data_3S63 # _entry.id 3S63 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3S63 RCSB RCSB065807 WWPDB D_1000065807 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3S64 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3S63 _pdbx_database_status.recvd_initial_deposition_date 2011-05-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Willis, C.' 1 'Wang, C.K.' 2 'Osman, A.' 3 'Simon, A.' 4 'Mulvenna, J.' 5 'Pickering, D.' 6 'Riboldi-Tunicliffe, A.' 7 'Jones, M.K.' 8 'Loukas, A.' 9 'Hofmann, A.' 10 # _citation.id primary _citation.title 'Insights into the membrane interactions of the saposin-like proteins Na-SLP-1 and Ac-SLP-1 from human and dog hookworm.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 6 _citation.page_first e25369 _citation.page_last e25369 _citation.year 2011 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21991310 _citation.pdbx_database_id_DOI 10.1371/journal.pone.0025369 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Willis, C.' 1 primary 'Wang, C.K.' 2 primary 'Osman, A.' 3 primary 'Simon, A.' 4 primary 'Pickering, D.' 5 primary 'Mulvenna, J.' 6 primary 'Riboldi-Tunicliffe, A.' 7 primary 'Jones, M.K.' 8 primary 'Loukas, A.' 9 primary 'Hofmann, A.' 10 # _cell.entry_id 3S63 _cell.length_a 85.433 _cell.length_b 85.433 _cell.length_c 113.452 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3S63 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Saposin-like protein' 13565.567 2 ? ? ? ? 2 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Na-SLP-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LTPKETCDLCQIALRTVFGHFGGNIPSRRKLVHQLKHECKRHFNYRRRCLLLMKVNSDLIFREMTDGSFKPMEVCLIMRE CNPHDSPLEPEMIDKSGQPEAFALVSSSDDNYDTSEE ; _entity_poly.pdbx_seq_one_letter_code_can ;LTPKETCDLCQIALRTVFGHFGGNIPSRRKLVHQLKHECKRHFNYRRRCLLLMKVNSDLIFREMTDGSFKPMEVCLIMRE CNPHDSPLEPEMIDKSGQPEAFALVSSSDDNYDTSEE ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 THR n 1 3 PRO n 1 4 LYS n 1 5 GLU n 1 6 THR n 1 7 CYS n 1 8 ASP n 1 9 LEU n 1 10 CYS n 1 11 GLN n 1 12 ILE n 1 13 ALA n 1 14 LEU n 1 15 ARG n 1 16 THR n 1 17 VAL n 1 18 PHE n 1 19 GLY n 1 20 HIS n 1 21 PHE n 1 22 GLY n 1 23 GLY n 1 24 ASN n 1 25 ILE n 1 26 PRO n 1 27 SER n 1 28 ARG n 1 29 ARG n 1 30 LYS n 1 31 LEU n 1 32 VAL n 1 33 HIS n 1 34 GLN n 1 35 LEU n 1 36 LYS n 1 37 HIS n 1 38 GLU n 1 39 CYS n 1 40 LYS n 1 41 ARG n 1 42 HIS n 1 43 PHE n 1 44 ASN n 1 45 TYR n 1 46 ARG n 1 47 ARG n 1 48 ARG n 1 49 CYS n 1 50 LEU n 1 51 LEU n 1 52 LEU n 1 53 MET n 1 54 LYS n 1 55 VAL n 1 56 ASN n 1 57 SER n 1 58 ASP n 1 59 LEU n 1 60 ILE n 1 61 PHE n 1 62 ARG n 1 63 GLU n 1 64 MET n 1 65 THR n 1 66 ASP n 1 67 GLY n 1 68 SER n 1 69 PHE n 1 70 LYS n 1 71 PRO n 1 72 MET n 1 73 GLU n 1 74 VAL n 1 75 CYS n 1 76 LEU n 1 77 ILE n 1 78 MET n 1 79 ARG n 1 80 GLU n 1 81 CYS n 1 82 ASN n 1 83 PRO n 1 84 HIS n 1 85 ASP n 1 86 SER n 1 87 PRO n 1 88 LEU n 1 89 GLU n 1 90 PRO n 1 91 GLU n 1 92 MET n 1 93 ILE n 1 94 ASP n 1 95 LYS n 1 96 SER n 1 97 GLY n 1 98 GLN n 1 99 PRO n 1 100 GLU n 1 101 ALA n 1 102 PHE n 1 103 ALA n 1 104 LEU n 1 105 VAL n 1 106 SER n 1 107 SER n 1 108 SER n 1 109 ASP n 1 110 ASP n 1 111 ASN n 1 112 TYR n 1 113 ASP n 1 114 THR n 1 115 SER n 1 116 GLU n 1 117 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Necator americanus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 51031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 3S63 _struct_ref.pdbx_db_accession 3S63 _struct_ref.entity_id 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 3S63 A 1 ? 117 ? 3S63 1 ? 117 ? 1 117 2 1 3S63 B 1 ? 117 ? 3S63 1 ? 117 ? 1 117 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3S63 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_percent_sol 44.16 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pdbx_details '0.2M NaCl, 20% PEG 6000, 0.1M HEPES, pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 289K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2010-05-07 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.94723 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX1' _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' _diffrn_source.pdbx_synchrotron_beamline MX1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.94723 # _reflns.entry_id 3S63 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 25 _reflns.d_resolution_high 2.7 _reflns.number_obs 7191 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.101 _reflns.pdbx_netI_over_sigmaI 7.4 _reflns.B_iso_Wilson_estimate 56 _reflns.pdbx_redundancy 41.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.515 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 43 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1021 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.number_possible ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3S63 _refine.ls_number_reflns_obs 7191 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.49 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 24.662 _refine.ls_d_res_high 2.700 _refine.ls_percent_reflns_obs 99.97 _refine.ls_R_factor_obs 0.1874 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1845 _refine.ls_R_factor_R_free 0.2449 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.68 _refine.ls_number_reflns_R_free 595 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -10.6589 _refine.aniso_B[2][2] -10.6589 _refine.aniso_B[3][3] 21.3178 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.362 _refine.solvent_model_param_bsol 53.004 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SIRAS _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.36 _refine.pdbx_overall_phase_error 24.49 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1400 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1439 _refine_hist.d_res_high 2.700 _refine_hist.d_res_low 24.662 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.008 ? ? 1433 ? 'X-RAY DIFFRACTION' f_angle_d 1.147 ? ? 1919 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 17.584 ? ? 552 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.078 ? ? 215 ? 'X-RAY DIFFRACTION' f_plane_restr 0.005 ? ? 248 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs 'X-RAY DIFFRACTION' 4 2.7001 2.9714 3005 0.2113 100.00 0.2711 . . 168 . . . . 'X-RAY DIFFRACTION' 4 2.9714 3.4004 3027 0.1907 100.00 0.3178 . . 153 . . . . 'X-RAY DIFFRACTION' 4 3.4004 4.2805 3048 0.1676 100.00 0.2015 . . 132 . . . . 'X-RAY DIFFRACTION' 4 4.2805 24.6634 3040 0.1808 100.00 0.2164 . . 142 . . . . # _struct.entry_id 3S63 _struct.title 'Saposin-like protein Na-SLP-1' _struct.pdbx_descriptor 'Saposin-like protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3S63 _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'saposin, lipid-binding, LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 2 ? PHE A 21 ? THR A 2 PHE A 21 1 ? 20 HELX_P HELX_P2 2 SER A 27 ? LYS A 40 ? SER A 27 LYS A 40 1 ? 14 HELX_P HELX_P3 3 TYR A 45 ? ASP A 66 ? TYR A 45 ASP A 66 1 ? 22 HELX_P HELX_P4 4 LYS A 70 ? MET A 78 ? LYS A 70 MET A 78 1 ? 9 HELX_P HELX_P5 5 THR B 2 ? PHE B 21 ? THR B 2 PHE B 21 1 ? 20 HELX_P HELX_P6 6 SER B 27 ? LYS B 40 ? SER B 27 LYS B 40 1 ? 14 HELX_P HELX_P7 7 TYR B 45 ? ASN B 56 ? TYR B 45 ASN B 56 1 ? 12 HELX_P HELX_P8 8 ASN B 56 ? ASP B 66 ? ASN B 56 ASP B 66 1 ? 11 HELX_P HELX_P9 9 LYS B 70 ? MET B 78 ? LYS B 70 MET B 78 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 81 SG ? ? A CYS 7 A CYS 81 1_555 ? ? ? ? ? ? ? 2.036 ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 75 SG ? ? A CYS 10 A CYS 75 1_555 ? ? ? ? ? ? ? 2.028 ? disulf3 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 39 A CYS 49 1_555 ? ? ? ? ? ? ? 2.042 ? disulf4 disulf ? ? B CYS 7 SG ? ? ? 1_555 B CYS 81 SG ? ? B CYS 7 B CYS 81 1_555 ? ? ? ? ? ? ? 2.023 ? disulf5 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 75 SG ? ? B CYS 10 B CYS 75 1_555 ? ? ? ? ? ? ? 2.029 ? disulf6 disulf ? ? B CYS 39 SG ? ? ? 1_555 B CYS 49 SG ? ? B CYS 39 B CYS 49 1_555 ? ? ? ? ? ? ? 2.025 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 3S63 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3S63 _atom_sites.fract_transf_matrix[1][1] 0.011705 _atom_sites.fract_transf_matrix[1][2] 0.006758 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013516 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008814 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ARG 29 29 29 ARG ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 HIS 33 33 33 HIS ALA A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 PHE 43 43 43 PHE ALA A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 ARG 79 79 79 ARG ALA A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 ASN 82 82 82 ASN ALA A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 HIS 84 84 84 HIS ALA A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LEU 88 88 88 LEU ALA A . n A 1 89 GLU 89 89 ? ? ? A . n A 1 90 PRO 90 90 ? ? ? A . n A 1 91 GLU 91 91 ? ? ? A . n A 1 92 MET 92 92 ? ? ? A . n A 1 93 ILE 93 93 ? ? ? A . n A 1 94 ASP 94 94 ? ? ? A . n A 1 95 LYS 95 95 ? ? ? A . n A 1 96 SER 96 96 ? ? ? A . n A 1 97 GLY 97 97 ? ? ? A . n A 1 98 GLN 98 98 ? ? ? A . n A 1 99 PRO 99 99 ? ? ? A . n A 1 100 GLU 100 100 ? ? ? A . n A 1 101 ALA 101 101 ? ? ? A . n A 1 102 PHE 102 102 ? ? ? A . n A 1 103 ALA 103 103 ? ? ? A . n A 1 104 LEU 104 104 ? ? ? A . n A 1 105 VAL 105 105 ? ? ? A . n A 1 106 SER 106 106 ? ? ? A . n A 1 107 SER 107 107 ? ? ? A . n A 1 108 SER 108 108 ? ? ? A . n A 1 109 ASP 109 109 ? ? ? A . n A 1 110 ASP 110 110 ? ? ? A . n A 1 111 ASN 111 111 ? ? ? A . n A 1 112 TYR 112 112 ? ? ? A . n A 1 113 ASP 113 113 ? ? ? A . n A 1 114 THR 114 114 ? ? ? A . n A 1 115 SER 115 115 ? ? ? A . n A 1 116 GLU 116 116 ? ? ? A . n A 1 117 GLU 117 117 ? ? ? A . n B 1 1 LEU 1 1 1 LEU LEU B . n B 1 2 THR 2 2 2 THR THR B . n B 1 3 PRO 3 3 3 PRO PRO B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 THR 6 6 6 THR THR B . n B 1 7 CYS 7 7 7 CYS CYS B . n B 1 8 ASP 8 8 8 ASP ASP B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 CYS 10 10 10 CYS CYS B . n B 1 11 GLN 11 11 11 GLN GLN B . n B 1 12 ILE 12 12 12 ILE ILE B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 ARG 15 15 15 ARG ALA B . n B 1 16 THR 16 16 16 THR THR B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 PHE 18 18 18 PHE PHE B . n B 1 19 GLY 19 19 19 GLY GLY B . n B 1 20 HIS 20 20 20 HIS HIS B . n B 1 21 PHE 21 21 21 PHE PHE B . n B 1 22 GLY 22 22 22 GLY GLY B . n B 1 23 GLY 23 23 23 GLY GLY B . n B 1 24 ASN 24 24 24 ASN ASN B . n B 1 25 ILE 25 25 25 ILE ILE B . n B 1 26 PRO 26 26 26 PRO PRO B . n B 1 27 SER 27 27 27 SER SER B . n B 1 28 ARG 28 28 28 ARG ARG B . n B 1 29 ARG 29 29 29 ARG ALA B . n B 1 30 LYS 30 30 30 LYS ALA B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 HIS 33 33 33 HIS ALA B . n B 1 34 GLN 34 34 34 GLN GLN B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 LYS 36 36 36 LYS LYS B . n B 1 37 HIS 37 37 37 HIS HIS B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 CYS 39 39 39 CYS CYS B . n B 1 40 LYS 40 40 40 LYS LYS B . n B 1 41 ARG 41 41 41 ARG ARG B . n B 1 42 HIS 42 42 42 HIS HIS B . n B 1 43 PHE 43 43 43 PHE PHE B . n B 1 44 ASN 44 44 44 ASN ASN B . n B 1 45 TYR 45 45 45 TYR TYR B . n B 1 46 ARG 46 46 46 ARG ARG B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 ARG 48 48 48 ARG ARG B . n B 1 49 CYS 49 49 49 CYS CYS B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 LEU 51 51 51 LEU LEU B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 MET 53 53 53 MET MET B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 VAL 55 55 55 VAL VAL B . n B 1 56 ASN 56 56 56 ASN ASN B . n B 1 57 SER 57 57 57 SER SER B . n B 1 58 ASP 58 58 58 ASP ASP B . n B 1 59 LEU 59 59 59 LEU LEU B . n B 1 60 ILE 60 60 60 ILE ILE B . n B 1 61 PHE 61 61 61 PHE PHE B . n B 1 62 ARG 62 62 62 ARG ARG B . n B 1 63 GLU 63 63 63 GLU GLU B . n B 1 64 MET 64 64 64 MET MET B . n B 1 65 THR 65 65 65 THR THR B . n B 1 66 ASP 66 66 66 ASP ASP B . n B 1 67 GLY 67 67 67 GLY GLY B . n B 1 68 SER 68 68 68 SER SER B . n B 1 69 PHE 69 69 69 PHE PHE B . n B 1 70 LYS 70 70 70 LYS LYS B . n B 1 71 PRO 71 71 71 PRO PRO B . n B 1 72 MET 72 72 72 MET MET B . n B 1 73 GLU 73 73 73 GLU GLU B . n B 1 74 VAL 74 74 74 VAL VAL B . n B 1 75 CYS 75 75 75 CYS CYS B . n B 1 76 LEU 76 76 76 LEU LEU B . n B 1 77 ILE 77 77 77 ILE ILE B . n B 1 78 MET 78 78 78 MET MET B . n B 1 79 ARG 79 79 79 ARG ARG B . n B 1 80 GLU 80 80 80 GLU GLU B . n B 1 81 CYS 81 81 81 CYS CYS B . n B 1 82 ASN 82 82 82 ASN ALA B . n B 1 83 PRO 83 83 83 PRO PRO B . n B 1 84 HIS 84 84 84 HIS HIS B . n B 1 85 ASP 85 85 85 ASP ASP B . n B 1 86 SER 86 86 86 SER SER B . n B 1 87 PRO 87 87 87 PRO PRO B . n B 1 88 LEU 88 88 88 LEU LEU B . n B 1 89 GLU 89 89 89 GLU GLU B . n B 1 90 PRO 90 90 90 PRO PRO B . n B 1 91 GLU 91 91 ? ? ? B . n B 1 92 MET 92 92 ? ? ? B . n B 1 93 ILE 93 93 ? ? ? B . n B 1 94 ASP 94 94 ? ? ? B . n B 1 95 LYS 95 95 ? ? ? B . n B 1 96 SER 96 96 ? ? ? B . n B 1 97 GLY 97 97 ? ? ? B . n B 1 98 GLN 98 98 ? ? ? B . n B 1 99 PRO 99 99 ? ? ? B . n B 1 100 GLU 100 100 ? ? ? B . n B 1 101 ALA 101 101 ? ? ? B . n B 1 102 PHE 102 102 ? ? ? B . n B 1 103 ALA 103 103 ? ? ? B . n B 1 104 LEU 104 104 ? ? ? B . n B 1 105 VAL 105 105 ? ? ? B . n B 1 106 SER 106 106 ? ? ? B . n B 1 107 SER 107 107 ? ? ? B . n B 1 108 SER 108 108 ? ? ? B . n B 1 109 ASP 109 109 ? ? ? B . n B 1 110 ASP 110 110 ? ? ? B . n B 1 111 ASN 111 111 ? ? ? B . n B 1 112 TYR 112 112 ? ? ? B . n B 1 113 ASP 113 113 ? ? ? B . n B 1 114 THR 114 114 ? ? ? B . n B 1 115 SER 115 115 ? ? ? B . n B 1 116 GLU 116 116 ? ? ? B . n B 1 117 GLU 117 117 ? ? ? B . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C 2 1 B,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2012-01-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 SHARP phasing . ? 2 PHENIX refinement '(phenix.refine: 1.6.1_357)' ? 3 XDS 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # _pdbx_entry_details.sequence_details 'A SEQUENCE DATABASE REFERENCE FOR THIS PROTEIN DOES NOT CURRENTLY EXIST.' _pdbx_entry_details.entry_id 3S63 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 69 ? ? -10.73 107.55 2 1 ASP A 85 ? ? -56.87 171.05 3 1 PRO A 87 ? ? -60.76 -130.98 4 1 ARG B 46 ? ? -26.82 -58.80 5 1 SER B 68 ? ? -62.96 52.59 6 1 ARG B 79 ? ? 82.89 10.75 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 SER _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 68 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PHE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 69 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -144.21 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 29 ? CG ? A ARG 29 CG 2 1 Y 1 A ARG 29 ? CD ? A ARG 29 CD 3 1 Y 1 A ARG 29 ? NE ? A ARG 29 NE 4 1 Y 1 A ARG 29 ? CZ ? A ARG 29 CZ 5 1 Y 1 A ARG 29 ? NH1 ? A ARG 29 NH1 6 1 Y 1 A ARG 29 ? NH2 ? A ARG 29 NH2 7 1 Y 1 A HIS 33 ? CG ? A HIS 33 CG 8 1 Y 1 A HIS 33 ? ND1 ? A HIS 33 ND1 9 1 Y 1 A HIS 33 ? CD2 ? A HIS 33 CD2 10 1 Y 1 A HIS 33 ? CE1 ? A HIS 33 CE1 11 1 Y 1 A HIS 33 ? NE2 ? A HIS 33 NE2 12 1 Y 1 A PHE 43 ? CG ? A PHE 43 CG 13 1 Y 1 A PHE 43 ? CD1 ? A PHE 43 CD1 14 1 Y 1 A PHE 43 ? CD2 ? A PHE 43 CD2 15 1 Y 1 A PHE 43 ? CE1 ? A PHE 43 CE1 16 1 Y 1 A PHE 43 ? CE2 ? A PHE 43 CE2 17 1 Y 1 A PHE 43 ? CZ ? A PHE 43 CZ 18 1 Y 1 A ARG 79 ? CG ? A ARG 79 CG 19 1 Y 1 A ARG 79 ? CD ? A ARG 79 CD 20 1 Y 1 A ARG 79 ? NE ? A ARG 79 NE 21 1 Y 1 A ARG 79 ? CZ ? A ARG 79 CZ 22 1 Y 1 A ARG 79 ? NH1 ? A ARG 79 NH1 23 1 Y 1 A ARG 79 ? NH2 ? A ARG 79 NH2 24 1 Y 1 A ASN 82 ? CG ? A ASN 82 CG 25 1 Y 1 A ASN 82 ? OD1 ? A ASN 82 OD1 26 1 Y 1 A ASN 82 ? ND2 ? A ASN 82 ND2 27 1 Y 1 A HIS 84 ? CG ? A HIS 84 CG 28 1 Y 1 A HIS 84 ? ND1 ? A HIS 84 ND1 29 1 Y 1 A HIS 84 ? CD2 ? A HIS 84 CD2 30 1 Y 1 A HIS 84 ? CE1 ? A HIS 84 CE1 31 1 Y 1 A HIS 84 ? NE2 ? A HIS 84 NE2 32 1 Y 1 A LEU 88 ? CG ? A LEU 88 CG 33 1 Y 1 A LEU 88 ? CD1 ? A LEU 88 CD1 34 1 Y 1 A LEU 88 ? CD2 ? A LEU 88 CD2 35 1 Y 1 B ARG 15 ? CG ? B ARG 15 CG 36 1 Y 1 B ARG 15 ? CD ? B ARG 15 CD 37 1 Y 1 B ARG 15 ? NE ? B ARG 15 NE 38 1 Y 1 B ARG 15 ? CZ ? B ARG 15 CZ 39 1 Y 1 B ARG 15 ? NH1 ? B ARG 15 NH1 40 1 Y 1 B ARG 15 ? NH2 ? B ARG 15 NH2 41 1 Y 1 B ARG 29 ? CG ? B ARG 29 CG 42 1 Y 1 B ARG 29 ? CD ? B ARG 29 CD 43 1 Y 1 B ARG 29 ? NE ? B ARG 29 NE 44 1 Y 1 B ARG 29 ? CZ ? B ARG 29 CZ 45 1 Y 1 B ARG 29 ? NH1 ? B ARG 29 NH1 46 1 Y 1 B ARG 29 ? NH2 ? B ARG 29 NH2 47 1 Y 1 B LYS 30 ? CG ? B LYS 30 CG 48 1 Y 1 B LYS 30 ? CD ? B LYS 30 CD 49 1 Y 1 B LYS 30 ? CE ? B LYS 30 CE 50 1 Y 1 B LYS 30 ? NZ ? B LYS 30 NZ 51 1 Y 1 B HIS 33 ? CG ? B HIS 33 CG 52 1 Y 1 B HIS 33 ? ND1 ? B HIS 33 ND1 53 1 Y 1 B HIS 33 ? CD2 ? B HIS 33 CD2 54 1 Y 1 B HIS 33 ? CE1 ? B HIS 33 CE1 55 1 Y 1 B HIS 33 ? NE2 ? B HIS 33 NE2 56 1 Y 1 B ASN 82 ? CG ? B ASN 82 CG 57 1 Y 1 B ASN 82 ? OD1 ? B ASN 82 OD1 58 1 Y 1 B ASN 82 ? ND2 ? B ASN 82 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 89 ? A GLU 89 2 1 Y 1 A PRO 90 ? A PRO 90 3 1 Y 1 A GLU 91 ? A GLU 91 4 1 Y 1 A MET 92 ? A MET 92 5 1 Y 1 A ILE 93 ? A ILE 93 6 1 Y 1 A ASP 94 ? A ASP 94 7 1 Y 1 A LYS 95 ? A LYS 95 8 1 Y 1 A SER 96 ? A SER 96 9 1 Y 1 A GLY 97 ? A GLY 97 10 1 Y 1 A GLN 98 ? A GLN 98 11 1 Y 1 A PRO 99 ? A PRO 99 12 1 Y 1 A GLU 100 ? A GLU 100 13 1 Y 1 A ALA 101 ? A ALA 101 14 1 Y 1 A PHE 102 ? A PHE 102 15 1 Y 1 A ALA 103 ? A ALA 103 16 1 Y 1 A LEU 104 ? A LEU 104 17 1 Y 1 A VAL 105 ? A VAL 105 18 1 Y 1 A SER 106 ? A SER 106 19 1 Y 1 A SER 107 ? A SER 107 20 1 Y 1 A SER 108 ? A SER 108 21 1 Y 1 A ASP 109 ? A ASP 109 22 1 Y 1 A ASP 110 ? A ASP 110 23 1 Y 1 A ASN 111 ? A ASN 111 24 1 Y 1 A TYR 112 ? A TYR 112 25 1 Y 1 A ASP 113 ? A ASP 113 26 1 Y 1 A THR 114 ? A THR 114 27 1 Y 1 A SER 115 ? A SER 115 28 1 Y 1 A GLU 116 ? A GLU 116 29 1 Y 1 A GLU 117 ? A GLU 117 30 1 Y 1 B GLU 91 ? B GLU 91 31 1 Y 1 B MET 92 ? B MET 92 32 1 Y 1 B ILE 93 ? B ILE 93 33 1 Y 1 B ASP 94 ? B ASP 94 34 1 Y 1 B LYS 95 ? B LYS 95 35 1 Y 1 B SER 96 ? B SER 96 36 1 Y 1 B GLY 97 ? B GLY 97 37 1 Y 1 B GLN 98 ? B GLN 98 38 1 Y 1 B PRO 99 ? B PRO 99 39 1 Y 1 B GLU 100 ? B GLU 100 40 1 Y 1 B ALA 101 ? B ALA 101 41 1 Y 1 B PHE 102 ? B PHE 102 42 1 Y 1 B ALA 103 ? B ALA 103 43 1 Y 1 B LEU 104 ? B LEU 104 44 1 Y 1 B VAL 105 ? B VAL 105 45 1 Y 1 B SER 106 ? B SER 106 46 1 Y 1 B SER 107 ? B SER 107 47 1 Y 1 B SER 108 ? B SER 108 48 1 Y 1 B ASP 109 ? B ASP 109 49 1 Y 1 B ASP 110 ? B ASP 110 50 1 Y 1 B ASN 111 ? B ASN 111 51 1 Y 1 B TYR 112 ? B TYR 112 52 1 Y 1 B ASP 113 ? B ASP 113 53 1 Y 1 B THR 114 ? B THR 114 54 1 Y 1 B SER 115 ? B SER 115 55 1 Y 1 B GLU 116 ? B GLU 116 56 1 Y 1 B GLU 117 ? B GLU 117 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 118 1 HOH HOH A . C 2 HOH 2 119 2 HOH HOH A . C 2 HOH 3 120 9 HOH HOH A . C 2 HOH 4 121 13 HOH HOH A . C 2 HOH 5 122 14 HOH HOH A . C 2 HOH 6 123 15 HOH HOH A . C 2 HOH 7 124 16 HOH HOH A . C 2 HOH 8 125 22 HOH HOH A . C 2 HOH 9 126 23 HOH HOH A . C 2 HOH 10 127 24 HOH HOH A . C 2 HOH 11 128 25 HOH HOH A . C 2 HOH 12 129 26 HOH HOH A . C 2 HOH 13 131 28 HOH HOH A . C 2 HOH 14 132 29 HOH HOH A . C 2 HOH 15 133 30 HOH HOH A . C 2 HOH 16 134 31 HOH HOH A . C 2 HOH 17 135 32 HOH HOH A . C 2 HOH 18 136 35 HOH HOH A . D 2 HOH 1 118 3 HOH HOH B . D 2 HOH 2 119 4 HOH HOH B . D 2 HOH 3 120 5 HOH HOH B . D 2 HOH 4 121 6 HOH HOH B . D 2 HOH 5 122 7 HOH HOH B . D 2 HOH 6 123 8 HOH HOH B . D 2 HOH 7 124 10 HOH HOH B . D 2 HOH 8 125 11 HOH HOH B . D 2 HOH 9 126 12 HOH HOH B . D 2 HOH 10 127 17 HOH HOH B . D 2 HOH 11 128 18 HOH HOH B . D 2 HOH 12 129 19 HOH HOH B . D 2 HOH 13 130 20 HOH HOH B . D 2 HOH 14 131 21 HOH HOH B . D 2 HOH 15 132 33 HOH HOH B . D 2 HOH 16 134 37 HOH HOH B . D 2 HOH 17 135 38 HOH HOH B . D 2 HOH 18 136 39 HOH HOH B . D 2 HOH 19 137 36 HOH HOH B . D 2 HOH 20 138 41 HOH HOH B . D 2 HOH 21 139 40 HOH HOH B . #