data_3U2R # _entry.id 3U2R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 3U2R RCSB RCSB068232 WWPDB D_1000068232 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC101285 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3U2R _pdbx_database_status.recvd_initial_deposition_date 2011-10-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Michalska, K.' 1 'Li, H.' 2 'Bearden, J.' 3 'Joachimiak, A.' 4 'Midwest Center for Structural Genomics (MCSG)' 5 # _citation.id primary _citation.title 'Crystal structure of MarR transcription factor from Planctomyces limnophilus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Michalska, K.' 1 primary 'Li, H.' 2 primary 'Bearden, J.' 3 primary 'Joachimiak, A.' 4 primary 'Midwest Center for Structural Genomics (MCSG)' 5 # _cell.entry_id 3U2R _cell.length_a 64.970 _cell.length_b 64.970 _cell.length_c 87.260 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3U2R _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Regulatory protein MarR' 19897.035 1 ? ? ? ? 2 water nat water 18.015 20 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MarR transcription factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)NERSRPLRFDSLTQEAYLQLWRTYDR(MSE)KAIEEEIFSQFELSAQQYNTLRLLRSVHPEG(MSE)ATLQI ADRLISRAPDITRLIDRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRL (MSE)ELARTPHEEPGSRWIADRSRPS ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMNERSRPLRFDSLTQEAYLQLWRTYDRMKAIEEEIFSQFELSAQQYNTLRLLRSVHPEGMATLQIADRLISRAPDIT RLIDRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELARTPHEEPGSRW IADRSRPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC101285 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 ASN n 1 6 GLU n 1 7 ARG n 1 8 SER n 1 9 ARG n 1 10 PRO n 1 11 LEU n 1 12 ARG n 1 13 PHE n 1 14 ASP n 1 15 SER n 1 16 LEU n 1 17 THR n 1 18 GLN n 1 19 GLU n 1 20 ALA n 1 21 TYR n 1 22 LEU n 1 23 GLN n 1 24 LEU n 1 25 TRP n 1 26 ARG n 1 27 THR n 1 28 TYR n 1 29 ASP n 1 30 ARG n 1 31 MSE n 1 32 LYS n 1 33 ALA n 1 34 ILE n 1 35 GLU n 1 36 GLU n 1 37 GLU n 1 38 ILE n 1 39 PHE n 1 40 SER n 1 41 GLN n 1 42 PHE n 1 43 GLU n 1 44 LEU n 1 45 SER n 1 46 ALA n 1 47 GLN n 1 48 GLN n 1 49 TYR n 1 50 ASN n 1 51 THR n 1 52 LEU n 1 53 ARG n 1 54 LEU n 1 55 LEU n 1 56 ARG n 1 57 SER n 1 58 VAL n 1 59 HIS n 1 60 PRO n 1 61 GLU n 1 62 GLY n 1 63 MSE n 1 64 ALA n 1 65 THR n 1 66 LEU n 1 67 GLN n 1 68 ILE n 1 69 ALA n 1 70 ASP n 1 71 ARG n 1 72 LEU n 1 73 ILE n 1 74 SER n 1 75 ARG n 1 76 ALA n 1 77 PRO n 1 78 ASP n 1 79 ILE n 1 80 THR n 1 81 ARG n 1 82 LEU n 1 83 ILE n 1 84 ASP n 1 85 ARG n 1 86 LEU n 1 87 ASP n 1 88 ASP n 1 89 ARG n 1 90 GLY n 1 91 LEU n 1 92 VAL n 1 93 LEU n 1 94 ARG n 1 95 THR n 1 96 ARG n 1 97 LYS n 1 98 PRO n 1 99 GLU n 1 100 ASN n 1 101 ARG n 1 102 ARG n 1 103 VAL n 1 104 VAL n 1 105 GLU n 1 106 VAL n 1 107 ALA n 1 108 LEU n 1 109 THR n 1 110 ASP n 1 111 ALA n 1 112 GLY n 1 113 LEU n 1 114 LYS n 1 115 LEU n 1 116 LEU n 1 117 LYS n 1 118 ASP n 1 119 LEU n 1 120 GLU n 1 121 GLU n 1 122 PRO n 1 123 VAL n 1 124 ARG n 1 125 GLN n 1 126 CYS n 1 127 HIS n 1 128 GLU n 1 129 ARG n 1 130 GLN n 1 131 LEU n 1 132 GLY n 1 133 HIS n 1 134 LEU n 1 135 ALA n 1 136 ALA n 1 137 ASP n 1 138 GLU n 1 139 LEU n 1 140 HIS n 1 141 GLU n 1 142 LEU n 1 143 ILE n 1 144 ARG n 1 145 LEU n 1 146 MSE n 1 147 GLU n 1 148 LEU n 1 149 ALA n 1 150 ARG n 1 151 THR n 1 152 PRO n 1 153 HIS n 1 154 GLU n 1 155 GLU n 1 156 PRO n 1 157 GLY n 1 158 SER n 1 159 ARG n 1 160 TRP n 1 161 ILE n 1 162 ALA n 1 163 ASP n 1 164 ARG n 1 165 SER n 1 166 ARG n 1 167 PRO n 1 168 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Plim_0262 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 3776' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Planctomyces limnophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 521674 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D5SNV8_PLAL2 _struct_ref.pdbx_db_accession D5SNV8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNERSRPLRFDSLTQEAYLQLWRTYDRMKAIEEEIFSQFELSAQQYNTLRLLRSVHPEGMATLQIADRLISRAPDITRLI DRLDDRGLVLRTRKPENRRVVEVALTDAGLKLLKDLEEPVRQCHERQLGHLAADELHELIRLMELARTPHEEPGSRWIAD RSRPS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3U2R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 168 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D5SNV8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 165 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 165 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3U2R SER A 1 ? UNP D5SNV8 ? ? 'EXPRESSION TAG' -2 1 1 3U2R ASN A 2 ? UNP D5SNV8 ? ? 'EXPRESSION TAG' -1 2 1 3U2R ALA A 3 ? UNP D5SNV8 ? ? 'EXPRESSION TAG' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 3U2R _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_percent_sol 46.84 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details ;0.64 M malonic acid, 0.0875 M monoammonium malate, 0.14 M sodium acetate, 0.175 M sodium formate, 0.056 M ammonium tartrate, pH 7.0, 0.1 M Bis-Tris propane:NaOH, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 289K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2011-06-03 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97929 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97929 # _reflns.entry_id 3U2R _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.0 _reflns.d_resolution_high 2.20 _reflns.number_obs 9939 _reflns.number_all 10039 _reflns.percent_possible_obs 99.0 _reflns.pdbx_Rmerge_I_obs 0.111 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.4 _reflns.B_iso_Wilson_estimate 48.26 _reflns.pdbx_redundancy 5.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.24 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.619 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.8 _reflns_shell.pdbx_redundancy 5.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 993 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3U2R _refine.ls_number_reflns_obs 9900 _refine.ls_number_reflns_all 9900 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 32.48 _refine.ls_d_res_high 2.20 _refine.ls_percent_reflns_obs 99.01 _refine.ls_R_factor_obs 0.2062 _refine.ls_R_factor_all 0.2062 _refine.ls_R_factor_R_work 0.2012 _refine.ls_R_factor_R_free 0.2533 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.03 _refine.ls_number_reflns_R_free 993 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.9335 _refine.correlation_coeff_Fo_to_Fc_free 0.8937 _refine.B_iso_mean 60.30 _refine.aniso_B[1][1] -5.1149 _refine.aniso_B[2][2] -5.1149 _refine.aniso_B[3][3] 10.2298 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGEN ATOMS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model isotropic _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI 0.511 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 3U2R _refine_analyze.Luzzati_coordinate_error_obs 0.303 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1113 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 1133 _refine_hist.d_res_high 2.20 _refine_hist.d_res_low 32.48 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id t_bond_d 0.014 ? 2.00 2256 HARMONIC 'X-RAY DIFFRACTION' t_angle_deg 1.15 ? 2.00 4081 HARMONIC 'X-RAY DIFFRACTION' t_dihedral_angle_d ? ? 2.00 656 SINUSOIDAL 'X-RAY DIFFRACTION' t_trig_c_planes ? ? 2.00 34 HARMONIC 'X-RAY DIFFRACTION' t_gen_planes ? ? 5.00 326 HARMONIC 'X-RAY DIFFRACTION' t_it ? ? 20.00 2256 HARMONIC 'X-RAY DIFFRACTION' t_omega_torsion 3.62 ? ? ? ? 'X-RAY DIFFRACTION' t_other_torsion 3.23 ? ? ? ? 'X-RAY DIFFRACTION' t_chiral_improper_torsion ? ? 5.00 144 SEMIHARMONIC 'X-RAY DIFFRACTION' t_ideal_dist_contact ? ? 4.00 2530 SEMIHARMONIC 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.d_res_high 2.20 _refine_ls_shell.d_res_low 2.46 _refine_ls_shell.number_reflns_R_work 2443 _refine_ls_shell.R_factor_R_work 0.1847 _refine_ls_shell.percent_reflns_obs 99.01 _refine_ls_shell.R_factor_R_free 0.2301 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 10.84 _refine_ls_shell.number_reflns_R_free 297 _refine_ls_shell.number_reflns_all 2740 _refine_ls_shell.R_factor_all 0.1900 _refine_ls_shell.number_reflns_obs 2740 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 3U2R _struct.title 'Crystal structure of MarR transcription factor from Planctomyces limnophilus' _struct.pdbx_descriptor 'Regulatory protein MarR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3U2R _struct_keywords.pdbx_keywords 'transcription regulator' _struct_keywords.text 'Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, helix-turn-helix, transcription regulator' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 17 ? GLN A 41 ? THR A 14 GLN A 38 1 ? 25 HELX_P HELX_P2 2 SER A 45 ? HIS A 59 ? SER A 42 HIS A 56 1 ? 15 HELX_P HELX_P3 3 THR A 65 ? LEU A 72 ? THR A 62 LEU A 69 1 ? 8 HELX_P HELX_P4 4 PRO A 77 ? ARG A 89 ? PRO A 74 ARG A 86 1 ? 13 HELX_P HELX_P5 5 THR A 109 ? ALA A 149 ? THR A 106 ALA A 146 1 ? 41 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ARG 30 C ? ? ? 1_555 A MSE 31 N ? ? A ARG 27 A MSE 28 1_555 ? ? ? ? ? ? ? 1.302 ? covale2 covale ? ? A MSE 31 C ? ? ? 1_555 A LYS 32 N ? ? A MSE 28 A LYS 29 1_555 ? ? ? ? ? ? ? 1.320 ? covale3 covale ? ? A GLY 62 C ? ? ? 1_555 A MSE 63 N ? ? A GLY 59 A MSE 60 1_555 ? ? ? ? ? ? ? 1.321 ? covale4 covale ? ? A MSE 63 C ? ? ? 1_555 A ALA 64 N ? ? A MSE 60 A ALA 61 1_555 ? ? ? ? ? ? ? 1.346 ? covale5 covale ? ? A LEU 145 C ? ? ? 1_555 A MSE 146 N ? ? A LEU 142 A MSE 143 1_555 ? ? ? ? ? ? ? 1.358 ? covale6 covale ? ? A MSE 146 C ? ? ? 1_555 A GLU 147 N ? ? A MSE 143 A GLU 144 1_555 ? ? ? ? ? ? ? 1.340 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id HIS _struct_mon_prot_cis.label_seq_id 59 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id HIS _struct_mon_prot_cis.auth_seq_id 56 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 60 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 57 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.91 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MSE A 63 ? ALA A 64 ? MSE A 60 ALA A 61 A 2 ASN A 100 ? LEU A 108 ? ASN A 97 LEU A 105 A 3 VAL A 92 ? LYS A 97 ? VAL A 89 LYS A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MSE A 63 ? N MSE A 60 O VAL A 106 ? O VAL A 103 A 2 3 O GLU A 105 ? O GLU A 102 N THR A 95 ? N THR A 92 # _database_PDB_matrix.entry_id 3U2R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 3U2R _atom_sites.fract_transf_matrix[1][1] 0.015392 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015392 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011460 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MSE 4 1 ? ? ? A . n A 1 5 ASN 5 2 ? ? ? A . n A 1 6 GLU 6 3 ? ? ? A . n A 1 7 ARG 7 4 ? ? ? A . n A 1 8 SER 8 5 ? ? ? A . n A 1 9 ARG 9 6 ? ? ? A . n A 1 10 PRO 10 7 ? ? ? A . n A 1 11 LEU 11 8 ? ? ? A . n A 1 12 ARG 12 9 9 ARG ARG A . n A 1 13 PHE 13 10 10 PHE PHE A . n A 1 14 ASP 14 11 11 ASP ASP A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 THR 17 14 14 THR THR A . n A 1 18 GLN 18 15 15 GLN GLN A . n A 1 19 GLU 19 16 16 GLU GLU A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 TYR 21 18 18 TYR TYR A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 GLN 23 20 20 GLN GLN A . n A 1 24 LEU 24 21 21 LEU LEU A . n A 1 25 TRP 25 22 22 TRP TRP A . n A 1 26 ARG 26 23 23 ARG ARG A . n A 1 27 THR 27 24 24 THR THR A . n A 1 28 TYR 28 25 25 TYR TYR A . n A 1 29 ASP 29 26 26 ASP ASP A . n A 1 30 ARG 30 27 27 ARG ARG A . n A 1 31 MSE 31 28 28 MSE MSE A . n A 1 32 LYS 32 29 29 LYS LYS A . n A 1 33 ALA 33 30 30 ALA ALA A . n A 1 34 ILE 34 31 31 ILE ILE A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 GLU 36 33 33 GLU GLU A . n A 1 37 GLU 37 34 34 GLU GLU A . n A 1 38 ILE 38 35 35 ILE ILE A . n A 1 39 PHE 39 36 36 PHE PHE A . n A 1 40 SER 40 37 37 SER SER A . n A 1 41 GLN 41 38 38 GLN GLN A . n A 1 42 PHE 42 39 39 PHE PHE A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 LEU 44 41 41 LEU LEU A . n A 1 45 SER 45 42 42 SER SER A . n A 1 46 ALA 46 43 43 ALA ALA A . n A 1 47 GLN 47 44 44 GLN GLN A . n A 1 48 GLN 48 45 45 GLN GLN A . n A 1 49 TYR 49 46 46 TYR TYR A . n A 1 50 ASN 50 47 47 ASN ASN A . n A 1 51 THR 51 48 48 THR THR A . n A 1 52 LEU 52 49 49 LEU LEU A . n A 1 53 ARG 53 50 50 ARG ARG A . n A 1 54 LEU 54 51 51 LEU LEU A . n A 1 55 LEU 55 52 52 LEU LEU A . n A 1 56 ARG 56 53 53 ARG ARG A . n A 1 57 SER 57 54 54 SER SER A . n A 1 58 VAL 58 55 55 VAL VAL A . n A 1 59 HIS 59 56 56 HIS HIS A . n A 1 60 PRO 60 57 57 PRO PRO A . n A 1 61 GLU 61 58 58 GLU GLU A . n A 1 62 GLY 62 59 59 GLY GLY A . n A 1 63 MSE 63 60 60 MSE MSE A . n A 1 64 ALA 64 61 61 ALA ALA A . n A 1 65 THR 65 62 62 THR THR A . n A 1 66 LEU 66 63 63 LEU LEU A . n A 1 67 GLN 67 64 64 GLN GLN A . n A 1 68 ILE 68 65 65 ILE ILE A . n A 1 69 ALA 69 66 66 ALA ALA A . n A 1 70 ASP 70 67 67 ASP ASP A . n A 1 71 ARG 71 68 68 ARG ARG A . n A 1 72 LEU 72 69 69 LEU LEU A . n A 1 73 ILE 73 70 ? ? ? A . n A 1 74 SER 74 71 ? ? ? A . n A 1 75 ARG 75 72 ? ? ? A . n A 1 76 ALA 76 73 73 ALA ALA A . n A 1 77 PRO 77 74 74 PRO PRO A . n A 1 78 ASP 78 75 75 ASP ASP A . n A 1 79 ILE 79 76 76 ILE ILE A . n A 1 80 THR 80 77 77 THR THR A . n A 1 81 ARG 81 78 78 ARG ARG A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 ILE 83 80 80 ILE ILE A . n A 1 84 ASP 84 81 81 ASP ASP A . n A 1 85 ARG 85 82 82 ARG ARG A . n A 1 86 LEU 86 83 83 LEU LEU A . n A 1 87 ASP 87 84 84 ASP ASP A . n A 1 88 ASP 88 85 85 ASP ASP A . n A 1 89 ARG 89 86 86 ARG ARG A . n A 1 90 GLY 90 87 87 GLY GLY A . n A 1 91 LEU 91 88 88 LEU LEU A . n A 1 92 VAL 92 89 89 VAL VAL A . n A 1 93 LEU 93 90 90 LEU LEU A . n A 1 94 ARG 94 91 91 ARG ARG A . n A 1 95 THR 95 92 92 THR THR A . n A 1 96 ARG 96 93 93 ARG ARG A . n A 1 97 LYS 97 94 94 LYS LYS A . n A 1 98 PRO 98 95 95 PRO PRO A . n A 1 99 GLU 99 96 96 GLU GLU A . n A 1 100 ASN 100 97 97 ASN ASN A . n A 1 101 ARG 101 98 98 ARG ARG A . n A 1 102 ARG 102 99 99 ARG ARG A . n A 1 103 VAL 103 100 100 VAL VAL A . n A 1 104 VAL 104 101 101 VAL VAL A . n A 1 105 GLU 105 102 102 GLU GLU A . n A 1 106 VAL 106 103 103 VAL VAL A . n A 1 107 ALA 107 104 104 ALA ALA A . n A 1 108 LEU 108 105 105 LEU LEU A . n A 1 109 THR 109 106 106 THR THR A . n A 1 110 ASP 110 107 107 ASP ASP A . n A 1 111 ALA 111 108 108 ALA ALA A . n A 1 112 GLY 112 109 109 GLY GLY A . n A 1 113 LEU 113 110 110 LEU LEU A . n A 1 114 LYS 114 111 111 LYS LYS A . n A 1 115 LEU 115 112 112 LEU LEU A . n A 1 116 LEU 116 113 113 LEU LEU A . n A 1 117 LYS 117 114 114 LYS LYS A . n A 1 118 ASP 118 115 115 ASP ASP A . n A 1 119 LEU 119 116 116 LEU LEU A . n A 1 120 GLU 120 117 117 GLU GLU A . n A 1 121 GLU 121 118 118 GLU GLU A . n A 1 122 PRO 122 119 119 PRO PRO A . n A 1 123 VAL 123 120 120 VAL VAL A . n A 1 124 ARG 124 121 121 ARG ARG A . n A 1 125 GLN 125 122 122 GLN GLN A . n A 1 126 CYS 126 123 123 CYS CYS A . n A 1 127 HIS 127 124 124 HIS HIS A . n A 1 128 GLU 128 125 125 GLU GLU A . n A 1 129 ARG 129 126 126 ARG ARG A . n A 1 130 GLN 130 127 127 GLN GLN A . n A 1 131 LEU 131 128 128 LEU LEU A . n A 1 132 GLY 132 129 129 GLY GLY A . n A 1 133 HIS 133 130 130 HIS HIS A . n A 1 134 LEU 134 131 131 LEU LEU A . n A 1 135 ALA 135 132 132 ALA ALA A . n A 1 136 ALA 136 133 133 ALA ALA A . n A 1 137 ASP 137 134 134 ASP ASP A . n A 1 138 GLU 138 135 135 GLU GLU A . n A 1 139 LEU 139 136 136 LEU LEU A . n A 1 140 HIS 140 137 137 HIS HIS A . n A 1 141 GLU 141 138 138 GLU GLU A . n A 1 142 LEU 142 139 139 LEU LEU A . n A 1 143 ILE 143 140 140 ILE ILE A . n A 1 144 ARG 144 141 141 ARG ARG A . n A 1 145 LEU 145 142 142 LEU LEU A . n A 1 146 MSE 146 143 143 MSE MSE A . n A 1 147 GLU 147 144 144 GLU GLU A . n A 1 148 LEU 148 145 145 LEU LEU A . n A 1 149 ALA 149 146 146 ALA ALA A . n A 1 150 ARG 150 147 ? ? ? A . n A 1 151 THR 151 148 ? ? ? A . n A 1 152 PRO 152 149 ? ? ? A . n A 1 153 HIS 153 150 ? ? ? A . n A 1 154 GLU 154 151 ? ? ? A . n A 1 155 GLU 155 152 ? ? ? A . n A 1 156 PRO 156 153 ? ? ? A . n A 1 157 GLY 157 154 ? ? ? A . n A 1 158 SER 158 155 ? ? ? A . n A 1 159 ARG 159 156 ? ? ? A . n A 1 160 TRP 160 157 ? ? ? A . n A 1 161 ILE 161 158 ? ? ? A . n A 1 162 ALA 162 159 ? ? ? A . n A 1 163 ASP 163 160 ? ? ? A . n A 1 164 ARG 164 161 ? ? ? A . n A 1 165 SER 165 162 ? ? ? A . n A 1 166 ARG 166 163 ? ? ? A . n A 1 167 PRO 167 164 ? ? ? A . n A 1 168 SER 168 165 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 31 A MSE 28 ? MET SELENOMETHIONINE 2 A MSE 63 A MSE 60 ? MET SELENOMETHIONINE 3 A MSE 146 A MSE 143 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 software_defined_assembly PISA tetrameric 4 2 software_defined_assembly PISA dimeric 2 3 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,3,4 A,B 2 1,2 A,B 3 1,4 A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9530 ? 1 MORE -88 ? 1 'SSA (A^2)' 29610 ? 2 'ABSA (A^2)' 3550 ? 2 MORE -29 ? 2 'SSA (A^2)' 16020 ? 3 'ABSA (A^2)' 1020 ? 3 MORE -11 ? 3 'SSA (A^2)' 18550 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 64.9700000000 0.0000000000 -1.0000000000 0.0000000000 64.9700000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 8_665 -y+1,-x+1,-z 0.0000000000 -1.0000000000 0.0000000000 64.9700000000 -1.0000000000 0.0000000000 0.0000000000 64.9700000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2011-10-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 30.7436 36.2314 17.7741 -0.0229 -0.0489 -0.0797 0.0419 0.0116 -0.0256 4.4151 3.6832 3.3227 0.6965 -2.9104 -1.2259 0.1911 -0.5442 0.3447 0.3984 -0.0557 -0.1573 -0.3039 0.2407 -0.1354 'X-RAY DIFFRACTION' 2 ? refined 19.1268 16.2629 23.7424 -0.0939 -0.0322 -0.0481 -0.1033 0.0357 0.0293 2.6774 5.3999 6.3505 0.5546 -0.2097 -2.9104 0.1520 0.0288 -0.0594 0.3420 -0.2076 0.0224 -0.2293 0.2674 0.0556 'X-RAY DIFFRACTION' 3 ? refined 15.2911 12.9724 32.7917 -0.0276 -0.0208 -0.0806 -0.1239 0.0750 -0.0239 4.3282 2.8774 6.8575 1.2360 2.6335 0.1101 0.2003 -0.5442 0.2298 0.4385 -0.1423 0.0306 -0.1618 0.0764 -0.0580 'X-RAY DIFFRACTION' 4 ? refined 25.3496 28.8426 7.1204 -0.0641 -0.0192 -0.1363 -0.0055 0.0025 0.0067 2.5620 5.3229 3.1426 2.7983 -1.8081 -2.6573 -0.0671 0.1576 0.1005 -0.1026 0.2183 0.2585 0.1627 -0.3003 -0.1512 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 9 A 32 '{A|9 - A|32}' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 33 A 67 '{A|33 - A|67}' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 68 A 110 '{A|68 - A|110}' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 111 A 146 '{A|111 - A|146}' ? ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SBC-Collect 'data collection' . ? 1 SHELX 'model building' . ? 2 MLPHARE phasing . ? 3 DM 'model building' . ? 4 ARP/wARP 'model building' . ? 5 Coot 'model building' . ? 6 BUSTER refinement 2.10.0 ? 7 HKL-3000 'data reduction' . ? 8 HKL-3000 'data scaling' . ? 9 SHELX phasing . ? 10 DM phasing . ? 11 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MSE 1 ? A MSE 4 5 1 Y 1 A ASN 2 ? A ASN 5 6 1 Y 1 A GLU 3 ? A GLU 6 7 1 Y 1 A ARG 4 ? A ARG 7 8 1 Y 1 A SER 5 ? A SER 8 9 1 Y 1 A ARG 6 ? A ARG 9 10 1 Y 1 A PRO 7 ? A PRO 10 11 1 Y 1 A LEU 8 ? A LEU 11 12 1 Y 1 A ILE 70 ? A ILE 73 13 1 Y 1 A SER 71 ? A SER 74 14 1 Y 1 A ARG 72 ? A ARG 75 15 1 Y 1 A ARG 147 ? A ARG 150 16 1 Y 1 A THR 148 ? A THR 151 17 1 Y 1 A PRO 149 ? A PRO 152 18 1 Y 1 A HIS 150 ? A HIS 153 19 1 Y 1 A GLU 151 ? A GLU 154 20 1 Y 1 A GLU 152 ? A GLU 155 21 1 Y 1 A PRO 153 ? A PRO 156 22 1 Y 1 A GLY 154 ? A GLY 157 23 1 Y 1 A SER 155 ? A SER 158 24 1 Y 1 A ARG 156 ? A ARG 159 25 1 Y 1 A TRP 157 ? A TRP 160 26 1 Y 1 A ILE 158 ? A ILE 161 27 1 Y 1 A ALA 159 ? A ALA 162 28 1 Y 1 A ASP 160 ? A ASP 163 29 1 Y 1 A ARG 161 ? A ARG 164 30 1 Y 1 A SER 162 ? A SER 165 31 1 Y 1 A ARG 163 ? A ARG 166 32 1 Y 1 A PRO 164 ? A PRO 167 33 1 Y 1 A SER 165 ? A SER 168 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 166 1 HOH HOH A . B 2 HOH 2 167 2 HOH HOH A . B 2 HOH 3 168 3 HOH HOH A . B 2 HOH 4 169 4 HOH HOH A . B 2 HOH 5 170 5 HOH HOH A . B 2 HOH 6 171 6 HOH HOH A . B 2 HOH 7 172 7 HOH HOH A . B 2 HOH 8 173 8 HOH HOH A . B 2 HOH 9 174 9 HOH HOH A . B 2 HOH 10 175 10 HOH HOH A . B 2 HOH 11 176 11 HOH HOH A . B 2 HOH 12 177 12 HOH HOH A . B 2 HOH 13 178 13 HOH HOH A . B 2 HOH 14 179 14 HOH HOH A . B 2 HOH 15 180 15 HOH HOH A . B 2 HOH 16 181 16 HOH HOH A . B 2 HOH 17 182 17 HOH HOH A . B 2 HOH 18 183 18 HOH HOH A . B 2 HOH 19 184 19 HOH HOH A . B 2 HOH 20 185 20 HOH HOH A . #