data_3T4R # _entry.id 3T4R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3T4R RCSB RCSB067035 WWPDB D_1000067035 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3T4R _pdbx_database_status.recvd_initial_deposition_date 2011-07-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Martinez, N.' 1 'Tarbouriech, N.' 2 'Jamin, M.' 3 # _citation.id primary _citation.title 'Structure of the C-terminal domain of lettuce necrotic yellows virus phosphoprotein.' _citation.journal_abbrev J.Virol. _citation.journal_volume 87 _citation.page_first 9569 _citation.page_last 9578 _citation.year 2013 _citation.journal_id_ASTM JOVIAM _citation.country US _citation.journal_id_ISSN 0022-538X _citation.journal_id_CSD 0825 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23785215 _citation.pdbx_database_id_DOI 10.1128/JVI.00999-13 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Martinez, N.' 1 primary 'Ribeiro, E.A.' 2 primary 'Leyrat, C.' 3 primary 'Tarbouriech, N.' 4 primary 'Ruigrok, R.W.' 5 primary 'Jamin, M.' 6 # _cell.entry_id 3T4R _cell.length_a 43.280 _cell.length_b 43.280 _cell.length_c 89.380 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3T4R _symmetry.space_group_name_H-M 'P 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 91 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Phosphoprotein 9555.391 1 ? ? 'C-terminal domain' ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 water nat water 18.015 22 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein P, Protein 4a' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)ARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILA(MSE)AADGLTPELKEKIQNEIIENHIAL(MSE)AL EEYSSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHH H ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 ARG n 1 4 ILE n 1 5 ARG n 1 6 HIS n 1 7 GLU n 1 8 LYS n 1 9 GLU n 1 10 LYS n 1 11 LEU n 1 12 LEU n 1 13 ALA n 1 14 ASP n 1 15 LEU n 1 16 ASP n 1 17 TRP n 1 18 GLU n 1 19 ILE n 1 20 GLY n 1 21 GLU n 1 22 ILE n 1 23 ALA n 1 24 GLN n 1 25 TYR n 1 26 THR n 1 27 PRO n 1 28 LEU n 1 29 ILE n 1 30 VAL n 1 31 ASP n 1 32 PHE n 1 33 LEU n 1 34 VAL n 1 35 PRO n 1 36 ASP n 1 37 ASP n 1 38 ILE n 1 39 LEU n 1 40 ALA n 1 41 MSE n 1 42 ALA n 1 43 ALA n 1 44 ASP n 1 45 GLY n 1 46 LEU n 1 47 THR n 1 48 PRO n 1 49 GLU n 1 50 LEU n 1 51 LYS n 1 52 GLU n 1 53 LYS n 1 54 ILE n 1 55 GLN n 1 56 ASN n 1 57 GLU n 1 58 ILE n 1 59 ILE n 1 60 GLU n 1 61 ASN n 1 62 HIS n 1 63 ILE n 1 64 ALA n 1 65 LEU n 1 66 MSE n 1 67 ALA n 1 68 LEU n 1 69 GLU n 1 70 GLU n 1 71 TYR n 1 72 SER n 1 73 SER n 1 74 LEU n 1 75 GLU n 1 76 HIS n 1 77 HIS n 1 78 HIS n 1 79 HIS n 1 80 HIS n 1 81 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name LNYV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene P _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'isolate 318' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lettuce necrotic yellows virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 928304 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VP4A_LNYV3 _struct_ref.pdbx_db_accession Q9E7N7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code RIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSS _struct_ref.pdbx_align_begin 230 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3T4R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9E7N7 _struct_ref_seq.db_align_beg 230 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 300 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3T4R MSE A 1 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 1 1 1 3T4R ALA A 2 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 2 2 1 3T4R LEU A 74 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 74 3 1 3T4R GLU A 75 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 75 4 1 3T4R HIS A 76 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 76 5 1 3T4R HIS A 77 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 77 6 1 3T4R HIS A 78 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 78 7 1 3T4R HIS A 79 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 79 8 1 3T4R HIS A 80 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 80 9 1 3T4R HIS A 81 ? UNP Q9E7N7 ? ? 'EXPRESSION TAG' 81 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3T4R _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_percent_sol 43.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pdbx_details '50 mM Na Cacodylate, 40 mM Magnesium Acetate, 10% MPD, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2011-04-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'channel cut ESRF monochromator' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.974 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.974 # _reflns.entry_id 3T4R _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.6 _reflns.d_resolution_high 2.0 _reflns.number_obs 6220 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.072 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 20.62 _reflns.B_iso_Wilson_estimate 43.8 _reflns.pdbx_redundancy 10.56 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.05 _reflns_shell.percent_possible_all 99.3 _reflns_shell.Rmerge_I_obs 0.455 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.88 _reflns_shell.pdbx_redundancy 3.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 813 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3T4R _refine.ls_number_reflns_obs 5923 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.60 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs 99.84 _refine.ls_R_factor_obs 0.22922 _refine.ls_R_factor_all 0.22922 _refine.ls_R_factor_R_work 0.22614 _refine.ls_R_factor_R_free 0.29351 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 288 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.953 _refine.correlation_coeff_Fo_to_Fc_free 0.918 _refine.B_iso_mean 54.050 _refine.aniso_B[1][1] 0.11 _refine.aniso_B[2][2] 0.11 _refine.aniso_B[3][3] -0.22 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.189 _refine.overall_SU_ML 0.172 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 14.241 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3T4R _refine_analyze.Luzzati_coordinate_error_obs 0.188 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free 0.189 _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 577 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 600 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 30.60 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.027 0.022 ? 582 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2.064 2.001 ? 793 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.941 5.000 ? 75 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 44.606 26.923 ? 26 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 21.884 15.000 ? 106 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 6.797 15.000 ? 1 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.143 0.200 ? 94 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.015 0.021 ? 430 ? 'X-RAY DIFFRACTION' r_mcbond_it 1.026 1.500 ? 363 ? 'X-RAY DIFFRACTION' r_mcangle_it 1.742 2.000 ? 586 ? 'X-RAY DIFFRACTION' r_scbond_it 2.984 3.000 ? 219 ? 'X-RAY DIFFRACTION' r_scangle_it 4.588 4.500 ? 205 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.0 _refine_ls_shell.d_res_low 2.05 _refine_ls_shell.number_reflns_R_work 430 _refine_ls_shell.R_factor_R_work 0.290 _refine_ls_shell.percent_reflns_obs 99.33 _refine_ls_shell.R_factor_R_free 0.293 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 16 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 813 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3T4R _struct.title 'Lettuce Necrotic Yellow Virus Phosphoprotein C-Terminal Domain' _struct.pdbx_descriptor Phosphoprotein _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3T4R _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'Helical bundle, Nucleoprotein, VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 3 ? LEU A 15 ? ARG A 3 LEU A 15 1 ? 13 HELX_P HELX_P2 2 GLU A 18 ? ALA A 23 ? GLU A 18 ALA A 23 1 ? 6 HELX_P HELX_P3 3 THR A 26 ? VAL A 34 ? THR A 26 VAL A 34 1 ? 9 HELX_P HELX_P4 4 PRO A 35 ? ALA A 42 ? PRO A 35 ALA A 42 1 ? 8 HELX_P HELX_P5 5 GLU A 49 ? LEU A 74 ? GLU A 49 LEU A 74 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ALA 40 C ? ? ? 1_555 A MSE 41 N ? ? A ALA 40 A MSE 41 1_555 ? ? ? ? ? ? ? 1.327 ? covale2 covale ? ? A MSE 41 C ? ? ? 1_555 A ALA 42 N ? ? A MSE 41 A ALA 42 1_555 ? ? ? ? ? ? ? 1.333 ? covale3 covale ? ? A LEU 65 C ? ? ? 1_555 A MSE 66 N ? ? A LEU 65 A MSE 66 1_555 ? ? ? ? ? ? ? 1.325 ? covale4 covale ? ? A MSE 66 C ? ? ? 1_555 A ALA 67 N ? ? A MSE 66 A ALA 67 1_555 ? ? ? ? ? ? ? 1.327 ? metalc1 metalc ? ? A ASP 36 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 36 A MG 82 1_555 ? ? ? ? ? ? ? 2.613 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 46 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 46 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 THR _struct_mon_prot_cis.pdbx_label_seq_id_2 47 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 THR _struct_mon_prot_cis.pdbx_auth_seq_id_2 47 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.03 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE MG A 82' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ASP A 36 ? ASP A 36 . ? 1_555 ? 2 AC1 2 ASP A 36 ? ASP A 36 . ? 7_555 ? # _database_PDB_matrix.entry_id 3T4R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3T4R _atom_sites.fract_transf_matrix[1][1] 0.023105 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023105 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011188 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 MSE 41 41 41 MSE MSE A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 THR 47 47 47 THR ALA A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 MSE 66 66 66 MSE MSE A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLU 75 75 ? ? ? A . n A 1 76 HIS 76 76 ? ? ? A . n A 1 77 HIS 77 77 ? ? ? A . n A 1 78 HIS 78 78 ? ? ? A . n A 1 79 HIS 79 79 ? ? ? A . n A 1 80 HIS 80 80 ? ? ? A . n A 1 81 HIS 81 81 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 41 A MSE 41 ? MET SELENOMETHIONINE 2 A MSE 66 A MSE 66 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id MG _pdbx_struct_special_symmetry.auth_seq_id 82 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id MG _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-01-30 2 'Structure model' 1 1 2014-03-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 5.5760 15.6010 42.2150 -0.0147 0.1857 0.0666 0.0042 -0.0198 0.0085 15.7115 2.8366 9.8071 0.8802 -3.6312 -0.8949 0.0282 0.2866 -0.3206 -0.3195 -0.1878 -0.0773 -0.2079 -0.3979 0.1595 'X-RAY DIFFRACTION' 2 ? refined 6.8640 24.8580 44.9870 0.1194 0.1936 0.1468 0.0091 0.0071 -0.0419 17.0582 5.9722 9.2166 6.5070 -4.8541 -2.1677 0.5687 -0.9847 1.4648 -0.1393 -0.1893 0.3171 -0.8746 0.2270 -0.3794 'X-RAY DIFFRACTION' 3 ? refined 13.6280 12.4290 41.7020 0.0762 0.2910 0.1125 0.0292 0.0004 0.0388 11.6935 19.9456 11.3174 -0.4301 1.0597 -2.3257 0.0775 -0.1379 -0.9778 -0.1937 -0.0908 0.1192 0.6498 0.5637 0.0134 'X-RAY DIFFRACTION' 4 ? refined 11.0470 8.5920 51.4030 0.1608 0.5350 0.3267 -0.0183 -0.0952 0.2716 19.2670 17.5609 18.2056 1.6895 6.9287 4.6719 0.9593 -1.5353 -2.6002 0.5940 -0.4291 0.3115 1.6381 -0.5796 -0.5302 'X-RAY DIFFRACTION' 5 ? refined 22.0520 27.9450 51.7100 0.5458 0.3236 0.1459 -0.0014 0.0580 0.0237 16.9231 46.2165 11.6582 20.5440 9.3590 17.5850 0.6150 -0.3575 0.9386 -0.3122 -0.9533 -0.7335 -1.6714 -1.1134 0.3383 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 3 ? ? A 17 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 18 ? ? A 29 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 30 ? ? A 45 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 46 ? ? A 59 ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 60 ? ? A 74 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DNA 'data collection' . ? 1 SHELXD phasing . ? 2 REFMAC refinement 5.5.0110 ? 3 XDS 'data reduction' . ? 4 XSCALE 'data scaling' . ? 5 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A ARG 3 ? ? CG A ARG 3 ? ? 1.338 1.521 -0.183 0.027 N 2 1 CB A GLN 24 ? ? CG A GLN 24 ? ? 1.178 1.521 -0.343 0.027 N 3 1 CA A THR 47 ? ? CB A THR 47 ? ? 1.740 1.529 0.211 0.026 N 4 1 CG A GLU 49 ? ? CD A GLU 49 ? ? 1.620 1.515 0.105 0.015 N 5 1 CD A GLU 49 ? ? OE1 A GLU 49 ? ? 1.383 1.252 0.131 0.011 N 6 1 CD A GLU 60 ? ? OE2 A GLU 60 ? ? 1.327 1.252 0.075 0.011 N 7 1 CG A GLU 69 ? ? CD A GLU 69 ? ? 1.406 1.515 -0.109 0.015 N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 THR _pdbx_validate_rmsd_angle.auth_seq_id_1 47 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 THR _pdbx_validate_rmsd_angle.auth_seq_id_2 47 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CB _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 THR _pdbx_validate_rmsd_angle.auth_seq_id_3 47 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 89.79 _pdbx_validate_rmsd_angle.angle_target_value 110.30 _pdbx_validate_rmsd_angle.angle_deviation -20.51 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.90 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 16 ? ? 83.41 14.68 2 1 THR A 47 ? ? -144.72 -8.99 3 1 PRO A 48 ? ? 20.87 -114.58 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ARG 3 ? CG ? A ARG 3 CG 2 1 Y 0 A ARG 3 ? CD ? A ARG 3 CD 3 1 Y 0 A ARG 3 ? NE ? A ARG 3 NE 4 1 Y 0 A ARG 3 ? CZ ? A ARG 3 CZ 5 1 Y 0 A ARG 3 ? NH1 ? A ARG 3 NH1 6 1 Y 0 A ARG 3 ? NH2 ? A ARG 3 NH2 7 1 Y 0 A GLN 24 ? CG ? A GLN 24 CG 8 1 Y 0 A GLN 24 ? CD ? A GLN 24 CD 9 1 Y 0 A GLN 24 ? OE1 ? A GLN 24 OE1 10 1 Y 0 A GLN 24 ? NE2 ? A GLN 24 NE2 11 1 Y 1 A THR 47 ? OG1 ? A THR 47 OG1 12 1 Y 1 A THR 47 ? CG2 ? A THR 47 CG2 13 1 Y 0 A THR 47 ? CB ? A THR 47 CB 14 1 Y 0 A GLU 69 ? CD ? A GLU 69 CD 15 1 Y 0 A GLU 69 ? OE1 ? A GLU 69 OE1 16 1 Y 0 A GLU 69 ? OE2 ? A GLU 69 OE2 17 1 Y 0 A LEU 74 ? C ? A LEU 74 C 18 1 Y 0 A LEU 74 ? O ? A LEU 74 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLU 75 ? A GLU 75 4 1 Y 1 A HIS 76 ? A HIS 76 5 1 Y 1 A HIS 77 ? A HIS 77 6 1 Y 1 A HIS 78 ? A HIS 78 7 1 Y 1 A HIS 79 ? A HIS 79 8 1 Y 1 A HIS 80 ? A HIS 80 9 1 Y 1 A HIS 81 ? A HIS 81 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 82 1 MG MG A . C 3 HOH 1 83 1 HOH HOH A . C 3 HOH 2 84 2 HOH HOH A . C 3 HOH 3 85 4 HOH HOH A . C 3 HOH 4 86 6 HOH HOH A . C 3 HOH 5 87 8 HOH HOH A . C 3 HOH 6 88 9 HOH HOH A . C 3 HOH 7 89 10 HOH HOH A . C 3 HOH 8 90 12 HOH HOH A . C 3 HOH 9 91 15 HOH HOH A . C 3 HOH 10 92 17 HOH HOH A . C 3 HOH 11 93 18 HOH HOH A . C 3 HOH 12 94 23 HOH HOH A . C 3 HOH 13 95 24 HOH HOH A . C 3 HOH 14 96 25 HOH HOH A . C 3 HOH 15 97 26 HOH HOH A . C 3 HOH 16 98 27 HOH HOH A . C 3 HOH 17 99 28 HOH HOH A . C 3 HOH 18 100 31 HOH HOH A . C 3 HOH 19 101 43 HOH HOH A . C 3 HOH 20 102 45 HOH HOH A . C 3 HOH 21 103 46 HOH HOH A . C 3 HOH 22 104 48 HOH HOH A . #