data_3UN6 # _entry.id 3UN6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 3UN6 pdb_00003un6 10.2210/pdb3un6/pdb RCSB RCSB068963 ? ? WWPDB D_1000068963 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-12-07 2 'Structure model' 1 1 2017-11-08 3 'Structure model' 2 0 2024-02-28 4 'Structure model' 2 1 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Atomic model' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Derived calculations' 7 3 'Structure model' 'Polymer sequence' 8 3 'Structure model' 'Source and taxonomy' 9 3 'Structure model' 'Structure summary' 10 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' atom_site 3 3 'Structure model' atom_site_anisotrop 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' entity 8 3 'Structure model' entity_poly 9 3 'Structure model' entity_poly_seq 10 3 'Structure model' entity_src_gen 11 3 'Structure model' pdbx_poly_seq_scheme 12 3 'Structure model' pdbx_struct_conn_angle 13 3 'Structure model' pdbx_struct_mod_residue 14 3 'Structure model' pdbx_struct_sheet_hbond 15 3 'Structure model' pdbx_unobs_or_zero_occ_residues 16 3 'Structure model' struct_conf 17 3 'Structure model' struct_conn 18 3 'Structure model' struct_mon_prot_cis 19 3 'Structure model' struct_ref 20 3 'Structure model' struct_ref_seq 21 3 'Structure model' struct_ref_seq_dif 22 3 'Structure model' struct_sheet_range 23 3 'Structure model' struct_site 24 3 'Structure model' struct_site_gen 25 4 'Structure model' pdbx_entry_details 26 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.name' 2 3 'Structure model' '_atom_site.label_seq_id' 3 3 'Structure model' '_atom_site_anisotrop.pdbx_label_seq_id' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' 6 3 'Structure model' '_entity.formula_weight' 7 3 'Structure model' '_entity.pdbx_description' 8 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 9 3 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 10 3 'Structure model' '_entity_src_gen.pdbx_beg_seq_num' 11 3 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 12 3 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 13 3 'Structure model' '_entity_src_gen.pdbx_seq_type' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 25 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 26 3 'Structure model' '_pdbx_struct_conn_angle.value' 27 3 'Structure model' '_pdbx_struct_mod_residue.details' 28 3 'Structure model' '_pdbx_struct_mod_residue.label_seq_id' 29 3 'Structure model' '_pdbx_struct_sheet_hbond.range_1_label_seq_id' 30 3 'Structure model' '_pdbx_struct_sheet_hbond.range_2_label_seq_id' 31 3 'Structure model' '_struct_conf.beg_label_seq_id' 32 3 'Structure model' '_struct_conf.end_label_seq_id' 33 3 'Structure model' '_struct_conn.pdbx_dist_value' 34 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 35 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 36 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 37 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 38 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 39 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 40 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 41 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 42 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 43 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 44 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 45 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 46 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 47 3 'Structure model' '_struct_mon_prot_cis.label_seq_id' 48 3 'Structure model' '_struct_mon_prot_cis.pdbx_label_seq_id_2' 49 3 'Structure model' '_struct_ref.pdbx_align_begin' 50 3 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 51 3 'Structure model' '_struct_ref_seq.db_align_beg' 52 3 'Structure model' '_struct_ref_seq.pdbx_auth_seq_align_beg' 53 3 'Structure model' '_struct_ref_seq.seq_align_end' 54 3 'Structure model' '_struct_ref_seq_dif.details' 55 3 'Structure model' '_struct_ref_seq_dif.pdbx_auth_seq_num' 56 3 'Structure model' '_struct_sheet_range.beg_label_seq_id' 57 3 'Structure model' '_struct_sheet_range.end_label_seq_id' 58 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 59 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 60 3 'Structure model' '_struct_site.pdbx_auth_seq_id' 61 3 'Structure model' '_struct_site_gen.label_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 3UN6 _pdbx_database_status.recvd_initial_deposition_date 2011-11-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id idp91135 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Minasov, G.' 1 'Wawrzak, Z.' 2 'Halavaty, A.' 3 'Shuvalova, L.' 4 'Dubrovska, I.' 5 'Winsor, J.' 6 'Kiryukhina, O.' 7 'Bagnoli, F.' 8 'Falugi, F.' 9 'Bottomley, M.' 10 'Grandi, G.' 11 'Anderson, W.F.' 12 'Center for Structural Genomics of Infectious Diseases (CSGID)' 13 # _citation.id primary _citation.title '2.0 Angstrom Crystal Structure of Ligand Binding Component of ABC-type Import System from Staphylococcus aureus with Zinc bound.' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Minasov, G.' 1 ? primary 'Wawrzak, Z.' 2 ? primary 'Halavaty, A.' 3 ? primary 'Shuvalova, L.' 4 ? primary 'Dubrovska, I.' 5 ? primary 'Winsor, J.' 6 ? primary 'Kiryukhina, O.' 7 ? primary 'Bagnoli, F.' 8 ? primary 'Falugi, F.' 9 ? primary 'Bottomley, M.' 10 ? primary 'Grandi, G.' 11 ? primary 'Anderson, W.F.' 12 ? primary 'Center for Structural Genomics of Infectious Diseases (CSGID)' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ABC transporter substrate-binding protein' 37486.777 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 3 ? ? ? ? 4 water nat water 18.015 105 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GSSHHHHHHENLYFQGCDWQRTSKERSKNAQNQQVIKIGYLPITHSANL(MSE)(MSE)TKKLLSQYNHPKYKLE LVKFNNWPDL(MSE)DALNSGRIDGASTLIELA(MSE)KSKQKGSNIKAVALGHHEGNVI(MSE)GQKG(MSE)HLNEFN NNGDDYHFGIPHRYSTHYLLLEELRKQLKIKPGHFSYHE(MSE)SPAE(MSE)PAALSEHRITGYSVAEPFGALGEKLGK GKTLKHGDDVIPDAYCCVLVLRGELLDQHKDVAQAFVQDYKKSGFK(MSE)NDRKQSVDI(MSE)THHFKQSRDVLTQSA AWTSYGDLTIKPSGYQEITTLVKQHHLFNPPAYDDFVEPSLYKEASRS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHENLYFQGCDWQRTSKERSKNAQNQQVIKIGYLPITHSANLMMTKKLLSQYNHPKYKLELVKFNNWPDLMD ALNSGRIDGASTLIELAMKSKQKGSNIKAVALGHHEGNVIMGQKGMHLNEFNNNGDDYHFGIPHRYSTHYLLLEELRKQL KIKPGHFSYHEMSPAEMPAALSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCVLVLRGELLDQHKDVAQAF VQDYKKSGFKMNDRKQSVDIMTHHFKQSRDVLTQSAAWTSYGDLTIKPSGYQEITTLVKQHHLFNPPAYDDFVEPSLYKE ASRS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier idp91135 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'PHOSPHATE ION' PO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLU n 1 12 ASN n 1 13 LEU n 1 14 TYR n 1 15 PHE n 1 16 GLN n 1 17 GLY n 1 18 CYS n 1 19 ASP n 1 20 TRP n 1 21 GLN n 1 22 ARG n 1 23 THR n 1 24 SER n 1 25 LYS n 1 26 GLU n 1 27 ARG n 1 28 SER n 1 29 LYS n 1 30 ASN n 1 31 ALA n 1 32 GLN n 1 33 ASN n 1 34 GLN n 1 35 GLN n 1 36 VAL n 1 37 ILE n 1 38 LYS n 1 39 ILE n 1 40 GLY n 1 41 TYR n 1 42 LEU n 1 43 PRO n 1 44 ILE n 1 45 THR n 1 46 HIS n 1 47 SER n 1 48 ALA n 1 49 ASN n 1 50 LEU n 1 51 MSE n 1 52 MSE n 1 53 THR n 1 54 LYS n 1 55 LYS n 1 56 LEU n 1 57 LEU n 1 58 SER n 1 59 GLN n 1 60 TYR n 1 61 ASN n 1 62 HIS n 1 63 PRO n 1 64 LYS n 1 65 TYR n 1 66 LYS n 1 67 LEU n 1 68 GLU n 1 69 LEU n 1 70 VAL n 1 71 LYS n 1 72 PHE n 1 73 ASN n 1 74 ASN n 1 75 TRP n 1 76 PRO n 1 77 ASP n 1 78 LEU n 1 79 MSE n 1 80 ASP n 1 81 ALA n 1 82 LEU n 1 83 ASN n 1 84 SER n 1 85 GLY n 1 86 ARG n 1 87 ILE n 1 88 ASP n 1 89 GLY n 1 90 ALA n 1 91 SER n 1 92 THR n 1 93 LEU n 1 94 ILE n 1 95 GLU n 1 96 LEU n 1 97 ALA n 1 98 MSE n 1 99 LYS n 1 100 SER n 1 101 LYS n 1 102 GLN n 1 103 LYS n 1 104 GLY n 1 105 SER n 1 106 ASN n 1 107 ILE n 1 108 LYS n 1 109 ALA n 1 110 VAL n 1 111 ALA n 1 112 LEU n 1 113 GLY n 1 114 HIS n 1 115 HIS n 1 116 GLU n 1 117 GLY n 1 118 ASN n 1 119 VAL n 1 120 ILE n 1 121 MSE n 1 122 GLY n 1 123 GLN n 1 124 LYS n 1 125 GLY n 1 126 MSE n 1 127 HIS n 1 128 LEU n 1 129 ASN n 1 130 GLU n 1 131 PHE n 1 132 ASN n 1 133 ASN n 1 134 ASN n 1 135 GLY n 1 136 ASP n 1 137 ASP n 1 138 TYR n 1 139 HIS n 1 140 PHE n 1 141 GLY n 1 142 ILE n 1 143 PRO n 1 144 HIS n 1 145 ARG n 1 146 TYR n 1 147 SER n 1 148 THR n 1 149 HIS n 1 150 TYR n 1 151 LEU n 1 152 LEU n 1 153 LEU n 1 154 GLU n 1 155 GLU n 1 156 LEU n 1 157 ARG n 1 158 LYS n 1 159 GLN n 1 160 LEU n 1 161 LYS n 1 162 ILE n 1 163 LYS n 1 164 PRO n 1 165 GLY n 1 166 HIS n 1 167 PHE n 1 168 SER n 1 169 TYR n 1 170 HIS n 1 171 GLU n 1 172 MSE n 1 173 SER n 1 174 PRO n 1 175 ALA n 1 176 GLU n 1 177 MSE n 1 178 PRO n 1 179 ALA n 1 180 ALA n 1 181 LEU n 1 182 SER n 1 183 GLU n 1 184 HIS n 1 185 ARG n 1 186 ILE n 1 187 THR n 1 188 GLY n 1 189 TYR n 1 190 SER n 1 191 VAL n 1 192 ALA n 1 193 GLU n 1 194 PRO n 1 195 PHE n 1 196 GLY n 1 197 ALA n 1 198 LEU n 1 199 GLY n 1 200 GLU n 1 201 LYS n 1 202 LEU n 1 203 GLY n 1 204 LYS n 1 205 GLY n 1 206 LYS n 1 207 THR n 1 208 LEU n 1 209 LYS n 1 210 HIS n 1 211 GLY n 1 212 ASP n 1 213 ASP n 1 214 VAL n 1 215 ILE n 1 216 PRO n 1 217 ASP n 1 218 ALA n 1 219 TYR n 1 220 CYS n 1 221 CYS n 1 222 VAL n 1 223 LEU n 1 224 VAL n 1 225 LEU n 1 226 ARG n 1 227 GLY n 1 228 GLU n 1 229 LEU n 1 230 LEU n 1 231 ASP n 1 232 GLN n 1 233 HIS n 1 234 LYS n 1 235 ASP n 1 236 VAL n 1 237 ALA n 1 238 GLN n 1 239 ALA n 1 240 PHE n 1 241 VAL n 1 242 GLN n 1 243 ASP n 1 244 TYR n 1 245 LYS n 1 246 LYS n 1 247 SER n 1 248 GLY n 1 249 PHE n 1 250 LYS n 1 251 MSE n 1 252 ASN n 1 253 ASP n 1 254 ARG n 1 255 LYS n 1 256 GLN n 1 257 SER n 1 258 VAL n 1 259 ASP n 1 260 ILE n 1 261 MSE n 1 262 THR n 1 263 HIS n 1 264 HIS n 1 265 PHE n 1 266 LYS n 1 267 GLN n 1 268 SER n 1 269 ARG n 1 270 ASP n 1 271 VAL n 1 272 LEU n 1 273 THR n 1 274 GLN n 1 275 SER n 1 276 ALA n 1 277 ALA n 1 278 TRP n 1 279 THR n 1 280 SER n 1 281 TYR n 1 282 GLY n 1 283 ASP n 1 284 LEU n 1 285 THR n 1 286 ILE n 1 287 LYS n 1 288 PRO n 1 289 SER n 1 290 GLY n 1 291 TYR n 1 292 GLN n 1 293 GLU n 1 294 ILE n 1 295 THR n 1 296 THR n 1 297 LEU n 1 298 VAL n 1 299 LYS n 1 300 GLN n 1 301 HIS n 1 302 HIS n 1 303 LEU n 1 304 PHE n 1 305 ASN n 1 306 PRO n 1 307 PRO n 1 308 ALA n 1 309 TYR n 1 310 ASP n 1 311 ASP n 1 312 PHE n 1 313 VAL n 1 314 GLU n 1 315 PRO n 1 316 SER n 1 317 LEU n 1 318 TYR n 1 319 LYS n 1 320 GLU n 1 321 ALA n 1 322 SER n 1 323 ARG n 1 324 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 324 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SAOUHSC_00137 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'NCTC 8325' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus NCTC 8325' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 93061 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 15b' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 HIS 8 8 ? ? ? A . n A 1 9 HIS 9 9 ? ? ? A . n A 1 10 HIS 10 10 ? ? ? A . n A 1 11 GLU 11 11 ? ? ? A . n A 1 12 ASN 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 TYR 14 14 ? ? ? A . n A 1 15 PHE 15 15 ? ? ? A . n A 1 16 GLN 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 CYS 18 18 ? ? ? A . n A 1 19 ASP 19 19 ? ? ? A . n A 1 20 TRP 20 20 ? ? ? A . n A 1 21 GLN 21 21 ? ? ? A . n A 1 22 ARG 22 22 ? ? ? A . n A 1 23 THR 23 23 ? ? ? A . n A 1 24 SER 24 24 ? ? ? A . n A 1 25 LYS 25 25 ? ? ? A . n A 1 26 GLU 26 26 ? ? ? A . n A 1 27 ARG 27 27 ? ? ? A . n A 1 28 SER 28 28 ? ? ? A . n A 1 29 LYS 29 29 ? ? ? A . n A 1 30 ASN 30 30 ? ? ? A . n A 1 31 ALA 31 31 ? ? ? A . n A 1 32 GLN 32 32 ? ? ? A . n A 1 33 ASN 33 33 ? ? ? A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 MSE 51 51 51 MSE MSE A . n A 1 52 MSE 52 52 52 MSE MSE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 MSE 79 79 79 MSE MSE A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 MSE 98 98 98 MSE MSE A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 MSE 121 121 121 MSE MSE A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 MSE 126 126 126 MSE MSE A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 HIS 149 149 149 HIS HIS A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 HIS 166 166 166 HIS HIS A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 MSE 172 172 172 MSE MSE A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 PRO 174 174 174 PRO PRO A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 MSE 177 177 177 MSE MSE A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 HIS 184 184 184 HIS HIS A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 HIS 210 210 210 HIS HIS A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 PRO 216 216 216 PRO PRO A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 TYR 219 219 219 TYR TYR A . n A 1 220 CYS 220 220 220 CYS CYS A . n A 1 221 CYS 221 221 221 CYS CYS A . n A 1 222 VAL 222 222 222 VAL VAL A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 ARG 226 226 226 ARG ARG A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 LEU 230 230 230 LEU LEU A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 GLN 232 232 232 GLN GLN A . n A 1 233 HIS 233 233 233 HIS HIS A . n A 1 234 LYS 234 234 234 LYS LYS A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 GLN 238 238 238 GLN GLN A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 GLN 242 242 242 GLN GLN A . n A 1 243 ASP 243 243 243 ASP ASP A . n A 1 244 TYR 244 244 244 TYR TYR A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 GLY 248 248 248 GLY GLY A . n A 1 249 PHE 249 249 249 PHE PHE A . n A 1 250 LYS 250 250 250 LYS LYS A . n A 1 251 MSE 251 251 251 MSE MSE A . n A 1 252 ASN 252 252 252 ASN ASN A . n A 1 253 ASP 253 253 253 ASP ASP A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 GLN 256 256 256 GLN GLN A . n A 1 257 SER 257 257 257 SER SER A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 ASP 259 259 259 ASP ASP A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 MSE 261 261 261 MSE MSE A . n A 1 262 THR 262 262 262 THR THR A . n A 1 263 HIS 263 263 263 HIS HIS A . n A 1 264 HIS 264 264 264 HIS HIS A . n A 1 265 PHE 265 265 265 PHE PHE A . n A 1 266 LYS 266 266 266 LYS LYS A . n A 1 267 GLN 267 267 267 GLN GLN A . n A 1 268 SER 268 268 268 SER SER A . n A 1 269 ARG 269 269 269 ARG ARG A . n A 1 270 ASP 270 270 270 ASP ASP A . n A 1 271 VAL 271 271 271 VAL VAL A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 THR 273 273 273 THR THR A . n A 1 274 GLN 274 274 274 GLN GLN A . n A 1 275 SER 275 275 275 SER SER A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 ALA 277 277 277 ALA ALA A . n A 1 278 TRP 278 278 278 TRP TRP A . n A 1 279 THR 279 279 279 THR THR A . n A 1 280 SER 280 280 280 SER SER A . n A 1 281 TYR 281 281 281 TYR TYR A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 THR 285 285 285 THR THR A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 PRO 288 288 288 PRO PRO A . n A 1 289 SER 289 289 289 SER SER A . n A 1 290 GLY 290 290 290 GLY GLY A . n A 1 291 TYR 291 291 291 TYR TYR A . n A 1 292 GLN 292 292 292 GLN GLN A . n A 1 293 GLU 293 293 293 GLU GLU A . n A 1 294 ILE 294 294 294 ILE ILE A . n A 1 295 THR 295 295 295 THR THR A . n A 1 296 THR 296 296 296 THR THR A . n A 1 297 LEU 297 297 297 LEU LEU A . n A 1 298 VAL 298 298 298 VAL VAL A . n A 1 299 LYS 299 299 299 LYS LYS A . n A 1 300 GLN 300 300 300 GLN GLN A . n A 1 301 HIS 301 301 301 HIS HIS A . n A 1 302 HIS 302 302 302 HIS HIS A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 PHE 304 304 304 PHE PHE A . n A 1 305 ASN 305 305 305 ASN ASN A . n A 1 306 PRO 306 306 306 PRO PRO A . n A 1 307 PRO 307 307 307 PRO PRO A . n A 1 308 ALA 308 308 308 ALA ALA A . n A 1 309 TYR 309 309 309 TYR TYR A . n A 1 310 ASP 310 310 310 ASP ASP A . n A 1 311 ASP 311 311 311 ASP ASP A . n A 1 312 PHE 312 312 312 PHE PHE A . n A 1 313 VAL 313 313 313 VAL VAL A . n A 1 314 GLU 314 314 314 GLU GLU A . n A 1 315 PRO 315 315 315 PRO PRO A . n A 1 316 SER 316 316 316 SER SER A . n A 1 317 LEU 317 317 317 LEU LEU A . n A 1 318 TYR 318 318 318 TYR TYR A . n A 1 319 LYS 319 319 319 LYS LYS A . n A 1 320 GLU 320 320 320 GLU GLU A . n A 1 321 ALA 321 321 321 ALA ALA A . n A 1 322 SER 322 322 322 SER SER A . n A 1 323 ARG 323 323 323 ARG ARG A . n A 1 324 SER 324 324 324 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 325 1 ZN ZN A . C 2 ZN 1 326 2 ZN ZN A . D 3 PO4 1 327 3 PO4 PO4 A . E 3 PO4 1 328 4 PO4 PO4 A . F 3 PO4 1 329 5 PO4 PO4 A . G 4 HOH 1 330 6 HOH HOH A . G 4 HOH 2 331 7 HOH HOH A . G 4 HOH 3 332 8 HOH HOH A . G 4 HOH 4 333 9 HOH HOH A . G 4 HOH 5 334 10 HOH HOH A . G 4 HOH 6 335 11 HOH HOH A . G 4 HOH 7 336 12 HOH HOH A . G 4 HOH 8 337 13 HOH HOH A . G 4 HOH 9 338 14 HOH HOH A . G 4 HOH 10 339 15 HOH HOH A . G 4 HOH 11 340 16 HOH HOH A . G 4 HOH 12 341 17 HOH HOH A . G 4 HOH 13 342 18 HOH HOH A . G 4 HOH 14 343 19 HOH HOH A . G 4 HOH 15 344 20 HOH HOH A . G 4 HOH 16 345 21 HOH HOH A . G 4 HOH 17 346 22 HOH HOH A . G 4 HOH 18 347 23 HOH HOH A . G 4 HOH 19 348 24 HOH HOH A . G 4 HOH 20 349 25 HOH HOH A . G 4 HOH 21 350 26 HOH HOH A . G 4 HOH 22 351 27 HOH HOH A . G 4 HOH 23 352 28 HOH HOH A . G 4 HOH 24 353 29 HOH HOH A . G 4 HOH 25 354 30 HOH HOH A . G 4 HOH 26 355 31 HOH HOH A . G 4 HOH 27 356 32 HOH HOH A . G 4 HOH 28 357 33 HOH HOH A . G 4 HOH 29 358 34 HOH HOH A . G 4 HOH 30 359 35 HOH HOH A . G 4 HOH 31 360 36 HOH HOH A . G 4 HOH 32 361 37 HOH HOH A . G 4 HOH 33 362 38 HOH HOH A . G 4 HOH 34 363 39 HOH HOH A . G 4 HOH 35 364 40 HOH HOH A . G 4 HOH 36 365 41 HOH HOH A . G 4 HOH 37 366 42 HOH HOH A . G 4 HOH 38 367 43 HOH HOH A . G 4 HOH 39 368 44 HOH HOH A . G 4 HOH 40 369 45 HOH HOH A . G 4 HOH 41 370 46 HOH HOH A . G 4 HOH 42 371 47 HOH HOH A . G 4 HOH 43 372 48 HOH HOH A . G 4 HOH 44 373 49 HOH HOH A . G 4 HOH 45 374 50 HOH HOH A . G 4 HOH 46 375 51 HOH HOH A . G 4 HOH 47 376 52 HOH HOH A . G 4 HOH 48 377 53 HOH HOH A . G 4 HOH 49 378 54 HOH HOH A . G 4 HOH 50 379 55 HOH HOH A . G 4 HOH 51 380 56 HOH HOH A . G 4 HOH 52 381 57 HOH HOH A . G 4 HOH 53 382 58 HOH HOH A . G 4 HOH 54 383 59 HOH HOH A . G 4 HOH 55 384 60 HOH HOH A . G 4 HOH 56 385 61 HOH HOH A . G 4 HOH 57 386 62 HOH HOH A . G 4 HOH 58 387 63 HOH HOH A . G 4 HOH 59 388 64 HOH HOH A . G 4 HOH 60 389 65 HOH HOH A . G 4 HOH 61 390 66 HOH HOH A . G 4 HOH 62 391 67 HOH HOH A . G 4 HOH 63 392 68 HOH HOH A . G 4 HOH 64 393 69 HOH HOH A . G 4 HOH 65 394 70 HOH HOH A . G 4 HOH 66 395 71 HOH HOH A . G 4 HOH 67 396 72 HOH HOH A . G 4 HOH 68 397 73 HOH HOH A . G 4 HOH 69 398 74 HOH HOH A . G 4 HOH 70 399 75 HOH HOH A . G 4 HOH 71 400 76 HOH HOH A . G 4 HOH 72 401 77 HOH HOH A . G 4 HOH 73 402 78 HOH HOH A . G 4 HOH 74 403 79 HOH HOH A . G 4 HOH 75 404 80 HOH HOH A . G 4 HOH 76 405 81 HOH HOH A . G 4 HOH 77 406 82 HOH HOH A . G 4 HOH 78 407 83 HOH HOH A . G 4 HOH 79 408 84 HOH HOH A . G 4 HOH 80 409 85 HOH HOH A . G 4 HOH 81 410 86 HOH HOH A . G 4 HOH 82 411 87 HOH HOH A . G 4 HOH 83 412 88 HOH HOH A . G 4 HOH 84 413 89 HOH HOH A . G 4 HOH 85 414 90 HOH HOH A . G 4 HOH 86 415 91 HOH HOH A . G 4 HOH 87 416 92 HOH HOH A . G 4 HOH 88 417 93 HOH HOH A . G 4 HOH 89 418 94 HOH HOH A . G 4 HOH 90 419 95 HOH HOH A . G 4 HOH 91 420 96 HOH HOH A . G 4 HOH 92 421 97 HOH HOH A . G 4 HOH 93 422 98 HOH HOH A . G 4 HOH 94 423 99 HOH HOH A . G 4 HOH 95 424 100 HOH HOH A . G 4 HOH 96 425 101 HOH HOH A . G 4 HOH 97 426 102 HOH HOH A . G 4 HOH 98 427 103 HOH HOH A . G 4 HOH 99 428 104 HOH HOH A . G 4 HOH 100 429 105 HOH HOH A . G 4 HOH 101 430 106 HOH HOH A . G 4 HOH 102 431 107 HOH HOH A . G 4 HOH 103 432 108 HOH HOH A . G 4 HOH 104 433 109 HOH HOH A . G 4 HOH 105 434 110 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal Blu-Ice 'data collection' Max ? 1 BUCCANEER 'model building' . ? 2 REFMAC refinement 5.5.0102 ? 3 HKL-3000 'data reduction' . ? 4 HKL-3000 'data scaling' . ? 5 BUCCANEER phasing . ? 6 # _cell.entry_id 3UN6 _cell.length_a 45.080 _cell.length_b 64.732 _cell.length_c 45.468 _cell.angle_alpha 90.00 _cell.angle_beta 91.50 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 3UN6 _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # _exptl.entry_id 3UN6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.68 _exptl_crystal.density_percent_sol 26.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details ;Protein: 5.8.0mG/mL, 0.5M Sodium chloride, 0.01M Tris-HCl (pH 8.3); Screen: PACT (A5), 0.1M SPG buffer (pH 8.0), 25% (v/v) PEG 1500, VAPOR DIFFUSION, SITTING DROP, temperature 295K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date 2011-11-10 _diffrn_detector.details Mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si {1,1,1}' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97903 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97903 # _reflns.entry_id 3UN6 _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.0 _reflns.d_resolution_high 2.0 _reflns.number_obs 17064 _reflns.number_all 17064 _reflns.percent_possible_obs 97.7 _reflns.pdbx_Rmerge_I_obs 0.098 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.2 _reflns.B_iso_Wilson_estimate 25.5 _reflns.pdbx_redundancy 4.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.03 _reflns_shell.percent_possible_all 93.1 _reflns_shell.Rmerge_I_obs 0.430 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.pdbx_redundancy 3.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 804 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 3UN6 _refine.ls_number_reflns_obs 16184 _refine.ls_number_reflns_all 16184 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 28.99 _refine.ls_d_res_high 2.01 _refine.ls_percent_reflns_obs 96.67 _refine.ls_R_factor_obs 0.16561 _refine.ls_R_factor_all 0.16561 _refine.ls_R_factor_R_work 0.16352 _refine.ls_R_factor_R_free 0.20571 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 865 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.965 _refine.correlation_coeff_Fo_to_Fc_free 0.944 _refine.B_iso_mean 27.013 _refine.aniso_B[1][1] 2.84 _refine.aniso_B[2][2] -2.18 _refine.aniso_B[3][3] -0.65 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.29 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model 'Thermal Factors Individually Refined' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free 0.166 _refine.overall_SU_ML 0.110 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 8.328 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2320 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 17 _refine_hist.number_atoms_solvent 105 _refine_hist.number_atoms_total 2442 _refine_hist.d_res_high 2.01 _refine_hist.d_res_low 28.99 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.013 0.021 ? 2424 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.001 0.020 ? 1645 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.424 1.958 ? 3278 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.848 3.000 ? 4035 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 3.405 5.000 ? 298 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 33.888 24.643 ? 112 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 11.097 15.000 ? 433 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 13.794 15.000 ? 8 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.100 0.200 ? 344 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.005 0.021 ? 2693 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.001 0.020 ? 469 ? 'X-RAY DIFFRACTION' r_mcbond_it 1.033 1.500 ? 1471 ? 'X-RAY DIFFRACTION' r_mcbond_other 0.313 1.500 ? 597 ? 'X-RAY DIFFRACTION' r_mcangle_it 1.840 2.000 ? 2369 ? 'X-RAY DIFFRACTION' r_scbond_it 3.282 3.000 ? 953 ? 'X-RAY DIFFRACTION' r_scangle_it 4.982 4.500 ? 909 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.005 _refine_ls_shell.d_res_low 2.057 _refine_ls_shell.number_reflns_R_work 992 _refine_ls_shell.R_factor_R_work 0.213 _refine_ls_shell.percent_reflns_obs 80.27 _refine_ls_shell.R_factor_R_free 0.237 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 70 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 992 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 3UN6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 3UN6 _struct.title '2.0 Angstrom Crystal Structure of Ligand Binding Component of ABC-type Import System from Staphylococcus aureus with Zinc bound' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 3UN6 _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text ;Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Ligand Binding Component of ABC-type Import System, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2G1I5_STAA8 _struct_ref.pdbx_db_accession Q2G1I5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;CDWQRTSKERSKNAQNQQVIKIGYLPITHSANLMMTKKLLSQYNHPKYKLELVKFNNWPDLMDALNSGRIDGASTLIELA MKSKQKGSNIKAVALGHHEGNVIMGQKGMHLNEFNNNGDDYHFGIPHRYSTHYLLLEELRKQLKIKPGHFSYHEMSPAEM PAALSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCVLVLRGELLDQHKDVAQAFVQDYKKSGFKMNDRKQS VDIMTHHFKQSRDVLTQSAAWTSYGDLTIKPSGYQEITTLVKQHHLFNPPAYDDFVEPSLYKEASRS ; _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 3UN6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 18 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 324 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2G1I5 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 324 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 18 _struct_ref_seq.pdbx_auth_seq_align_end 324 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 3UN6 MSE A 1 ? UNP Q2G1I5 ? ? 'initiating methionine' 1 1 1 3UN6 GLY A 2 ? UNP Q2G1I5 ? ? 'expression tag' 2 2 1 3UN6 SER A 3 ? UNP Q2G1I5 ? ? 'expression tag' 3 3 1 3UN6 SER A 4 ? UNP Q2G1I5 ? ? 'expression tag' 4 4 1 3UN6 HIS A 5 ? UNP Q2G1I5 ? ? 'expression tag' 5 5 1 3UN6 HIS A 6 ? UNP Q2G1I5 ? ? 'expression tag' 6 6 1 3UN6 HIS A 7 ? UNP Q2G1I5 ? ? 'expression tag' 7 7 1 3UN6 HIS A 8 ? UNP Q2G1I5 ? ? 'expression tag' 8 8 1 3UN6 HIS A 9 ? UNP Q2G1I5 ? ? 'expression tag' 9 9 1 3UN6 HIS A 10 ? UNP Q2G1I5 ? ? 'expression tag' 10 10 1 3UN6 GLU A 11 ? UNP Q2G1I5 ? ? 'expression tag' 11 11 1 3UN6 ASN A 12 ? UNP Q2G1I5 ? ? 'expression tag' 12 12 1 3UN6 LEU A 13 ? UNP Q2G1I5 ? ? 'expression tag' 13 13 1 3UN6 TYR A 14 ? UNP Q2G1I5 ? ? 'expression tag' 14 14 1 3UN6 PHE A 15 ? UNP Q2G1I5 ? ? 'expression tag' 15 15 1 3UN6 GLN A 16 ? UNP Q2G1I5 ? ? 'expression tag' 16 16 1 3UN6 GLY A 17 ? UNP Q2G1I5 ? ? 'expression tag' 17 17 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 44 ? HIS A 46 ? ILE A 44 HIS A 46 5 ? 3 HELX_P HELX_P2 2 SER A 47 ? GLN A 59 ? SER A 47 GLN A 59 1 ? 13 HELX_P HELX_P3 3 ASN A 74 ? SER A 84 ? ASN A 74 SER A 84 1 ? 11 HELX_P HELX_P4 4 ILE A 94 ? LYS A 103 ? ILE A 94 LYS A 103 1 ? 10 HELX_P HELX_P5 5 HIS A 127 ? PHE A 131 ? HIS A 127 PHE A 131 5 ? 5 HELX_P HELX_P6 6 SER A 147 ? LEU A 160 ? SER A 147 LEU A 160 1 ? 14 HELX_P HELX_P7 7 SER A 173 ? ALA A 175 ? SER A 173 ALA A 175 5 ? 3 HELX_P HELX_P8 8 GLU A 176 ? GLU A 183 ? GLU A 176 GLU A 183 1 ? 8 HELX_P HELX_P9 9 PRO A 194 ? LEU A 202 ? PRO A 194 LEU A 202 1 ? 9 HELX_P HELX_P10 10 ASP A 212 ? VAL A 214 ? ASP A 212 VAL A 214 5 ? 3 HELX_P HELX_P11 11 ARG A 226 ? HIS A 233 ? ARG A 226 HIS A 233 1 ? 8 HELX_P HELX_P12 12 HIS A 233 ? MSE A 251 ? HIS A 233 MSE A 251 1 ? 19 HELX_P HELX_P13 13 ASP A 253 ? PHE A 265 ? ASP A 253 PHE A 265 1 ? 13 HELX_P HELX_P14 14 SER A 268 ? TRP A 278 ? SER A 268 TRP A 278 1 ? 11 HELX_P HELX_P15 15 LYS A 287 ? HIS A 301 ? LYS A 287 HIS A 301 1 ? 15 HELX_P HELX_P16 16 ALA A 308 ? VAL A 313 ? ALA A 308 VAL A 313 1 ? 6 HELX_P HELX_P17 17 PRO A 315 ? ALA A 321 ? PRO A 315 ALA A 321 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 50 C ? ? ? 1_555 A MSE 51 N ? ? A LEU 50 A MSE 51 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale2 covale both ? A MSE 51 C ? ? ? 1_555 A MSE 52 N ? ? A MSE 51 A MSE 52 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? A MSE 52 C ? ? ? 1_555 A THR 53 N ? ? A MSE 52 A THR 53 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale4 covale both ? A LEU 78 C ? ? ? 1_555 A MSE 79 N ? ? A LEU 78 A MSE 79 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale5 covale both ? A MSE 79 C ? ? ? 1_555 A ASP 80 N ? ? A MSE 79 A ASP 80 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A ALA 97 C ? ? ? 1_555 A MSE 98 N ? ? A ALA 97 A MSE 98 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale7 covale both ? A MSE 98 C ? ? ? 1_555 A LYS 99 N ? ? A MSE 98 A LYS 99 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? A ILE 120 C ? ? ? 1_555 A MSE 121 N ? ? A ILE 120 A MSE 121 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale9 covale both ? A MSE 121 C ? ? ? 1_555 A GLY 122 N ? ? A MSE 121 A GLY 122 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale10 covale both ? A GLY 125 C ? ? ? 1_555 A MSE 126 N ? ? A GLY 125 A MSE 126 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale11 covale both ? A MSE 126 C ? ? ? 1_555 A HIS 127 N A ? A MSE 126 A HIS 127 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale12 covale both ? A MSE 126 C ? ? ? 1_555 A HIS 127 N B ? A MSE 126 A HIS 127 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale13 covale both ? A GLU 171 C ? ? ? 1_555 A MSE 172 N ? ? A GLU 171 A MSE 172 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale14 covale both ? A MSE 172 C ? ? ? 1_555 A SER 173 N ? ? A MSE 172 A SER 173 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale15 covale both ? A GLU 176 C ? ? ? 1_555 A MSE 177 N ? ? A GLU 176 A MSE 177 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale16 covale both ? A MSE 177 C ? ? ? 1_555 A PRO 178 N ? ? A MSE 177 A PRO 178 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale17 covale both ? A LYS 250 C ? ? ? 1_555 A MSE 251 N ? ? A LYS 250 A MSE 251 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale18 covale both ? A MSE 251 C ? ? ? 1_555 A ASN 252 N ? ? A MSE 251 A ASN 252 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale19 covale both ? A ILE 260 C ? ? ? 1_555 A MSE 261 N ? ? A ILE 260 A MSE 261 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale20 covale both ? A MSE 261 C ? ? ? 1_555 A THR 262 N ? ? A MSE 261 A THR 262 1_555 ? ? ? ? ? ? ? 1.333 ? ? metalc1 metalc ? ? A HIS 46 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 46 A ZN 325 1_555 ? ? ? ? ? ? ? 2.108 ? ? metalc2 metalc ? ? A CYS 220 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 220 A ZN 325 1_555 ? ? ? ? ? ? ? 2.392 ? ? metalc3 metalc ? ? A CYS 221 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 221 A ZN 325 1_555 ? ? ? ? ? ? ? 2.282 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 G HOH . O ? ? A ZN 325 A HOH 330 1_555 ? ? ? ? ? ? ? 2.389 ? ? metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 G HOH . O ? ? A ZN 326 A HOH 330 1_555 ? ? ? ? ? ? ? 2.310 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 ZN ? B ZN . ? A ZN 325 ? 1_555 SG ? A CYS 220 ? A CYS 220 ? 1_555 103.9 ? 2 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 ZN ? B ZN . ? A ZN 325 ? 1_555 SG ? A CYS 221 ? A CYS 221 ? 1_555 116.6 ? 3 SG ? A CYS 220 ? A CYS 220 ? 1_555 ZN ? B ZN . ? A ZN 325 ? 1_555 SG ? A CYS 221 ? A CYS 221 ? 1_555 126.2 ? 4 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 ZN ? B ZN . ? A ZN 325 ? 1_555 O ? G HOH . ? A HOH 330 ? 1_555 100.5 ? 5 SG ? A CYS 220 ? A CYS 220 ? 1_555 ZN ? B ZN . ? A ZN 325 ? 1_555 O ? G HOH . ? A HOH 330 ? 1_555 101.5 ? 6 SG ? A CYS 221 ? A CYS 221 ? 1_555 ZN ? B ZN . ? A ZN 325 ? 1_555 O ? G HOH . ? A HOH 330 ? 1_555 104.1 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 51 ? . . . . MSE A 51 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 52 ? . . . . MSE A 52 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 79 ? . . . . MSE A 79 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 98 ? . . . . MSE A 98 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 121 ? . . . . MSE A 121 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 126 ? . . . . MSE A 126 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE A 172 ? . . . . MSE A 172 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 8 MSE A 177 ? . . . . MSE A 177 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 9 MSE A 251 ? . . . . MSE A 251 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 10 MSE A 261 ? . . . . MSE A 261 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 193 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 193 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 194 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 194 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.34 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? parallel C 2 3 ? parallel C 3 4 ? anti-parallel C 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 66 ? LYS A 71 ? LYS A 66 LYS A 71 A 2 VAL A 36 ? TYR A 41 ? VAL A 36 TYR A 41 A 3 GLY A 89 ? LEU A 93 ? GLY A 89 LEU A 93 A 4 CYS A 221 ? LEU A 225 ? CYS A 221 LEU A 225 A 5 LYS A 108 ? LEU A 112 ? LYS A 108 LEU A 112 B 1 HIS A 115 ? GLU A 116 ? HIS A 115 GLU A 116 B 2 THR A 279 ? SER A 280 ? THR A 279 SER A 280 C 1 PHE A 167 ? GLU A 171 ? PHE A 167 GLU A 171 C 2 TYR A 138 ? ILE A 142 ? TYR A 138 ILE A 142 C 3 GLY A 188 ? ALA A 192 ? GLY A 188 ALA A 192 C 4 ASN A 118 ? GLY A 122 ? ASN A 118 GLY A 122 C 5 LYS A 206 ? HIS A 210 ? LYS A 206 HIS A 210 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 66 ? O LYS A 66 N ILE A 37 ? N ILE A 37 A 2 3 N GLY A 40 ? N GLY A 40 O GLY A 89 ? O GLY A 89 A 3 4 N ALA A 90 ? N ALA A 90 O VAL A 224 ? O VAL A 224 A 4 5 O LEU A 223 ? O LEU A 223 N ALA A 111 ? N ALA A 111 B 1 2 N HIS A 115 ? N HIS A 115 O SER A 280 ? O SER A 280 C 1 2 O SER A 168 ? O SER A 168 N TYR A 138 ? N TYR A 138 C 2 3 N GLY A 141 ? N GLY A 141 O GLY A 188 ? O GLY A 188 C 3 4 O TYR A 189 ? O TYR A 189 N MSE A 121 ? N MSE A 121 C 4 5 N GLY A 122 ? N GLY A 122 O LYS A 206 ? O LYS A 206 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 325 ? 4 'BINDING SITE FOR RESIDUE ZN A 325' AC2 Software A ZN 326 ? 1 'BINDING SITE FOR RESIDUE ZN A 326' AC3 Software A PO4 327 ? 2 'BINDING SITE FOR RESIDUE PO4 A 327' AC4 Software A PO4 328 ? 5 'BINDING SITE FOR RESIDUE PO4 A 328' AC5 Software A PO4 329 ? 3 'BINDING SITE FOR RESIDUE PO4 A 329' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 46 ? HIS A 46 . ? 1_555 ? 2 AC1 4 CYS A 220 ? CYS A 220 . ? 1_555 ? 3 AC1 4 CYS A 221 ? CYS A 221 . ? 1_555 ? 4 AC1 4 HOH G . ? HOH A 330 . ? 1_555 ? 5 AC2 1 HOH G . ? HOH A 330 . ? 1_555 ? 6 AC3 2 LYS A 71 ? LYS A 71 . ? 1_555 ? 7 AC3 2 LYS A 266 ? LYS A 266 . ? 1_555 ? 8 AC4 5 LYS A 99 ? LYS A 99 . ? 1_555 ? 9 AC4 5 LYS A 103 ? LYS A 103 . ? 1_555 ? 10 AC4 5 ARG A 145 ? ARG A 145 . ? 1_555 ? 11 AC4 5 TYR A 146 ? TYR A 146 . ? 1_555 ? 12 AC4 5 HOH G . ? HOH A 432 . ? 1_555 ? 13 AC5 3 HIS A 144 ? HIS A 144 . ? 1_555 ? 14 AC5 3 ARG A 145 ? ARG A 145 . ? 1_555 ? 15 AC5 3 HOH G . ? HOH A 367 . ? 1_555 ? # _pdbx_entry_details.entry_id 3UN6 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 114 ? ? 178.02 177.16 2 1 GLU A 116 ? ? 61.58 -142.36 3 1 CYS A 220 ? ? -124.76 -77.46 4 1 TYR A 281 ? ? -130.07 -113.24 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.initial_of_center CSGID # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 51 A MSE 51 ? MET 'modified residue' 2 A MSE 52 A MSE 52 ? MET 'modified residue' 3 A MSE 79 A MSE 79 ? MET 'modified residue' 4 A MSE 98 A MSE 98 ? MET 'modified residue' 5 A MSE 121 A MSE 121 ? MET 'modified residue' 6 A MSE 126 A MSE 126 ? MET 'modified residue' 7 A MSE 172 A MSE 172 ? MET 'modified residue' 8 A MSE 177 A MSE 177 ? MET 'modified residue' 9 A MSE 251 A MSE 251 ? MET 'modified residue' 10 A MSE 261 A MSE 261 ? MET 'modified residue' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -22.9669 11.7647 -5.7610 0.0510 0.0098 0.0265 0.0061 -0.0244 -0.0119 0.9848 1.3776 1.6035 0.0834 -0.1805 -0.3399 -0.0150 -0.0633 0.0547 0.1451 -0.0210 0.0245 -0.0514 -0.0624 0.0359 'X-RAY DIFFRACTION' 2 ? refined -16.8390 12.9390 -15.8322 0.0456 0.0220 0.0273 -0.0077 -0.0272 0.0075 1.7066 0.9431 1.3872 -0.0853 -0.5788 0.0270 -0.0176 0.0650 0.0357 -0.0568 -0.0036 -0.0622 -0.0597 0.0445 0.0212 'X-RAY DIFFRACTION' 3 ? refined -27.0471 9.7933 -13.9531 0.0514 0.0386 0.0221 0.0002 -0.0221 -0.0099 0.8656 2.0875 0.7873 0.2296 -0.0669 0.1132 -0.0052 0.0807 -0.0046 0.0089 -0.0029 0.1415 0.0451 -0.0733 0.0081 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 34 ? ? A 131 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 132 ? ? A 257 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 258 ? ? A 324 ? ? ? ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A HIS 8 ? A HIS 8 9 1 Y 1 A HIS 9 ? A HIS 9 10 1 Y 1 A HIS 10 ? A HIS 10 11 1 Y 1 A GLU 11 ? A GLU 11 12 1 Y 1 A ASN 12 ? A ASN 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A TYR 14 ? A TYR 14 15 1 Y 1 A PHE 15 ? A PHE 15 16 1 Y 1 A GLN 16 ? A GLN 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A CYS 18 ? A CYS 18 19 1 Y 1 A ASP 19 ? A ASP 19 20 1 Y 1 A TRP 20 ? A TRP 20 21 1 Y 1 A GLN 21 ? A GLN 21 22 1 Y 1 A ARG 22 ? A ARG 22 23 1 Y 1 A THR 23 ? A THR 23 24 1 Y 1 A SER 24 ? A SER 24 25 1 Y 1 A LYS 25 ? A LYS 25 26 1 Y 1 A GLU 26 ? A GLU 26 27 1 Y 1 A ARG 27 ? A ARG 27 28 1 Y 1 A SER 28 ? A SER 28 29 1 Y 1 A LYS 29 ? A LYS 29 30 1 Y 1 A ASN 30 ? A ASN 30 31 1 Y 1 A ALA 31 ? A ALA 31 32 1 Y 1 A GLN 32 ? A GLN 32 33 1 Y 1 A ASN 33 ? A ASN 33 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PO4 P P N N 273 PO4 O1 O N N 274 PO4 O2 O N N 275 PO4 O3 O N N 276 PO4 O4 O N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 ZN ZN ZN N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PO4 P O1 doub N N 260 PO4 P O2 sing N N 261 PO4 P O3 sing N N 262 PO4 P O4 sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _atom_sites.entry_id 3UN6 _atom_sites.fract_transf_matrix[1][1] 0.022183 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000582 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015448 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022001 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE ZN # loop_