205 397 96 HOH HOH A . S 4 HOH 206 398 97 HOH HOH A . S 4 HOH 207 399 98 HOH HOH A . S 4 HOH 208 400 99 HOH HOH A . S 4 HOH 209 401 100 HOH HOH A . S 4 HOH 210 402 101 HOH HOH A . S 4 HOH 211 403 102 HOH HOH A . S 4 HOH 212 404 103 HOH HOH A . S 4 HOH 213 405 104 HOH HOH A . S 4 HOH 214 406 105 HOH HOH A . S 4 HOH 215 407 106 HOH HOH A . S 4 HOH 216 408 107 HOH HOH A . S 4 HOH 217 409 108 HOH HOH A . S 4 HOH 218 410 109 HOH HOH A . S 4 HOH 219 411 110 HOH HOH A . S 4 HOH 220 412 111 HOH HOH A . S 4 HOH 221 413 112 HOH HOH A . S 4 HOH 222 414 113 HOH HOH A . S 4 HOH 223 415 114 HOH HOH A . S 4 HOH 224 416 115 HOH HOH A . S 4 HOH 225 417 116 HOH HOH A . S 4 HOH 226 418 117 HOH HOH A . S 4 HOH 227 419 118 HOH HOH A . S 4 HOH 228 420 119 HOH HOH A . S 4 HOH 229 421 120 HOH HOH A . S 4 HOH 230 422 121 HOH HOH A . S 4 HOH 231 423 122 HOH HOH A . S 4 HOH 232 424 123 HOH HOH A . S 4 HOH 233 425 125 HOH HOH A . S 4 HOH 234 426 126 HOH HOH A . S 4 HOH 235 427 127 HOH HOH A . S 4 HOH 236 428 128 HOH HOH A . S 4 HOH 237 429 129 HOH HOH A . S 4 HOH 238 430 130 HOH HOH A . S 4 HOH 239 431 132 HOH HOH A . S 4 HOH 240 432 133 HOH HOH A . S 4 HOH 241 433 134 HOH HOH A . S 4 HOH 242 434 135 HOH HOH A . S 4 HOH 243 435 136 HOH HOH A . S 4 HOH 244 436 137 HOH HOH A . S 4 HOH 245 437 138 HOH HOH A . S 4 HOH 246 438 139 HOH HOH A . S 4 HOH 247 439 140 HOH HOH A . S 4 HOH 248 440 141 HOH HOH A . S 4 HOH 249 441 142 HOH HOH A . S 4 HOH 250 442 143 HOH HOH A . S 4 HOH 251 443 146 HOH HOH A . S 4 HOH 252 444 147 HOH HOH A . S 4 HOH 253 445 148 HOH HOH A . S 4 HOH 254 446 149 HOH HOH A . S 4 HOH 255 447 150 HOH HOH A . S 4 HOH 256 448 151 HOH HOH A . S 4 HOH 257 449 152 HOH HOH A . S 4 HOH 258 450 153 HOH HOH A . S 4 HOH 259 451 154 HOH HOH A . S 4 HOH 260 452 155 HOH HOH A . S 4 HOH 261 453 156 HOH HOH A . S 4 HOH 262 454 157 HOH HOH A . S 4 HOH 263 455 159 HOH HOH A . S 4 HOH 264 456 160 HOH HOH A . S 4 HOH 265 457 161 HOH HOH A . S 4 HOH 266 458 162 HOH HOH A . S 4 HOH 267 459 163 HOH HOH A . S 4 HOH 268 460 164 HOH HOH A . S 4 HOH 269 461 165 HOH HOH A . S 4 HOH 270 462 167 HOH HOH A . S 4 HOH 271 463 168 HOH HOH A . S 4 HOH 272 464 169 HOH HOH A . S 4 HOH 273 465 171 HOH HOH A . S 4 HOH 274 466 172 HOH HOH A . S 4 HOH 275 467 173 HOH HOH A . S 4 HOH 276 468 174 HOH HOH A . S 4 HOH 277 469 175 HOH HOH A . S 4 HOH 278 470 176 HOH HOH A . S 4 HOH 279 471 177 HOH HOH A . S 4 HOH 280 472 180 HOH HOH A . S 4 HOH 281 473 181 HOH HOH A . S 4 HOH 282 474 182 HOH HOH A . S 4 HOH 283 475 183 HOH HOH A . S 4 HOH 284 476 184 HOH HOH A . S 4 HOH 285 477 185 HOH HOH A . S 4 HOH 286 478 186 HOH HOH A . S 4 HOH 287 479 187 HOH HOH A . S 4 HOH 288 480 188 HOH HOH A . S 4 HOH 289 481 189 HOH HOH A . S 4 HOH 290 482 190 HOH HOH A . S 4 HOH 291 483 191 HOH HOH A . S 4 HOH 292 484 192 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 173 ? CG ? A GLU 174 CG 2 1 Y 1 A GLU 173 ? CD ? A GLU 174 CD 3 1 Y 1 A GLU 173 ? OE1 ? A GLU 174 OE1 4 1 Y 1 A GLU 173 ? OE2 ? A GLU 174 OE2 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 MOSFLM . ? package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk 'data reduction' http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ? ? 2 SCALA 3.2.5 5/04/2004 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 3 REFMAC 5.4.0077 ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 PDB_EXTRACT 3.005 'June 11, 2008' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 6 PHASER . ? ? ? ? phasing ? ? ? # _cell.length_a 183.886 _cell.length_b 183.886 _cell.length_c 183.886 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 3KA3 _cell.pdbx_unique_axis ? _cell.Z_PDB 96 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.entry_id 3KA3 _symmetry.Int_Tables_number 209 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 3KA3 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 60.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.temp 277 _exptl_crystal_grow.pdbx_details '2M MgCl2, 0.1M Bicine pH 9.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details 'Mirror 1: plane parabola Pt and Rh-coated Invar steel. Mirror 2: torroid Pt and Rh-coated Si' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'KOHZU: Double crystal Si(111)' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.1159 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.pdbx_wavelength_list 1.1159 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.3.1 # _reflns.entry_id 3KA3 _reflns.d_resolution_high 1.40 _reflns.d_resolution_low 50.0 _reflns.number_obs 52741 _reflns.pdbx_Rmerge_I_obs 0.088 _reflns.pdbx_netI_over_sigmaI 21.200 _reflns.pdbx_Rsym_value 0.088 _reflns.pdbx_redundancy 13.600 _reflns.percent_possible_obs 100.000 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.40 1.48 ? 103581 ? 0.969 0.8 0.969 ? 13.70 ? 7566 100.00 ? 1 1.48 1.57 ? 98606 ? 0.572 1.3 0.572 ? 13.80 ? 7155 100.00 ? 2 1.57 1.67 ? 93168 ? 0.379 2.0 0.379 ? 13.80 ? 6739 100.00 ? 3 1.67 1.81 ? 87266 ? 0.255 2.9 0.255 ? 13.80 ? 6313 100.00 ? 4 1.81 1.98 ? 80465 ? 0.158 4.7 0.158 ? 13.80 ? 5832 100.00 ? 5 1.98 2.21 ? 72534 ? 0.097 7.4 0.097 ? 13.70 ? 5287 100.00 ? 6 2.21 2.56 ? 63606 ? 0.080 8.5 0.080 ? 13.50 ? 4725 100.00 ? 7 2.56 3.13 ? 51041 ? 0.054 12.7 0.054 ? 12.70 ? 4034 100.00 ? 8 3.13 4.43 ? 43064 ? 0.039 13.0 0.039 ? 13.50 ? 3186 100.00 ? 9 4.43 50.0 ? 23618 ? 0.038 10.7 0.038 ? 12.40 ? 1904 100.00 ? 10 # _refine.entry_id 3KA3 _refine.ls_d_res_high 1.40 _refine.ls_d_res_low 50.0 _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.990 _refine.ls_number_reflns_obs 52741 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details '1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. 2. U VALUES: REFINED INDIVIDUALLY.' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.137 _refine.ls_R_factor_R_work 0.136 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.159 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 2689 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 16.983 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc 0.976 _refine.correlation_coeff_Fo_to_Fc_free 0.973 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.046 _refine.pdbx_overall_ESU_R_Free 0.044 _refine.overall_SU_ML 0.024 _refine.overall_SU_B 1.374 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 67.09 _refine.B_iso_min 5.62 _refine.occupancy_max 1.00 _refine.occupancy_min 0.25 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1429 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 292 _refine_hist.number_atoms_total 1738 _refine_hist.d_res_high 1.40 _refine_hist.d_res_low 50.0 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1610 0.028 0.021 ? 'X-RAY DIFFRACTION' ? r_bond_other_d 1129 0.001 0.020 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2201 2.141 1.953 ? 'X-RAY DIFFRACTION' ? r_angle_other_deg 2779 1.724 3.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 214 4.754 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 94 38.192 24.787 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 319 14.292 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 11 15.940 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 232 0.137 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1851 0.013 0.020 ? 'X-RAY DIFFRACTION' ? r_gen_planes_other 335 0.003 0.020 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 937 2.243 1.500 ? 'X-RAY DIFFRACTION' ? r_mcbond_other 375 0.964 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1529 3.026 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 673 5.375 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 648 7.613 4.500 ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 2739 2.700 3.000 ? 'X-RAY DIFFRACTION' ? r_sphericity_free 309 15.282 3.000 ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded 2684 4.740 3.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.400 _refine_ls_shell.d_res_low 1.436 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.000 _refine_ls_shell.number_reflns_R_work 3605 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.398 _refine_ls_shell.R_factor_R_free 0.438 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 210 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 3815 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3KA3 _struct.title 'Frog M-ferritin with magnesium' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3KA3 _struct_keywords.text 'IRON STORAGE, DIIRON, Iron, Metal-binding, Oxidoreductase' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 3 ? I N N 2 ? J N N 3 ? K N N 2 ? L N N 2 ? M N N 3 ? N N N 3 ? O N N 3 ? P N N 2 ? Q N N 3 ? R N N 2 ? S N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRI2_RANCA _struct_ref.pdbx_db_accession P07798 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVSQVRQNYHSDCEAAVNRMLNLELYASYTYSSMYAFFDRDDVALHNVAEFFKEHSHEEREHAEKFMKYQNKRGGRVVLQ DIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLATDKVDPHLCDFLESEYLEEQVKDIKRIGDFITNLKRLGLPEN GMGEYLFDKHSVKESS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3KA3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 176 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07798 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 176 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 175 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details 24-meric _pdbx_struct_assembly.oligomeric_count 24 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 94400 ? 1 MORE -293 ? 1 'SSA (A^2)' 136630 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_575 -x,-y+2,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 367.7720000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_557 -x,y,-z+2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 367.7720000000 4 'crystal symmetry operation' 4_577 x,-y+2,-z+2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 367.7720000000 0.0000000000 0.0000000000 -1.0000000000 367.7720000000 5 'crystal symmetry operation' 5_465 z-1,x+1,y 0.0000000000 0.0000000000 1.0000000000 -183.8860000000 1.0000000000 0.0000000000 0.0000000000 183.8860000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_467 z-1,-x+1,-y+2 0.0000000000 0.0000000000 1.0000000000 -183.8860000000 -1.0000000000 0.0000000000 0.0000000000 183.8860000000 0.0000000000 -1.0000000000 0.0000000000 367.7720000000 7 'crystal symmetry operation' 7_665 -z+1,-x+1,y 0.0000000000 0.0000000000 -1.0000000000 183.8860000000 -1.0000000000 0.0000000000 0.0000000000 183.8860000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_667 -z+1,x+1,-y+2 0.0000000000 0.0000000000 -1.0000000000 183.8860000000 1.0000000000 0.0000000000 0.0000000000 183.8860000000 0.0000000000 -1.0000000000 0.0000000000 367.7720000000 9 'crystal symmetry operation' 9_456 y-1,z,x+1 0.0000000000 1.0000000000 0.0000000000 -183.8860000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 183.8860000000 10 'crystal symmetry operation' 10_656 -y+1,z,-x+1 0.0000000000 -1.0000000000 0.0000000000 183.8860000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 183.8860000000 11 'crystal symmetry operation' 11_476 y-1,-z+2,-x+1 0.0000000000 1.0000000000 0.0000000000 -183.8860000000 0.0000000000 0.0000000000 -1.0000000000 367.7720000000 -1.0000000000 0.0000000000 0.0000000000 183.8860000000 12 'crystal symmetry operation' 12_676 -y+1,-z+2,x+1 0.0000000000 -1.0000000000 0.0000000000 183.8860000000 0.0000000000 0.0000000000 -1.0000000000 367.7720000000 1.0000000000 0.0000000000 0.0000000000 183.8860000000 13 'crystal symmetry operation' 13_467 y-1,x+1,-z+2 0.0000000000 1.0000000000 0.0000000000 -183.8860000000 1.0000000000 0.0000000000 0.0000000000 183.8860000000 0.0000000000 0.0000000000 -1.0000000000 367.7720000000 14 'crystal symmetry operation' 14_667 -y+1,-x+1,-z+2 0.0000000000 -1.0000000000 0.0000000000 183.8860000000 -1.0000000000 0.0000000000 0.0000000000 183.8860000000 0.0000000000 0.0000000000 -1.0000000000 367.7720000000 15 'crystal symmetry operation' 15_465 y-1,-x+1,z 0.0000000000 1.0000000000 0.0000000000 -183.8860000000 -1.0000000000 0.0000000000 0.0000000000 183.8860000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_665 -y+1,x+1,z 0.0000000000 -1.0000000000 0.0000000000 183.8860000000 1.0000000000 0.0000000000 0.0000000000 183.8860000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_557 x,z,-y+2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 367.7720000000 18 'crystal symmetry operation' 18_555 -x,z,y -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_577 -x,-z+2,-y+2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 367.7720000000 0.0000000000 -1.0000000000 0.0000000000 367.7720000000 20 'crystal symmetry operation' 20_575 x,-z+2,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 367.7720000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_456 z-1,y,-x+1 0.0000000000 0.0000000000 1.0000000000 -183.8860000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 183.8860000000 22 'crystal symmetry operation' 22_476 z-1,-y+2,x+1 0.0000000000 0.0000000000 1.0000000000 -183.8860000000 0.0000000000 -1.0000000000 0.0000000000 367.7720000000 1.0000000000 0.0000000000 0.0000000000 183.8860000000 23 'crystal symmetry operation' 23_656 -z+1,y,x+1 0.0000000000 0.0000000000 -1.0000000000 183.8860000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 183.8860000000 24 'crystal symmetry operation' 24_676 -z+1,-y+2,-x+1 0.0000000000 0.0000000000 -1.0000000000 183.8860000000 0.0000000000 -1.0000000000 0.0000000000 367.7720000000 -1.0000000000 0.0000000000 0.0000000000 183.8860000000 # _struct_biol.id 1 _struct_biol.details 'Biological unit is a 24-mer generated by F432 symmetry' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 10 ? ARG A 40 ? HIS A 9 ARG A 39 1 ? 31 HELX_P HELX_P2 2 LEU A 45 ? GLY A 74 ? LEU A 44 GLY A 73 1 ? 30 HELX_P HELX_P3 3 ASN A 92 ? LYS A 121 ? ASN A 91 LYS A 120 1 ? 30 HELX_P HELX_P4 4 ASP A 123 ? TYR A 134 ? ASP A 122 TYR A 133 1 ? 12 HELX_P HELX_P5 5 TYR A 134 ? LEU A 155 ? TYR A 133 LEU A 154 1 ? 22 HELX_P HELX_P6 6 ASN A 160 ? SER A 171 ? ASN A 159 SER A 170 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 11 OG ? ? ? 1_555 C MG . MG ? ? A SER 10 A MG 177 1_555 ? ? ? ? ? ? ? 2.057 ? ? metalc2 metalc ? ? A GLU 58 OE2 ? ? ? 1_555 B MG . MG ? ? A GLU 57 A MG 176 1_555 ? ? ? ? ? ? ? 1.863 ? ? metalc3 metalc ? ? A GLU 104 OE1 ? ? ? 1_555 F MG . MG ? ? A GLU 103 A MG 180 1_555 ? ? ? ? ? ? ? 1.949 ? ? metalc4 metalc ? ? A GLU 137 OE1 A ? ? 1_555 B MG . MG ? ? A GLU 136 A MG 176 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc5 metalc ? ? A GLU 137 OE2 A ? ? 1_555 R MG . MG ? ? A GLU 136 A MG 192 1_555 ? ? ? ? ? ? ? 1.985 ? ? metalc6 metalc ? ? A GLN 138 OE1 ? ? ? 1_555 F MG . MG ? ? A GLN 137 A MG 180 1_555 ? ? ? ? ? ? ? 2.704 ? ? metalc7 metalc ? ? A GLN 138 OE1 ? ? ? 1_555 R MG . MG ? ? A GLN 137 A MG 192 1_555 ? ? ? ? ? ? ? 1.949 ? ? metalc8 metalc ? ? A ASP 141 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 140 A MG 176 1_555 ? ? ? ? ? ? ? 2.443 ? ? metalc9 metalc ? ? A ASP 141 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 140 A MG 176 1_555 ? ? ? ? ? ? ? 2.940 ? ? metalc10 metalc ? ? A ASP 141 OD2 ? ? ? 1_555 F MG . MG ? ? A ASP 140 A MG 180 1_555 ? ? ? ? ? ? ? 2.620 ? ? metalc11 metalc ? ? B MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 176 A HOH 379 1_555 ? ? ? ? ? ? ? 2.142 ? ? metalc12 metalc ? ? B MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 176 A HOH 446 1_555 ? ? ? ? ? ? ? 1.949 ? ? metalc13 metalc ? ? B MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 176 A HOH 453 1_555 ? ? ? ? ? ? ? 2.060 ? ? metalc14 metalc ? ? C MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 177 A HOH 345 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc15 metalc ? ? C MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 177 A HOH 381 1_555 ? ? ? ? ? ? ? 2.038 ? ? metalc16 metalc ? ? C MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 177 A HOH 394 1_555 ? ? ? ? ? ? ? 2.017 ? ? metalc17 metalc ? ? C MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 177 A HOH 413 1_555 ? ? ? ? ? ? ? 2.129 ? ? metalc18 metalc ? ? C MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 177 A HOH 428 1_555 ? ? ? ? ? ? ? 2.011 ? ? metalc19 metalc ? ? D MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 178 A HOH 416 1_555 ? ? ? ? ? ? ? 2.091 ? ? metalc20 metalc ? ? D MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 178 A HOH 435 1_555 ? ? ? ? ? ? ? 1.970 ? ? metalc21 metalc ? ? D MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 178 A HOH 445 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc22 metalc ? ? E MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 179 A HOH 310 1_555 ? ? ? ? ? ? ? 2.155 ? ? metalc23 metalc ? ? E MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 179 A HOH 349 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc24 metalc ? ? F MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 180 A HOH 338 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc25 metalc ? ? F MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 180 A HOH 411 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc26 metalc ? ? F MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 180 A HOH 478 1_555 ? ? ? ? ? ? ? 2.512 ? ? metalc27 metalc ? ? I MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 183 A HOH 239 1_555 ? ? ? ? ? ? ? 2.362 ? ? metalc28 metalc ? ? I MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 183 A HOH 250 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc29 metalc ? ? I MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 183 A HOH 483 1_555 ? ? ? ? ? ? ? 2.062 ? ? metalc30 metalc ? ? K MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 185 A HOH 333 1_555 ? ? ? ? ? ? ? 1.719 ? ? metalc31 metalc ? ? K MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 185 A HOH 361 1_555 ? ? ? ? ? ? ? 1.843 ? ? metalc32 metalc ? ? L MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 186 A HOH 360 1_555 ? ? ? ? ? ? ? 2.144 ? ? metalc33 metalc ? ? L MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 186 A HOH 363 1_555 ? ? ? ? ? ? ? 2.148 ? ? metalc34 metalc ? ? P MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 190 A HOH 342 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc35 metalc ? ? P MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 190 A HOH 432 1_555 ? ? ? ? ? ? ? 2.145 ? ? metalc36 metalc ? ? R MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 192 A HOH 411 1_555 ? ? ? ? ? ? ? 2.552 ? ? metalc37 metalc ? ? R MG . MG ? ? ? 1_555 S HOH . O ? ? A MG 192 A HOH 423 1_555 ? ? ? ? ? ? ? 2.162 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG ? A SER 11 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 345 ? 1_555 86.4 ? 2 OG ? A SER 11 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 381 ? 1_555 88.0 ? 3 O ? S HOH . ? A HOH 345 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 381 ? 1_555 173.1 ? 4 OG ? A SER 11 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 394 ? 1_555 92.6 ? 5 O ? S HOH . ? A HOH 345 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 394 ? 1_555 93.0 ? 6 O ? S HOH . ? A HOH 381 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 394 ? 1_555 91.3 ? 7 OG ? A SER 11 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 413 ? 1_555 85.7 ? 8 O ? S HOH . ? A HOH 345 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 413 ? 1_555 86.9 ? 9 O ? S HOH . ? A HOH 381 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 413 ? 1_555 88.6 ? 10 O ? S HOH . ? A HOH 394 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 413 ? 1_555 178.3 ? 11 OG ? A SER 11 ? A SER 10 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 428 ? 1_555 176.0 ? 12 O ? S HOH . ? A HOH 345 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 428 ? 1_555 92.1 ? 13 O ? S HOH . ? A HOH 381 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 428 ? 1_555 93.2 ? 14 O ? S HOH . ? A HOH 394 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 428 ? 1_555 91.2 ? 15 O ? S HOH . ? A HOH 413 ? 1_555 MG ? C MG . ? A MG 177 ? 1_555 O ? S HOH . ? A HOH 428 ? 1_555 90.5 ? 16 OE2 ? A GLU 58 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 OE1 A A GLU 137 ? A GLU 136 ? 1_555 88.8 ? 17 OE2 ? A GLU 58 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 94.8 ? 18 OE1 A A GLU 137 ? A GLU 136 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 80.4 ? 19 OE2 ? A GLU 58 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 OD1 ? A ASP 141 ? A ASP 140 ? 1_555 119.4 ? 20 OE1 A A GLU 137 ? A GLU 136 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 OD1 ? A ASP 141 ? A ASP 140 ? 1_555 116.9 ? 21 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 OD1 ? A ASP 141 ? A ASP 140 ? 1_555 45.3 ? 22 OE2 ? A GLU 58 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 379 ? 1_555 169.4 ? 23 OE1 A A GLU 137 ? A GLU 136 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 379 ? 1_555 94.3 ? 24 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 379 ? 1_555 95.7 ? 25 OD1 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 379 ? 1_555 68.0 ? 26 OE2 ? A GLU 58 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 446 ? 1_555 94.1 ? 27 OE1 A A GLU 137 ? A GLU 136 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 446 ? 1_555 175.0 ? 28 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 446 ? 1_555 95.3 ? 29 OD1 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 446 ? 1_555 58.1 ? 30 O ? S HOH . ? A HOH 379 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 446 ? 1_555 83.5 ? 31 OE2 ? A GLU 58 ? A GLU 57 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 453 ? 1_555 84.2 ? 32 OE1 A A GLU 137 ? A GLU 136 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 453 ? 1_555 93.5 ? 33 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 453 ? 1_555 173.9 ? 34 OD1 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 453 ? 1_555 140.1 ? 35 O ? S HOH . ? A HOH 379 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 453 ? 1_555 85.5 ? 36 O ? S HOH . ? A HOH 446 ? 1_555 MG ? B MG . ? A MG 176 ? 1_555 O ? S HOH . ? A HOH 453 ? 1_555 90.8 ? 37 OE1 ? A GLU 104 ? A GLU 103 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 OE1 ? A GLN 138 ? A GLN 137 ? 1_555 96.1 ? 38 OE1 ? A GLU 104 ? A GLU 103 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 111.8 ? 39 OE1 ? A GLN 138 ? A GLN 137 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 111.0 ? 40 OE1 ? A GLU 104 ? A GLU 103 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 338 ? 1_555 158.2 ? 41 OE1 ? A GLN 138 ? A GLN 137 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 338 ? 1_555 85.9 ? 42 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 338 ? 1_555 87.4 ? 43 OE1 ? A GLU 104 ? A GLU 103 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 411 ? 1_555 84.3 ? 44 OE1 ? A GLN 138 ? A GLN 137 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 411 ? 1_555 70.0 ? 45 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 411 ? 1_555 163.3 ? 46 O ? S HOH . ? A HOH 338 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 411 ? 1_555 76.0 ? 47 OE1 ? A GLU 104 ? A GLU 103 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 478 ? 1_555 93.2 ? 48 OE1 ? A GLN 138 ? A GLN 137 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 478 ? 1_555 160.9 ? 49 OD2 ? A ASP 141 ? A ASP 140 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 478 ? 1_555 80.6 ? 50 O ? S HOH . ? A HOH 338 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 478 ? 1_555 79.4 ? 51 O ? S HOH . ? A HOH 411 ? 1_555 MG ? F MG . ? A MG 180 ? 1_555 O ? S HOH . ? A HOH 478 ? 1_555 94.5 ? 52 OE2 A A GLU 137 ? A GLU 136 ? 1_555 MG ? R MG . ? A MG 192 ? 1_555 OE1 ? A GLN 138 ? A GLN 137 ? 1_555 98.9 ? 53 OE2 A A GLU 137 ? A GLU 136 ? 1_555 MG ? R MG . ? A MG 192 ? 1_555 O ? S HOH . ? A HOH 411 ? 1_555 175.5 ? 54 OE1 ? A GLN 138 ? A GLN 137 ? 1_555 MG ? R MG . ? A MG 192 ? 1_555 O ? S HOH . ? A HOH 411 ? 1_555 77.7 ? 55 OE2 A A GLU 137 ? A GLU 136 ? 1_555 MG ? R MG . ? A MG 192 ? 1_555 O ? S HOH . ? A HOH 423 ? 1_555 92.3 ? 56 OE1 ? A GLN 138 ? A GLN 137 ? 1_555 MG ? R MG . ? A MG 192 ? 1_555 O ? S HOH . ? A HOH 423 ? 1_555 105.8 ? 57 O ? S HOH . ? A HOH 411 ? 1_555 MG ? R MG . ? A MG 192 ? 1_555 O ? S HOH . ? A HOH 423 ? 1_555 85.8 ? 58 O ? S HOH . ? A HOH 416 ? 1_555 MG ? D MG . ? A MG 178 ? 1_555 O ? S HOH . ? A HOH 435 ? 1_555 87.2 ? 59 O ? S HOH . ? A HOH 416 ? 1_555 MG ? D MG . ? A MG 178 ? 1_555 O ? S HOH . ? A HOH 445 ? 1_555 94.4 ? 60 O ? S HOH . ? A HOH 435 ? 1_555 MG ? D MG . ? A MG 178 ? 1_555 O ? S HOH . ? A HOH 445 ? 1_555 90.2 ? 61 O ? S HOH . ? A HOH 310 ? 1_555 MG ? E MG . ? A MG 179 ? 1_555 O ? S HOH . ? A HOH 349 ? 1_555 83.5 ? 62 O ? S HOH . ? A HOH 239 ? 1_555 MG ? I MG . ? A MG 183 ? 1_555 O ? S HOH . ? A HOH 250 ? 1_555 83.1 ? 63 O ? S HOH . ? A HOH 239 ? 1_555 MG ? I MG . ? A MG 183 ? 1_555 O ? S HOH . ? A HOH 483 ? 1_555 89.9 ? 64 O ? S HOH . ? A HOH 250 ? 1_555 MG ? I MG . ? A MG 183 ? 1_555 O ? S HOH . ? A HOH 483 ? 1_555 90.2 ? 65 O ? S HOH . ? A HOH 333 ? 1_555 MG ? K MG . ? A MG 185 ? 1_555 O ? S HOH . ? A HOH 361 ? 1_555 94.2 ? 66 O ? S HOH . ? A HOH 360 ? 1_555 MG ? L MG . ? A MG 186 ? 1_555 O ? S HOH . ? A HOH 363 ? 1_555 85.5 ? 67 O ? S HOH . ? A HOH 342 ? 1_555 MG ? P MG . ? A MG 190 ? 1_555 O ? S HOH . ? A HOH 432 ? 1_555 82.3 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 157 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 156 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 158 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 157 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.76 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 176 ? 6 'BINDING SITE FOR RESIDUE MG A 176' AC2 Software A MG 177 ? 6 'BINDING SITE FOR RESIDUE MG A 177' AC3 Software A MG 178 ? 6 'BINDING SITE FOR RESIDUE MG A 178' AC4 Software A MG 179 ? 6 'BINDING SITE FOR RESIDUE MG A 179' AC5 Software A MG 180 ? 8 'BINDING SITE FOR RESIDUE MG A 180' AC6 Software A CL 181 ? 1 'BINDING SITE FOR RESIDUE CL A 181' AC7 Software A CL 182 ? 4 'BINDING SITE FOR RESIDUE CL A 182' AC8 Software A MG 183 ? 6 'BINDING SITE FOR RESIDUE MG A 183' AC9 Software A CL 184 ? 2 'BINDING SITE FOR RESIDUE CL A 184' BC1 Software A MG 185 ? 7 'BINDING SITE FOR RESIDUE MG A 185' BC2 Software A MG 186 ? 8 'BINDING SITE FOR RESIDUE MG A 186' BC3 Software A CL 187 ? 6 'BINDING SITE FOR RESIDUE CL A 187' BC4 Software A CL 188 ? 4 'BINDING SITE FOR RESIDUE CL A 188' BC5 Software A MG 190 ? 7 'BINDING SITE FOR RESIDUE MG A 190' BC6 Software A CL 191 ? 5 'BINDING SITE FOR RESIDUE CL A 191' BC7 Software A MG 192 ? 6 'BINDING SITE FOR RESIDUE MG A 192' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 58 ? GLU A 57 . ? 1_555 ? 2 AC1 6 GLU A 137 ? GLU A 136 . ? 1_555 ? 3 AC1 6 ASP A 141 ? ASP A 140 . ? 1_555 ? 4 AC1 6 HOH S . ? HOH A 379 . ? 1_555 ? 5 AC1 6 HOH S . ? HOH A 446 . ? 1_555 ? 6 AC1 6 HOH S . ? HOH A 453 . ? 1_555 ? 7 AC2 6 SER A 11 ? SER A 10 . ? 1_555 ? 8 AC2 6 HOH S . ? HOH A 345 . ? 1_555 ? 9 AC2 6 HOH S . ? HOH A 381 . ? 1_555 ? 10 AC2 6 HOH S . ? HOH A 394 . ? 1_555 ? 11 AC2 6 HOH S . ? HOH A 413 . ? 1_555 ? 12 AC2 6 HOH S . ? HOH A 428 . ? 1_555 ? 13 AC3 6 HOH S . ? HOH A 415 . ? 7_665 ? 14 AC3 6 HOH S . ? HOH A 416 . ? 1_555 ? 15 AC3 6 HOH S . ? HOH A 426 . ? 7_665 ? 16 AC3 6 HOH S . ? HOH A 435 . ? 1_555 ? 17 AC3 6 HOH S . ? HOH A 445 . ? 1_555 ? 18 AC3 6 HOH S . ? HOH A 471 . ? 7_665 ? 19 AC4 6 HOH S . ? HOH A 310 . ? 10_656 ? 20 AC4 6 HOH S . ? HOH A 310 . ? 1_555 ? 21 AC4 6 HOH S . ? HOH A 310 . ? 7_665 ? 22 AC4 6 HOH S . ? HOH A 349 . ? 7_665 ? 23 AC4 6 HOH S . ? HOH A 349 . ? 10_656 ? 24 AC4 6 HOH S . ? HOH A 349 . ? 1_555 ? 25 AC5 8 GLU A 59 ? GLU A 58 . ? 1_555 ? 26 AC5 8 GLU A 104 ? GLU A 103 . ? 1_555 ? 27 AC5 8 GLN A 138 ? GLN A 137 . ? 1_555 ? 28 AC5 8 ASP A 141 ? ASP A 140 . ? 1_555 ? 29 AC5 8 MG R . ? MG A 192 . ? 1_555 ? 30 AC5 8 HOH S . ? HOH A 338 . ? 1_555 ? 31 AC5 8 HOH S . ? HOH A 411 . ? 1_555 ? 32 AC5 8 HOH S . ? HOH A 478 . ? 1_555 ? 33 AC6 1 SER A 11 ? SER A 10 . ? 1_555 ? 34 AC7 4 ARG A 6 ? ARG A 5 . ? 1_555 ? 35 AC7 4 ASN A 8 ? ASN A 7 . ? 1_555 ? 36 AC7 4 TYR A 9 ? TYR A 8 . ? 1_555 ? 37 AC7 4 HOH S . ? HOH A 241 . ? 1_555 ? 38 AC8 6 HOH S . ? HOH A 239 . ? 1_555 ? 39 AC8 6 HOH S . ? HOH A 250 . ? 1_555 ? 40 AC8 6 HOH S . ? HOH A 305 . ? 7_665 ? 41 AC8 6 HOH S . ? HOH A 359 . ? 24_676 ? 42 AC8 6 HOH S . ? HOH A 395 . ? 7_665 ? 43 AC8 6 HOH S . ? HOH A 483 . ? 1_555 ? 44 AC9 2 ASP A 88 ? ASP A 87 . ? 1_555 ? 45 AC9 2 HOH S . ? HOH A 281 . ? 1_555 ? 46 BC1 7 ASP A 128 ? ASP A 127 . ? 10_656 ? 47 BC1 7 HOH S . ? HOH A 333 . ? 7_665 ? 48 BC1 7 HOH S . ? HOH A 333 . ? 1_555 ? 49 BC1 7 HOH S . ? HOH A 333 . ? 10_656 ? 50 BC1 7 HOH S . ? HOH A 361 . ? 10_656 ? 51 BC1 7 HOH S . ? HOH A 361 . ? 1_555 ? 52 BC1 7 HOH S . ? HOH A 361 . ? 7_665 ? 53 BC2 8 HOH S . ? HOH A 337 . ? 24_676 ? 54 BC2 8 HOH S . ? HOH A 337 . ? 51_556 ? 55 BC2 8 HOH S . ? HOH A 344 . ? 24_676 ? 56 BC2 8 HOH S . ? HOH A 344 . ? 51_556 ? 57 BC2 8 HOH S . ? HOH A 360 . ? 70_475 ? 58 BC2 8 HOH S . ? HOH A 360 . ? 1_555 ? 59 BC2 8 HOH S . ? HOH A 363 . ? 70_475 ? 60 BC2 8 HOH S . ? HOH A 363 . ? 1_555 ? 61 BC3 6 SER A 132 ? SER A 131 . ? 1_555 ? 62 BC3 6 GLU A 133 ? GLU A 132 . ? 1_555 ? 63 BC3 6 TYR A 134 ? TYR A 133 . ? 1_555 ? 64 BC3 6 GLU A 136 ? GLU A 135 . ? 1_555 ? 65 BC3 6 GLU A 137 ? GLU A 136 . ? 1_555 ? 66 BC3 6 HOH S . ? HOH A 458 . ? 1_555 ? 67 BC4 4 HIS A 170 ? HIS A 169 . ? 1_555 ? 68 BC4 4 HIS A 170 ? HIS A 169 . ? 15_465 ? 69 BC4 4 HIS A 170 ? HIS A 169 . ? 2_575 ? 70 BC4 4 HIS A 170 ? HIS A 169 . ? 16_665 ? 71 BC5 7 HOH S . ? HOH A 342 . ? 1_555 ? 72 BC5 7 HOH S . ? HOH A 342 . ? 7_665 ? 73 BC5 7 HOH S . ? HOH A 342 . ? 10_656 ? 74 BC5 7 HOH S . ? HOH A 398 . ? 10_656 ? 75 BC5 7 HOH S . ? HOH A 432 . ? 10_656 ? 76 BC5 7 HOH S . ? HOH A 432 . ? 1_555 ? 77 BC5 7 HOH S . ? HOH A 432 . ? 7_665 ? 78 BC6 5 VAL A 2 ? VAL A 1 . ? 1_555 ? 79 BC6 5 SER A 3 ? SER A 2 . ? 1_555 ? 80 BC6 5 ARG A 6 ? ARG A 5 . ? 1_555 ? 81 BC6 5 GLY A 74 ? GLY A 73 . ? 1_555 ? 82 BC6 5 HOH S . ? HOH A 266 . ? 1_555 ? 83 BC7 6 GLU A 137 ? GLU A 136 . ? 1_555 ? 84 BC7 6 GLN A 138 ? GLN A 137 . ? 1_555 ? 85 BC7 6 MG F . ? MG A 180 . ? 1_555 ? 86 BC7 6 HOH S . ? HOH A 338 . ? 1_555 ? 87 BC7 6 HOH S . ? HOH A 411 . ? 1_555 ? 88 BC7 6 HOH S . ? HOH A 423 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 MG A MG 192 ? ? O A HOH 338 ? ? 1.68 2 1 CE A MET 66 ? C ND2 A ASN 70 ? ? 1.97 3 1 O A HOH 331 ? ? O A HOH 438 ? ? 1.97 4 1 O A SER 170 ? ? O A HOH 273 ? ? 2.04 5 1 OE1 A GLU 63 ? A O A HOH 235 ? ? 2.04 6 1 NE2 A GLN 97 ? ? O A HOH 257 ? ? 2.05 7 1 O A GLU 158 ? ? O A HOH 197 ? ? 2.08 8 1 O A HOH 227 ? ? O A HOH 321 ? ? 2.15 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 NZ A LYS 52 ? ? 1_555 OE2 A GLU 63 ? B 24_676 1.58 2 1 O A HOH 421 ? ? 1_555 O A HOH 459 ? ? 10_656 2.08 3 1 O A HOH 233 ? ? 1_555 O A HOH 475 ? ? 16_665 2.17 4 1 CE A LYS 52 ? ? 1_555 OE2 A GLU 63 ? B 24_676 2.18 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 1.189 1.326 -0.137 0.013 N 2 1 CG A GLU 88 ? A CD A GLU 88 ? A 1.626 1.515 0.111 0.015 N 3 1 CD A GLU 88 ? A OE1 A GLU 88 ? A 1.465 1.252 0.213 0.011 N 4 1 CD A GLU 103 ? ? OE2 A GLU 103 ? ? 1.181 1.252 -0.071 0.011 N 5 1 CD A LYS 115 ? ? CE A LYS 115 ? ? 1.675 1.508 0.167 0.025 N 6 1 CB A GLU 136 ? A CG A GLU 136 ? A 1.280 1.517 -0.237 0.019 N 7 1 CB A GLU 136 ? B CG A GLU 136 ? B 1.670 1.517 0.153 0.019 N 8 1 CG A GLU 136 ? B CD A GLU 136 ? B 1.625 1.515 0.110 0.015 N 9 1 CD A GLU 136 ? B OE2 A GLU 136 ? B 1.320 1.252 0.068 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 18 ? ? CZ A ARG 18 ? ? NH2 A ARG 18 ? ? 116.54 120.30 -3.76 0.50 N 2 1 CB A TYR 28 ? ? CG A TYR 28 ? ? CD1 A TYR 28 ? ? 125.73 121.00 4.73 0.60 N 3 1 NE A ARG 59 ? B CZ A ARG 59 ? B NH2 A ARG 59 ? B 117.08 120.30 -3.22 0.50 N 4 1 NE A ARG 75 ? ? CZ A ARG 75 ? ? NH2 A ARG 75 ? ? 116.95 120.30 -3.35 0.50 N 5 1 OE1 A GLU 88 ? A CD A GLU 88 ? A OE2 A GLU 88 ? A 131.17 123.30 7.87 1.20 N 6 1 CG A GLU 88 ? A CD A GLU 88 ? A OE2 A GLU 88 ? A 101.43 118.30 -16.87 2.00 N 7 1 CB A ASP 119 ? A CG A ASP 119 ? A OD2 A ASP 119 ? A 111.79 118.30 -6.51 0.90 N 8 1 CB A ASP 119 ? B CG A ASP 119 ? B OD2 A ASP 119 ? B 126.34 118.30 8.04 0.90 N 9 1 CG A ARG 143 ? B CD A ARG 143 ? B NE A ARG 143 ? B 125.36 111.80 13.56 2.10 N 10 1 NE A ARG 143 ? B CZ A ARG 143 ? B NH1 A ARG 143 ? B 124.82 120.30 4.52 0.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id VAL _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 42 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -123.02 _pdbx_validate_torsion.psi -66.17 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MG 179 ? E MG . 2 1 A MG 186 ? L MG . 3 1 A CL 188 ? N CL . 4 1 A CL 189 ? O CL . 5 1 A MG 190 ? P MG . 6 1 A HOH 337 ? S HOH . 7 1 A HOH 363 ? S HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A SER 175 ? A SER 176 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 MG MG MG N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _atom_sites.entry_id 3KA3 _atom_sites.fract_transf_matrix[1][1] 0.005438 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005438 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005438 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL MG N O S # loop_