data_4ALE # _entry.id 4ALE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4ALE pdb_00004ale 10.2210/pdb4ale/pdb PDBE EBI-51532 ? ? WWPDB D_1290051532 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 4A02 unspecified 'X-RAY CRYSTALLOGRAPHIC STRUCTURE OF EFCBM33A' PDB 4ALC unspecified 'X-RAY PHOTOREDUCTION OF POLYSACCHARIDE MONOOXIGENASE CBM33' PDB 4ALQ unspecified 'X-RAY PHOTOREDUCTION OF POLYSACCHARIDE MONOOXYGENASE CBM33' PDB 4ALR unspecified 'X-RAY PHOTOREDUCTION OF POLYSACCHARIDE MONOOXYGENASE CBM33' PDB 4ALS unspecified 'X-RAY PHOTOREDUCTION OF POLYSACCHARIDE MONOOXIGENASE CBM33' PDB 4ALT unspecified 'X-RAY PHOTOREDUCTION OF POLYSACCHARIDE MONOOXIGENASE CBM33' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4ALE _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-03-02 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gudmundsson, M.' 1 'Wu, M.' 2 'Ishida, T.' 3 'Momeni, M.H.' 4 'Vaaje-Kolstad, G.' 5 'Eijsink, V.' 6 'Sandgren, M.' 7 # _citation.id primary _citation.title ;Structural and Electronic Snapshots During the Transition from a Cu(II) to Cu(I) Metal Center of a Lytic Polysaccharide Monooxygenase by X-Ray Photo-Reduction. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 289 _citation.page_first 18782 _citation.page_last ? _citation.year 2014 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24828494 _citation.pdbx_database_id_DOI 10.1074/JBC.M114.563494 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gudmundsson, M.' 1 ? primary 'Kim, S.' 2 ? primary 'Wu, M.' 3 ? primary 'Ishida, T.' 4 ? primary 'Haddad Momeni, M.' 5 ? primary 'Vaaje-Kolstad, G.' 6 ? primary 'Lundberg, D.' 7 ? primary 'Royant, A.' 8 ? primary 'Stahlberg, J.' 9 ? primary 'Eijsink, V.G.' 10 ? primary 'Beckham, G.T.' 11 ? primary 'Sandgren, M.' 12 ? # _cell.entry_id 4ALE _cell.length_a 43.422 _cell.length_b 48.570 _cell.length_c 68.455 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ALE _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CHITIN BINDING PROTEIN' 18339.301 1 ? ? 'RESIDUES 29-194' ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 3 ? ? ? ? 4 water nat water 18.015 277 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'POLYSACCHARIDE MONOOXYGENASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HGYVASPGSRAFFGSSAGGNLNTNVGRAQWEPQSIEAPKNTFITGKLASAGVSGFEPLDEQTATRWHKTNITTGPLDITW NLTAQHRTASWDYYITKNGWNPNQPLDIKNFDKIASIDGKQEVPNKVVKQTINIPTDRKGYHVIYAVWGIGDTVNAFYQA IDVNIQ ; _entity_poly.pdbx_seq_one_letter_code_can ;HGYVASPGSRAFFGSSAGGNLNTNVGRAQWEPQSIEAPKNTFITGKLASAGVSGFEPLDEQTATRWHKTNITTGPLDITW NLTAQHRTASWDYYITKNGWNPNQPLDIKNFDKIASIDGKQEVPNKVVKQTINIPTDRKGYHVIYAVWGIGDTVNAFYQA IDVNIQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 GLY n 1 3 TYR n 1 4 VAL n 1 5 ALA n 1 6 SER n 1 7 PRO n 1 8 GLY n 1 9 SER n 1 10 ARG n 1 11 ALA n 1 12 PHE n 1 13 PHE n 1 14 GLY n 1 15 SER n 1 16 SER n 1 17 ALA n 1 18 GLY n 1 19 GLY n 1 20 ASN n 1 21 LEU n 1 22 ASN n 1 23 THR n 1 24 ASN n 1 25 VAL n 1 26 GLY n 1 27 ARG n 1 28 ALA n 1 29 GLN n 1 30 TRP n 1 31 GLU n 1 32 PRO n 1 33 GLN n 1 34 SER n 1 35 ILE n 1 36 GLU n 1 37 ALA n 1 38 PRO n 1 39 LYS n 1 40 ASN n 1 41 THR n 1 42 PHE n 1 43 ILE n 1 44 THR n 1 45 GLY n 1 46 LYS n 1 47 LEU n 1 48 ALA n 1 49 SER n 1 50 ALA n 1 51 GLY n 1 52 VAL n 1 53 SER n 1 54 GLY n 1 55 PHE n 1 56 GLU n 1 57 PRO n 1 58 LEU n 1 59 ASP n 1 60 GLU n 1 61 GLN n 1 62 THR n 1 63 ALA n 1 64 THR n 1 65 ARG n 1 66 TRP n 1 67 HIS n 1 68 LYS n 1 69 THR n 1 70 ASN n 1 71 ILE n 1 72 THR n 1 73 THR n 1 74 GLY n 1 75 PRO n 1 76 LEU n 1 77 ASP n 1 78 ILE n 1 79 THR n 1 80 TRP n 1 81 ASN n 1 82 LEU n 1 83 THR n 1 84 ALA n 1 85 GLN n 1 86 HIS n 1 87 ARG n 1 88 THR n 1 89 ALA n 1 90 SER n 1 91 TRP n 1 92 ASP n 1 93 TYR n 1 94 TYR n 1 95 ILE n 1 96 THR n 1 97 LYS n 1 98 ASN n 1 99 GLY n 1 100 TRP n 1 101 ASN n 1 102 PRO n 1 103 ASN n 1 104 GLN n 1 105 PRO n 1 106 LEU n 1 107 ASP n 1 108 ILE n 1 109 LYS n 1 110 ASN n 1 111 PHE n 1 112 ASP n 1 113 LYS n 1 114 ILE n 1 115 ALA n 1 116 SER n 1 117 ILE n 1 118 ASP n 1 119 GLY n 1 120 LYS n 1 121 GLN n 1 122 GLU n 1 123 VAL n 1 124 PRO n 1 125 ASN n 1 126 LYS n 1 127 VAL n 1 128 VAL n 1 129 LYS n 1 130 GLN n 1 131 THR n 1 132 ILE n 1 133 ASN n 1 134 ILE n 1 135 PRO n 1 136 THR n 1 137 ASP n 1 138 ARG n 1 139 LYS n 1 140 GLY n 1 141 TYR n 1 142 HIS n 1 143 VAL n 1 144 ILE n 1 145 TYR n 1 146 ALA n 1 147 VAL n 1 148 TRP n 1 149 GLY n 1 150 ILE n 1 151 GLY n 1 152 ASP n 1 153 THR n 1 154 VAL n 1 155 ASN n 1 156 ALA n 1 157 PHE n 1 158 TYR n 1 159 GLN n 1 160 ALA n 1 161 ILE n 1 162 ASP n 1 163 VAL n 1 164 ASN n 1 165 ILE n 1 166 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain V582 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ENTEROCOCCUS FAECALIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1351 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 700802 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PRSET-B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q838S1_ENTFA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q838S1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ALE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 166 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q838S1 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 194 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 29 _struct_ref_seq.pdbx_auth_seq_align_end 194 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4ALE _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.97 _exptl_crystal.density_percent_sol 37.72 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '20%(W/V) PEG-8000 AND 0.1 M HEPES PH 7.5 SITTING DROP VAPOR DIFFUSION' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2011-12-03 _diffrn_detector.details 'SAGITALLY FOCUSING GE(220) AND A MULTILAYER' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DIAMOND (111), GE(220)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9334 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-1' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-1 _diffrn_source.pdbx_wavelength 0.9334 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4ALE _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 48.57 _reflns.d_resolution_high 1.48 _reflns.number_obs 24395 _reflns.number_all ? _reflns.percent_possible_obs 97.8 _reflns.pdbx_Rmerge_I_obs 0.10 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 9.00 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.4 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.48 _reflns_shell.d_res_low 1.56 _reflns_shell.percent_possible_all 90.5 _reflns_shell.Rmerge_I_obs 0.50 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.60 _reflns_shell.pdbx_redundancy 2.9 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4ALE _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 23130 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.61 _refine.ls_d_res_high 1.48 _refine.ls_percent_reflns_obs 97.48 _refine.ls_R_factor_obs 0.16219 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.16104 _refine.ls_R_factor_R_free 0.18416 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 1228 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.961 _refine.correlation_coeff_Fo_to_Fc_free 0.944 _refine.B_iso_mean 10.316 _refine.aniso_B[1][1] 0.42 _refine.aniso_B[2][2] 0.35 _refine.aniso_B[3][3] -0.76 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' _refine.pdbx_starting_model 'PDB ENTRY 2BEM' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.077 _refine.pdbx_overall_ESU_R_Free 0.074 _refine.overall_SU_ML 0.044 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.136 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1300 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 277 _refine_hist.number_atoms_total 1599 _refine_hist.d_res_high 1.48 _refine_hist.d_res_low 39.61 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.008 0.020 ? 1401 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.229 1.921 ? 1911 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.034 5.000 ? 178 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.540 24.925 ? 67 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 11.604 15.000 ? 221 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 11.981 15.000 ? 6 'X-RAY DIFFRACTION' ? r_chiral_restr 0.080 0.200 ? 203 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.021 ? 1088 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.476 _refine_ls_shell.d_res_low 1.514 _refine_ls_shell.number_reflns_R_work 1325 _refine_ls_shell.R_factor_R_work 0.223 _refine_ls_shell.percent_reflns_obs 82.10 _refine_ls_shell.R_factor_R_free 0.236 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 74 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 4ALE _struct.title 'Structure changes of Polysaccharide monooxygenase CBM33A from Enterococcus faecalis by X-ray induced photoreduction.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4ALE _struct_keywords.pdbx_keywords 'CHITIN BINDING PROTEIN' _struct_keywords.text 'CHITIN BINDING PROTEIN, CBM33, CHITIN DEGRADATION, MICROSPECTROPHOTOMETRY' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 9 ? GLY A 14 ? SER A 37 GLY A 42 1 ? 6 HELX_P HELX_P2 2 VAL A 25 ? TRP A 30 ? VAL A 53 TRP A 58 5 ? 6 HELX_P HELX_P3 3 GLU A 31 ? SER A 34 ? GLU A 59 SER A 62 5 ? 4 HELX_P HELX_P4 4 PHE A 55 ? GLU A 60 ? PHE A 83 GLU A 88 5 ? 6 HELX_P HELX_P5 5 ASP A 107 ? LYS A 109 ? ASP A 135 LYS A 137 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 1 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 29 A CU 195 1_555 ? ? ? ? ? ? ? 1.968 ? ? metalc2 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 114 A CU 195 1_555 ? ? ? ? ? ? ? 1.957 ? ? metalc3 metalc ? ? B CU . CU ? ? ? 1_555 F HOH . O ? ? A CU 195 A HOH 2001 1_555 ? ? ? ? ? ? ? 2.216 ? ? metalc4 metalc ? ? B CU . CU ? ? ? 1_555 F HOH . O ? ? A CU 195 A HOH 2002 1_555 ? ? ? ? ? ? ? 2.364 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 6 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 34 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 7 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 35 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -13.24 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 3 ? AB ? 2 ? AC ? 2 ? AD ? 5 ? AE ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel AD 1 2 ? anti-parallel AD 2 3 ? anti-parallel AD 3 4 ? anti-parallel AD 4 5 ? anti-parallel AE 1 2 ? anti-parallel AE 2 3 ? anti-parallel AE 3 4 ? anti-parallel AE 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLY A 2 ? SER A 6 ? GLY A 30 SER A 34 AA 2 GLY A 74 ? LEU A 82 ? GLY A 102 LEU A 110 AA 3 VAL A 127 ? ILE A 134 ? VAL A 155 ILE A 162 AB 1 GLU A 36 ? PRO A 38 ? GLU A 64 PRO A 66 AB 2 ASN A 155 ? ILE A 165 ? ASN A 183 ILE A 193 AC 1 THR A 69 ? ILE A 71 ? THR A 97 ILE A 99 AC 2 ASN A 155 ? ILE A 165 ? ASN A 183 ILE A 193 AD 1 PHE A 111 ? GLU A 122 ? PHE A 139 GLU A 150 AD 2 THR A 88 ? THR A 96 ? THR A 116 THR A 124 AD 3 GLY A 140 ? ILE A 150 ? GLY A 168 ILE A 178 AD 4 ASN A 155 ? ILE A 165 ? ASN A 183 ILE A 193 AD 5 THR A 69 ? ILE A 71 ? THR A 97 ILE A 99 AE 1 PHE A 111 ? GLU A 122 ? PHE A 139 GLU A 150 AE 2 THR A 88 ? THR A 96 ? THR A 116 THR A 124 AE 3 GLY A 140 ? ILE A 150 ? GLY A 168 ILE A 178 AE 4 ASN A 155 ? ILE A 165 ? ASN A 183 ILE A 193 AE 5 GLU A 36 ? PRO A 38 ? GLU A 64 PRO A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ALA A 5 ? N ALA A 33 O THR A 79 ? O THR A 107 AA 2 3 N TRP A 80 ? N TRP A 108 O VAL A 128 ? O VAL A 156 AB 1 2 N ALA A 37 ? N ALA A 65 O ALA A 156 ? O ALA A 184 AC 1 2 N THR A 69 ? N THR A 97 O ASP A 162 ? O ASP A 190 AD 1 2 N GLN A 121 ? N GLN A 149 O THR A 88 ? O THR A 116 AD 2 3 N THR A 96 ? N THR A 124 O VAL A 143 ? O VAL A 171 AD 3 4 N ILE A 150 ? N ILE A 178 O ASN A 155 ? O ASN A 183 AD 4 5 N ASN A 164 ? N ASN A 192 O THR A 69 ? O THR A 97 AE 1 2 N GLN A 121 ? N GLN A 149 O THR A 88 ? O THR A 116 AE 2 3 N THR A 96 ? N THR A 124 O VAL A 143 ? O VAL A 171 AE 3 4 N ILE A 150 ? N ILE A 178 O ASN A 155 ? O ASN A 183 AE 4 5 N ALA A 156 ? N ALA A 184 O ALA A 37 ? O ALA A 65 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CU 195 ? 5 'BINDING SITE FOR RESIDUE CU A 195' AC2 Software A PEG 1194 ? 4 'BINDING SITE FOR RESIDUE PEG A 1194' AC3 Software A PEG 1195 ? 6 'BINDING SITE FOR RESIDUE PEG A 1195' AC4 Software A PEG 1196 ? 13 'BINDING SITE FOR RESIDUE PEG A 1196' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 1 ? HIS A 29 . ? 1_555 ? 2 AC1 5 HIS A 86 ? HIS A 114 . ? 1_555 ? 3 AC1 5 PHE A 157 ? PHE A 185 . ? 1_555 ? 4 AC1 5 HOH F . ? HOH A 2001 . ? 1_555 ? 5 AC1 5 HOH F . ? HOH A 2002 . ? 1_555 ? 6 AC2 4 ARG A 87 ? ARG A 115 . ? 3_544 ? 7 AC2 4 LYS A 126 ? LYS A 154 . ? 1_555 ? 8 AC2 4 ASP A 152 ? ASP A 180 . ? 3_544 ? 9 AC2 4 HOH F . ? HOH A 2279 . ? 1_555 ? 10 AC3 6 PHE A 42 ? PHE A 70 . ? 1_555 ? 11 AC3 6 TYR A 94 ? TYR A 122 . ? 1_555 ? 12 AC3 6 ILE A 108 ? ILE A 136 . ? 1_555 ? 13 AC3 6 PHE A 111 ? PHE A 139 . ? 1_555 ? 14 AC3 6 HOH F . ? HOH A 2234 . ? 4_455 ? 15 AC3 6 HOH F . ? HOH A 2281 . ? 1_555 ? 16 AC4 13 GLU A 36 ? GLU A 64 . ? 1_555 ? 17 AC4 13 ALA A 37 ? ALA A 65 . ? 1_555 ? 18 AC4 13 GLY A 51 ? GLY A 79 . ? 1_555 ? 19 AC4 13 VAL A 52 ? VAL A 80 . ? 1_555 ? 20 AC4 13 SER A 53 ? SER A 81 . ? 1_555 ? 21 AC4 13 THR A 64 ? THR A 92 . ? 3_454 ? 22 AC4 13 ARG A 65 ? ARG A 93 . ? 3_454 ? 23 AC4 13 TRP A 66 ? TRP A 94 . ? 3_454 ? 24 AC4 13 HOH F . ? HOH A 2047 . ? 3_454 ? 25 AC4 13 HOH F . ? HOH A 2048 . ? 3_454 ? 26 AC4 13 HOH F . ? HOH A 2118 . ? 1_555 ? 27 AC4 13 HOH F . ? HOH A 2283 . ? 1_555 ? 28 AC4 13 HOH F . ? HOH A 2284 . ? 1_555 ? # _database_PDB_matrix.entry_id 4ALE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4ALE _atom_sites.fract_transf_matrix[1][1] 0.023030 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020589 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014608 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 29 29 HIS HIS A . n A 1 2 GLY 2 30 30 GLY GLY A . n A 1 3 TYR 3 31 31 TYR TYR A . n A 1 4 VAL 4 32 32 VAL VAL A . n A 1 5 ALA 5 33 33 ALA ALA A . n A 1 6 SER 6 34 34 SER SER A . n A 1 7 PRO 7 35 35 PRO PRO A . n A 1 8 GLY 8 36 36 GLY GLY A . n A 1 9 SER 9 37 37 SER SER A . n A 1 10 ARG 10 38 38 ARG ARG A . n A 1 11 ALA 11 39 39 ALA ALA A . n A 1 12 PHE 12 40 40 PHE PHE A . n A 1 13 PHE 13 41 41 PHE PHE A . n A 1 14 GLY 14 42 42 GLY GLY A . n A 1 15 SER 15 43 43 SER SER A . n A 1 16 SER 16 44 44 SER SER A . n A 1 17 ALA 17 45 45 ALA ALA A . n A 1 18 GLY 18 46 46 GLY GLY A . n A 1 19 GLY 19 47 47 GLY GLY A . n A 1 20 ASN 20 48 48 ASN ASN A . n A 1 21 LEU 21 49 49 LEU LEU A . n A 1 22 ASN 22 50 50 ASN ASN A . n A 1 23 THR 23 51 51 THR THR A . n A 1 24 ASN 24 52 52 ASN ASN A . n A 1 25 VAL 25 53 53 VAL VAL A . n A 1 26 GLY 26 54 54 GLY GLY A . n A 1 27 ARG 27 55 55 ARG ARG A . n A 1 28 ALA 28 56 56 ALA ALA A . n A 1 29 GLN 29 57 57 GLN GLN A . n A 1 30 TRP 30 58 58 TRP TRP A . n A 1 31 GLU 31 59 59 GLU GLU A . n A 1 32 PRO 32 60 60 PRO PRO A . n A 1 33 GLN 33 61 61 GLN GLN A . n A 1 34 SER 34 62 62 SER SER A . n A 1 35 ILE 35 63 63 ILE ILE A . n A 1 36 GLU 36 64 64 GLU GLU A . n A 1 37 ALA 37 65 65 ALA ALA A . n A 1 38 PRO 38 66 66 PRO PRO A . n A 1 39 LYS 39 67 67 LYS LYS A . n A 1 40 ASN 40 68 68 ASN ASN A . n A 1 41 THR 41 69 69 THR THR A . n A 1 42 PHE 42 70 70 PHE PHE A . n A 1 43 ILE 43 71 71 ILE ILE A . n A 1 44 THR 44 72 72 THR THR A . n A 1 45 GLY 45 73 73 GLY GLY A . n A 1 46 LYS 46 74 74 LYS LYS A . n A 1 47 LEU 47 75 75 LEU LEU A . n A 1 48 ALA 48 76 76 ALA ALA A . n A 1 49 SER 49 77 77 SER SER A . n A 1 50 ALA 50 78 78 ALA ALA A . n A 1 51 GLY 51 79 79 GLY GLY A . n A 1 52 VAL 52 80 80 VAL VAL A . n A 1 53 SER 53 81 81 SER SER A . n A 1 54 GLY 54 82 82 GLY GLY A . n A 1 55 PHE 55 83 83 PHE PHE A . n A 1 56 GLU 56 84 84 GLU GLU A . n A 1 57 PRO 57 85 85 PRO PRO A . n A 1 58 LEU 58 86 86 LEU LEU A . n A 1 59 ASP 59 87 87 ASP ASP A . n A 1 60 GLU 60 88 88 GLU GLU A . n A 1 61 GLN 61 89 89 GLN GLN A . n A 1 62 THR 62 90 90 THR THR A . n A 1 63 ALA 63 91 91 ALA ALA A . n A 1 64 THR 64 92 92 THR THR A . n A 1 65 ARG 65 93 93 ARG ARG A . n A 1 66 TRP 66 94 94 TRP TRP A . n A 1 67 HIS 67 95 95 HIS HIS A . n A 1 68 LYS 68 96 96 LYS LYS A . n A 1 69 THR 69 97 97 THR THR A . n A 1 70 ASN 70 98 98 ASN ASN A . n A 1 71 ILE 71 99 99 ILE ILE A . n A 1 72 THR 72 100 100 THR THR A . n A 1 73 THR 73 101 101 THR THR A . n A 1 74 GLY 74 102 102 GLY GLY A . n A 1 75 PRO 75 103 103 PRO PRO A . n A 1 76 LEU 76 104 104 LEU LEU A . n A 1 77 ASP 77 105 105 ASP ASP A . n A 1 78 ILE 78 106 106 ILE ILE A . n A 1 79 THR 79 107 107 THR THR A . n A 1 80 TRP 80 108 108 TRP TRP A . n A 1 81 ASN 81 109 109 ASN ASN A . n A 1 82 LEU 82 110 110 LEU LEU A . n A 1 83 THR 83 111 111 THR THR A . n A 1 84 ALA 84 112 112 ALA ALA A . n A 1 85 GLN 85 113 113 GLN GLN A . n A 1 86 HIS 86 114 114 HIS HIS A . n A 1 87 ARG 87 115 115 ARG ARG A . n A 1 88 THR 88 116 116 THR THR A . n A 1 89 ALA 89 117 117 ALA ALA A . n A 1 90 SER 90 118 118 SER SER A . n A 1 91 TRP 91 119 119 TRP TRP A . n A 1 92 ASP 92 120 120 ASP ASP A . n A 1 93 TYR 93 121 121 TYR TYR A . n A 1 94 TYR 94 122 122 TYR TYR A . n A 1 95 ILE 95 123 123 ILE ILE A . n A 1 96 THR 96 124 124 THR THR A . n A 1 97 LYS 97 125 125 LYS LYS A . n A 1 98 ASN 98 126 126 ASN ASN A . n A 1 99 GLY 99 127 127 GLY GLY A . n A 1 100 TRP 100 128 128 TRP TRP A . n A 1 101 ASN 101 129 129 ASN ASN A . n A 1 102 PRO 102 130 130 PRO PRO A . n A 1 103 ASN 103 131 131 ASN ASN A . n A 1 104 GLN 104 132 132 GLN GLN A . n A 1 105 PRO 105 133 133 PRO PRO A . n A 1 106 LEU 106 134 134 LEU LEU A . n A 1 107 ASP 107 135 135 ASP ASP A . n A 1 108 ILE 108 136 136 ILE ILE A . n A 1 109 LYS 109 137 137 LYS LYS A . n A 1 110 ASN 110 138 138 ASN ASN A . n A 1 111 PHE 111 139 139 PHE PHE A . n A 1 112 ASP 112 140 140 ASP ASP A . n A 1 113 LYS 113 141 141 LYS LYS A . n A 1 114 ILE 114 142 142 ILE ILE A . n A 1 115 ALA 115 143 143 ALA ALA A . n A 1 116 SER 116 144 144 SER SER A . n A 1 117 ILE 117 145 145 ILE ILE A . n A 1 118 ASP 118 146 146 ASP ASP A . n A 1 119 GLY 119 147 147 GLY GLY A . n A 1 120 LYS 120 148 148 LYS LYS A . n A 1 121 GLN 121 149 149 GLN GLN A . n A 1 122 GLU 122 150 150 GLU GLU A . n A 1 123 VAL 123 151 151 VAL VAL A . n A 1 124 PRO 124 152 152 PRO PRO A . n A 1 125 ASN 125 153 153 ASN ASN A . n A 1 126 LYS 126 154 154 LYS LYS A . n A 1 127 VAL 127 155 155 VAL VAL A . n A 1 128 VAL 128 156 156 VAL VAL A . n A 1 129 LYS 129 157 157 LYS LYS A . n A 1 130 GLN 130 158 158 GLN GLN A . n A 1 131 THR 131 159 159 THR THR A . n A 1 132 ILE 132 160 160 ILE ILE A . n A 1 133 ASN 133 161 161 ASN ASN A . n A 1 134 ILE 134 162 162 ILE ILE A . n A 1 135 PRO 135 163 163 PRO PRO A . n A 1 136 THR 136 164 164 THR THR A . n A 1 137 ASP 137 165 165 ASP ASP A . n A 1 138 ARG 138 166 166 ARG ARG A . n A 1 139 LYS 139 167 167 LYS LYS A . n A 1 140 GLY 140 168 168 GLY GLY A . n A 1 141 TYR 141 169 169 TYR TYR A . n A 1 142 HIS 142 170 170 HIS HIS A . n A 1 143 VAL 143 171 171 VAL VAL A . n A 1 144 ILE 144 172 172 ILE ILE A . n A 1 145 TYR 145 173 173 TYR TYR A . n A 1 146 ALA 146 174 174 ALA ALA A . n A 1 147 VAL 147 175 175 VAL VAL A . n A 1 148 TRP 148 176 176 TRP TRP A . n A 1 149 GLY 149 177 177 GLY GLY A . n A 1 150 ILE 150 178 178 ILE ILE A . n A 1 151 GLY 151 179 179 GLY GLY A . n A 1 152 ASP 152 180 180 ASP ASP A . n A 1 153 THR 153 181 181 THR THR A . n A 1 154 VAL 154 182 182 VAL VAL A . n A 1 155 ASN 155 183 183 ASN ASN A . n A 1 156 ALA 156 184 184 ALA ALA A . n A 1 157 PHE 157 185 185 PHE PHE A . n A 1 158 TYR 158 186 186 TYR TYR A . n A 1 159 GLN 159 187 187 GLN GLN A . n A 1 160 ALA 160 188 188 ALA ALA A . n A 1 161 ILE 161 189 189 ILE ILE A . n A 1 162 ASP 162 190 190 ASP ASP A . n A 1 163 VAL 163 191 191 VAL VAL A . n A 1 164 ASN 164 192 192 ASN ASN A . n A 1 165 ILE 165 193 193 ILE ILE A . n A 1 166 GLN 166 194 194 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 195 195 CU CU A . C 3 PEG 1 1194 1194 PEG PEG A . D 3 PEG 1 1195 1195 PEG PEG A . E 3 PEG 1 1196 1196 PEG PEG A . F 4 HOH 1 2001 2001 HOH HOH A . F 4 HOH 2 2002 2002 HOH HOH A . F 4 HOH 3 2003 2003 HOH HOH A . F 4 HOH 4 2004 2004 HOH HOH A . F 4 HOH 5 2005 2005 HOH HOH A . F 4 HOH 6 2006 2006 HOH HOH A . F 4 HOH 7 2007 2007 HOH HOH A . F 4 HOH 8 2008 2008 HOH HOH A . F 4 HOH 9 2009 2009 HOH HOH A . F 4 HOH 10 2010 2010 HOH HOH A . F 4 HOH 11 2011 2011 HOH HOH A . F 4 HOH 12 2012 2012 HOH HOH A . F 4 HOH 13 2013 2013 HOH HOH A . F 4 HOH 14 2014 2014 HOH HOH A . F 4 HOH 15 2015 2015 HOH HOH A . F 4 HOH 16 2016 2016 HOH HOH A . F 4 HOH 17 2017 2017 HOH HOH A . F 4 HOH 18 2018 2018 HOH HOH A . F 4 HOH 19 2019 2019 HOH HOH A . F 4 HOH 20 2020 2020 HOH HOH A . F 4 HOH 21 2021 2021 HOH HOH A . F 4 HOH 22 2022 2022 HOH HOH A . F 4 HOH 23 2023 2023 HOH HOH A . F 4 HOH 24 2024 2024 HOH HOH A . F 4 HOH 25 2025 2025 HOH HOH A . F 4 HOH 26 2026 2026 HOH HOH A . F 4 HOH 27 2027 2027 HOH HOH A . F 4 HOH 28 2028 2028 HOH HOH A . F 4 HOH 29 2029 2029 HOH HOH A . F 4 HOH 30 2030 2030 HOH HOH A . F 4 HOH 31 2031 2031 HOH HOH A . F 4 HOH 32 2032 2032 HOH HOH A . F 4 HOH 33 2033 2033 HOH HOH A . F 4 HOH 34 2034 2034 HOH HOH A . F 4 HOH 35 2035 2035 HOH HOH A . F 4 HOH 36 2036 2036 HOH HOH A . F 4 HOH 37 2037 2037 HOH HOH A . F 4 HOH 38 2038 2038 HOH HOH A . F 4 HOH 39 2039 2039 HOH HOH A . F 4 HOH 40 2040 2040 HOH HOH A . F 4 HOH 41 2041 2041 HOH HOH A . F 4 HOH 42 2042 2042 HOH HOH A . F 4 HOH 43 2043 2043 HOH HOH A . F 4 HOH 44 2044 2044 HOH HOH A . F 4 HOH 45 2045 2045 HOH HOH A . F 4 HOH 46 2046 2046 HOH HOH A . F 4 HOH 47 2047 2047 HOH HOH A . F 4 HOH 48 2048 2048 HOH HOH A . F 4 HOH 49 2049 2049 HOH HOH A . F 4 HOH 50 2050 2050 HOH HOH A . F 4 HOH 51 2051 2051 HOH HOH A . F 4 HOH 52 2052 2052 HOH HOH A . F 4 HOH 53 2053 2053 HOH HOH A . F 4 HOH 54 2054 2054 HOH HOH A . F 4 HOH 55 2055 2055 HOH HOH A . F 4 HOH 56 2056 2056 HOH HOH A . F 4 HOH 57 2057 2057 HOH HOH A . F 4 HOH 58 2058 2058 HOH HOH A . F 4 HOH 59 2059 2059 HOH HOH A . F 4 HOH 60 2060 2060 HOH HOH A . F 4 HOH 61 2061 2061 HOH HOH A . F 4 HOH 62 2062 2062 HOH HOH A . F 4 HOH 63 2063 2063 HOH HOH A . F 4 HOH 64 2064 2064 HOH HOH A . F 4 HOH 65 2065 2065 HOH HOH A . F 4 HOH 66 2066 2066 HOH HOH A . F 4 HOH 67 2067 2067 HOH HOH A . F 4 HOH 68 2068 2068 HOH HOH A . F 4 HOH 69 2069 2069 HOH HOH A . F 4 HOH 70 2070 2070 HOH HOH A . F 4 HOH 71 2071 2071 HOH HOH A . F 4 HOH 72 2072 2072 HOH HOH A . F 4 HOH 73 2073 2073 HOH HOH A . F 4 HOH 74 2074 2074 HOH HOH A . F 4 HOH 75 2075 2075 HOH HOH A . F 4 HOH 76 2076 2076 HOH HOH A . F 4 HOH 77 2077 2077 HOH HOH A . F 4 HOH 78 2078 2078 HOH HOH A . F 4 HOH 79 2079 2079 HOH HOH A . F 4 HOH 80 2080 2080 HOH HOH A . F 4 HOH 81 2081 2081 HOH HOH A . F 4 HOH 82 2082 2082 HOH HOH A . F 4 HOH 83 2083 2083 HOH HOH A . F 4 HOH 84 2084 2084 HOH HOH A . F 4 HOH 85 2085 2085 HOH HOH A . F 4 HOH 86 2086 2086 HOH HOH A . F 4 HOH 87 2087 2087 HOH HOH A . F 4 HOH 88 2088 2088 HOH HOH A . F 4 HOH 89 2089 2089 HOH HOH A . F 4 HOH 90 2090 2090 HOH HOH A . F 4 HOH 91 2091 2091 HOH HOH A . F 4 HOH 92 2092 2092 HOH HOH A . F 4 HOH 93 2093 2093 HOH HOH A . F 4 HOH 94 2094 2094 HOH HOH A . F 4 HOH 95 2095 2095 HOH HOH A . F 4 HOH 96 2096 2096 HOH HOH A . F 4 HOH 97 2097 2097 HOH HOH A . F 4 HOH 98 2098 2098 HOH HOH A . F 4 HOH 99 2099 2099 HOH HOH A . F 4 HOH 100 2100 2100 HOH HOH A . F 4 HOH 101 2101 2101 HOH HOH A . F 4 HOH 102 2102 2102 HOH HOH A . F 4 HOH 103 2103 2103 HOH HOH A . F 4 HOH 104 2104 2104 HOH HOH A . F 4 HOH 105 2105 2105 HOH HOH A . F 4 HOH 106 2106 2106 HOH HOH A . F 4 HOH 107 2107 2107 HOH HOH A . F 4 HOH 108 2108 2108 HOH HOH A . F 4 HOH 109 2109 2109 HOH HOH A . F 4 HOH 110 2110 2110 HOH HOH A . F 4 HOH 111 2111 2111 HOH HOH A . F 4 HOH 112 2112 2112 HOH HOH A . F 4 HOH 113 2113 2113 HOH HOH A . F 4 HOH 114 2114 2114 HOH HOH A . F 4 HOH 115 2115 2115 HOH HOH A . F 4 HOH 116 2116 2116 HOH HOH A . F 4 HOH 117 2117 2117 HOH HOH A . F 4 HOH 118 2118 2118 HOH HOH A . F 4 HOH 119 2119 2119 HOH HOH A . F 4 HOH 120 2120 2120 HOH HOH A . F 4 HOH 121 2121 2121 HOH HOH A . F 4 HOH 122 2122 2122 HOH HOH A . F 4 HOH 123 2123 2123 HOH HOH A . F 4 HOH 124 2124 2124 HOH HOH A . F 4 HOH 125 2125 2125 HOH HOH A . F 4 HOH 126 2126 2126 HOH HOH A . F 4 HOH 127 2127 2127 HOH HOH A . F 4 HOH 128 2128 2128 HOH HOH A . F 4 HOH 129 2129 2129 HOH HOH A . F 4 HOH 130 2130 2130 HOH HOH A . F 4 HOH 131 2131 2131 HOH HOH A . F 4 HOH 132 2132 2132 HOH HOH A . F 4 HOH 133 2133 2133 HOH HOH A . F 4 HOH 134 2134 2134 HOH HOH A . F 4 HOH 135 2135 2135 HOH HOH A . F 4 HOH 136 2136 2136 HOH HOH A . F 4 HOH 137 2137 2137 HOH HOH A . F 4 HOH 138 2138 2138 HOH HOH A . F 4 HOH 139 2139 2139 HOH HOH A . F 4 HOH 140 2140 2140 HOH HOH A . F 4 HOH 141 2141 2141 HOH HOH A . F 4 HOH 142 2142 2142 HOH HOH A . F 4 HOH 143 2143 2143 HOH HOH A . F 4 HOH 144 2144 2144 HOH HOH A . F 4 HOH 145 2146 2146 HOH HOH A . F 4 HOH 146 2147 2147 HOH HOH A . F 4 HOH 147 2148 2148 HOH HOH A . F 4 HOH 148 2149 2149 HOH HOH A . F 4 HOH 149 2150 2150 HOH HOH A . F 4 HOH 150 2151 2151 HOH HOH A . F 4 HOH 151 2152 2152 HOH HOH A . F 4 HOH 152 2153 2153 HOH HOH A . F 4 HOH 153 2154 2154 HOH HOH A . F 4 HOH 154 2155 2155 HOH HOH A . F 4 HOH 155 2156 2156 HOH HOH A . F 4 HOH 156 2157 2157 HOH HOH A . F 4 HOH 157 2159 2159 HOH HOH A . F 4 HOH 158 2160 2160 HOH HOH A . F 4 HOH 159 2161 2161 HOH HOH A . F 4 HOH 160 2162 2162 HOH HOH A . F 4 HOH 161 2163 2163 HOH HOH A . F 4 HOH 162 2164 2164 HOH HOH A . F 4 HOH 163 2165 2165 HOH HOH A . F 4 HOH 164 2166 2166 HOH HOH A . F 4 HOH 165 2167 2167 HOH HOH A . F 4 HOH 166 2168 2168 HOH HOH A . F 4 HOH 167 2169 2169 HOH HOH A . F 4 HOH 168 2170 2170 HOH HOH A . F 4 HOH 169 2171 2171 HOH HOH A . F 4 HOH 170 2172 2172 HOH HOH A . F 4 HOH 171 2173 2173 HOH HOH A . F 4 HOH 172 2174 2174 HOH HOH A . F 4 HOH 173 2175 2175 HOH HOH A . F 4 HOH 174 2176 2176 HOH HOH A . F 4 HOH 175 2177 2177 HOH HOH A . F 4 HOH 176 2178 2178 HOH HOH A . F 4 HOH 177 2179 2179 HOH HOH A . F 4 HOH 178 2180 2180 HOH HOH A . F 4 HOH 179 2181 2181 HOH HOH A . F 4 HOH 180 2182 2182 HOH HOH A . F 4 HOH 181 2183 2183 HOH HOH A . F 4 HOH 182 2184 2184 HOH HOH A . F 4 HOH 183 2185 2185 HOH HOH A . F 4 HOH 184 2186 2186 HOH HOH A . F 4 HOH 185 2187 2187 HOH HOH A . F 4 HOH 186 2188 2188 HOH HOH A . F 4 HOH 187 2189 2189 HOH HOH A . F 4 HOH 188 2190 2190 HOH HOH A . F 4 HOH 189 2191 2191 HOH HOH A . F 4 HOH 190 2192 2192 HOH HOH A . F 4 HOH 191 2193 2193 HOH HOH A . F 4 HOH 192 2194 2194 HOH HOH A . F 4 HOH 193 2195 2195 HOH HOH A . F 4 HOH 194 2196 2196 HOH HOH A . F 4 HOH 195 2197 2197 HOH HOH A . F 4 HOH 196 2198 2198 HOH HOH A . F 4 HOH 197 2200 2200 HOH HOH A . F 4 HOH 198 2201 2201 HOH HOH A . F 4 HOH 199 2202 2202 HOH HOH A . F 4 HOH 200 2203 2203 HOH HOH A . F 4 HOH 201 2204 2204 HOH HOH A . F 4 HOH 202 2205 2205 HOH HOH A . F 4 HOH 203 2206 2206 HOH HOH A . F 4 HOH 204 2207 2207 HOH HOH A . F 4 HOH 205 2208 2208 HOH HOH A . F 4 HOH 206 2210 2210 HOH HOH A . F 4 HOH 207 2211 2211 HOH HOH A . F 4 HOH 208 2212 2212 HOH HOH A . F 4 HOH 209 2213 2213 HOH HOH A . F 4 HOH 210 2214 2214 HOH HOH A . F 4 HOH 211 2215 2215 HOH HOH A . F 4 HOH 212 2216 2216 HOH HOH A . F 4 HOH 213 2217 2217 HOH HOH A . F 4 HOH 214 2218 2218 HOH HOH A . F 4 HOH 215 2219 2219 HOH HOH A . F 4 HOH 216 2220 2220 HOH HOH A . F 4 HOH 217 2221 2221 HOH HOH A . F 4 HOH 218 2222 2222 HOH HOH A . F 4 HOH 219 2223 2223 HOH HOH A . F 4 HOH 220 2224 2224 HOH HOH A . F 4 HOH 221 2225 2225 HOH HOH A . F 4 HOH 222 2226 2226 HOH HOH A . F 4 HOH 223 2227 2227 HOH HOH A . F 4 HOH 224 2228 2228 HOH HOH A . F 4 HOH 225 2229 2229 HOH HOH A . F 4 HOH 226 2230 2230 HOH HOH A . F 4 HOH 227 2231 2231 HOH HOH A . F 4 HOH 228 2232 2232 HOH HOH A . F 4 HOH 229 2233 2233 HOH HOH A . F 4 HOH 230 2234 2234 HOH HOH A . F 4 HOH 231 2235 2235 HOH HOH A . F 4 HOH 232 2236 2236 HOH HOH A . F 4 HOH 233 2237 2237 HOH HOH A . F 4 HOH 234 2238 2238 HOH HOH A . F 4 HOH 235 2239 2239 HOH HOH A . F 4 HOH 236 2240 2240 HOH HOH A . F 4 HOH 237 2241 2241 HOH HOH A . F 4 HOH 238 2242 2242 HOH HOH A . F 4 HOH 239 2243 2243 HOH HOH A . F 4 HOH 240 2244 2244 HOH HOH A . F 4 HOH 241 2245 2245 HOH HOH A . F 4 HOH 242 2246 2246 HOH HOH A . F 4 HOH 243 2247 2247 HOH HOH A . F 4 HOH 244 2248 2248 HOH HOH A . F 4 HOH 245 2249 2249 HOH HOH A . F 4 HOH 246 2250 2250 HOH HOH A . F 4 HOH 247 2252 2252 HOH HOH A . F 4 HOH 248 2253 2253 HOH HOH A . F 4 HOH 249 2254 2254 HOH HOH A . F 4 HOH 250 2255 2255 HOH HOH A . F 4 HOH 251 2256 2256 HOH HOH A . F 4 HOH 252 2257 2257 HOH HOH A . F 4 HOH 253 2258 2258 HOH HOH A . F 4 HOH 254 2259 2259 HOH HOH A . F 4 HOH 255 2260 2260 HOH HOH A . F 4 HOH 256 2261 2261 HOH HOH A . F 4 HOH 257 2262 2262 HOH HOH A . F 4 HOH 258 2263 2263 HOH HOH A . F 4 HOH 259 2264 2264 HOH HOH A . F 4 HOH 260 2266 2266 HOH HOH A . F 4 HOH 261 2267 2267 HOH HOH A . F 4 HOH 262 2268 2268 HOH HOH A . F 4 HOH 263 2270 2270 HOH HOH A . F 4 HOH 264 2271 2271 HOH HOH A . F 4 HOH 265 2272 2272 HOH HOH A . F 4 HOH 266 2273 2273 HOH HOH A . F 4 HOH 267 2274 2274 HOH HOH A . F 4 HOH 268 2275 2275 HOH HOH A . F 4 HOH 269 2276 2276 HOH HOH A . F 4 HOH 270 2277 2277 HOH HOH A . F 4 HOH 271 2278 2278 HOH HOH A . F 4 HOH 272 2279 2279 HOH HOH A . F 4 HOH 273 2280 2280 HOH HOH A . F 4 HOH 274 2281 2281 HOH HOH A . F 4 HOH 275 2282 2282 HOH HOH A . F 4 HOH 276 2283 2283 HOH HOH A . F 4 HOH 277 2284 2284 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 1 ? A HIS 29 ? 1_555 CU ? B CU . ? A CU 195 ? 1_555 NE2 ? A HIS 86 ? A HIS 114 ? 1_555 172.5 ? 2 ND1 ? A HIS 1 ? A HIS 29 ? 1_555 CU ? B CU . ? A CU 195 ? 1_555 O ? F HOH . ? A HOH 2001 ? 1_555 92.9 ? 3 NE2 ? A HIS 86 ? A HIS 114 ? 1_555 CU ? B CU . ? A CU 195 ? 1_555 O ? F HOH . ? A HOH 2001 ? 1_555 82.4 ? 4 ND1 ? A HIS 1 ? A HIS 29 ? 1_555 CU ? B CU . ? A CU 195 ? 1_555 O ? F HOH . ? A HOH 2002 ? 1_555 79.8 ? 5 NE2 ? A HIS 86 ? A HIS 114 ? 1_555 CU ? B CU . ? A CU 195 ? 1_555 O ? F HOH . ? A HOH 2002 ? 1_555 94.4 ? 6 O ? F HOH . ? A HOH 2001 ? 1_555 CU ? B CU . ? A CU 195 ? 1_555 O ? F HOH . ? A HOH 2002 ? 1_555 91.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-02-27 2 'Structure model' 1 1 2014-05-28 3 'Structure model' 1 2 2014-08-13 4 'Structure model' 1 3 2019-05-08 5 'Structure model' 1 4 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Experimental preparation' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' Other 10 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 4 'Structure model' pdbx_database_proc 3 4 'Structure model' pdbx_database_status 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_database_status 8 5 'Structure model' pdbx_initial_refinement_model 9 5 'Structure model' pdbx_struct_conn_angle 10 5 'Structure model' struct_conn 11 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.method' 2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_pdbx_database_status.status_code_sf' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 5 'Structure model' '_pdbx_struct_conn_angle.value' 19 5 'Structure model' '_struct_conn.pdbx_dist_value' 20 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 21 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 25 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 26 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 27 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 28 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 32 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 33 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 34 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.6.0117 ? 1 XDS 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 PHASER phasing . ? 4 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2044 ? 6.79 . 2 1 O ? A HOH 2122 ? 6.34 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 PEG C1 C N N 217 PEG O1 O N N 218 PEG C2 C N N 219 PEG O2 O N N 220 PEG C3 C N N 221 PEG C4 C N N 222 PEG O4 O N N 223 PEG H11 H N N 224 PEG H12 H N N 225 PEG HO1 H N N 226 PEG H21 H N N 227 PEG H22 H N N 228 PEG H31 H N N 229 PEG H32 H N N 230 PEG H41 H N N 231 PEG H42 H N N 232 PEG HO4 H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TRP N N N N 305 TRP CA C N S 306 TRP C C N N 307 TRP O O N N 308 TRP CB C N N 309 TRP CG C Y N 310 TRP CD1 C Y N 311 TRP CD2 C Y N 312 TRP NE1 N Y N 313 TRP CE2 C Y N 314 TRP CE3 C Y N 315 TRP CZ2 C Y N 316 TRP CZ3 C Y N 317 TRP CH2 C Y N 318 TRP OXT O N N 319 TRP H H N N 320 TRP H2 H N N 321 TRP HA H N N 322 TRP HB2 H N N 323 TRP HB3 H N N 324 TRP HD1 H N N 325 TRP HE1 H N N 326 TRP HE3 H N N 327 TRP HZ2 H N N 328 TRP HZ3 H N N 329 TRP HH2 H N N 330 TRP HXT H N N 331 TYR N N N N 332 TYR CA C N S 333 TYR C C N N 334 TYR O O N N 335 TYR CB C N N 336 TYR CG C Y N 337 TYR CD1 C Y N 338 TYR CD2 C Y N 339 TYR CE1 C Y N 340 TYR CE2 C Y N 341 TYR CZ C Y N 342 TYR OH O N N 343 TYR OXT O N N 344 TYR H H N N 345 TYR H2 H N N 346 TYR HA H N N 347 TYR HB2 H N N 348 TYR HB3 H N N 349 TYR HD1 H N N 350 TYR HD2 H N N 351 TYR HE1 H N N 352 TYR HE2 H N N 353 TYR HH H N N 354 TYR HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PEG C1 O1 sing N N 205 PEG C1 C2 sing N N 206 PEG C1 H11 sing N N 207 PEG C1 H12 sing N N 208 PEG O1 HO1 sing N N 209 PEG C2 O2 sing N N 210 PEG C2 H21 sing N N 211 PEG C2 H22 sing N N 212 PEG O2 C3 sing N N 213 PEG C3 C4 sing N N 214 PEG C3 H31 sing N N 215 PEG C3 H32 sing N N 216 PEG C4 O4 sing N N 217 PEG C4 H41 sing N N 218 PEG C4 H42 sing N N 219 PEG O4 HO4 sing N N 220 PHE N CA sing N N 221 PHE N H sing N N 222 PHE N H2 sing N N 223 PHE CA C sing N N 224 PHE CA CB sing N N 225 PHE CA HA sing N N 226 PHE C O doub N N 227 PHE C OXT sing N N 228 PHE CB CG sing N N 229 PHE CB HB2 sing N N 230 PHE CB HB3 sing N N 231 PHE CG CD1 doub Y N 232 PHE CG CD2 sing Y N 233 PHE CD1 CE1 sing Y N 234 PHE CD1 HD1 sing N N 235 PHE CD2 CE2 doub Y N 236 PHE CD2 HD2 sing N N 237 PHE CE1 CZ doub Y N 238 PHE CE1 HE1 sing N N 239 PHE CE2 CZ sing Y N 240 PHE CE2 HE2 sing N N 241 PHE CZ HZ sing N N 242 PHE OXT HXT sing N N 243 PRO N CA sing N N 244 PRO N CD sing N N 245 PRO N H sing N N 246 PRO CA C sing N N 247 PRO CA CB sing N N 248 PRO CA HA sing N N 249 PRO C O doub N N 250 PRO C OXT sing N N 251 PRO CB CG sing N N 252 PRO CB HB2 sing N N 253 PRO CB HB3 sing N N 254 PRO CG CD sing N N 255 PRO CG HG2 sing N N 256 PRO CG HG3 sing N N 257 PRO CD HD2 sing N N 258 PRO CD HD3 sing N N 259 PRO OXT HXT sing N N 260 SER N CA sing N N 261 SER N H sing N N 262 SER N H2 sing N N 263 SER CA C sing N N 264 SER CA CB sing N N 265 SER CA HA sing N N 266 SER C O doub N N 267 SER C OXT sing N N 268 SER CB OG sing N N 269 SER CB HB2 sing N N 270 SER CB HB3 sing N N 271 SER OG HG sing N N 272 SER OXT HXT sing N N 273 THR N CA sing N N 274 THR N H sing N N 275 THR N H2 sing N N 276 THR CA C sing N N 277 THR CA CB sing N N 278 THR CA HA sing N N 279 THR C O doub N N 280 THR C OXT sing N N 281 THR CB OG1 sing N N 282 THR CB CG2 sing N N 283 THR CB HB sing N N 284 THR OG1 HG1 sing N N 285 THR CG2 HG21 sing N N 286 THR CG2 HG22 sing N N 287 THR CG2 HG23 sing N N 288 THR OXT HXT sing N N 289 TRP N CA sing N N 290 TRP N H sing N N 291 TRP N H2 sing N N 292 TRP CA C sing N N 293 TRP CA CB sing N N 294 TRP CA HA sing N N 295 TRP C O doub N N 296 TRP C OXT sing N N 297 TRP CB CG sing N N 298 TRP CB HB2 sing N N 299 TRP CB HB3 sing N N 300 TRP CG CD1 doub Y N 301 TRP CG CD2 sing Y N 302 TRP CD1 NE1 sing Y N 303 TRP CD1 HD1 sing N N 304 TRP CD2 CE2 doub Y N 305 TRP CD2 CE3 sing Y N 306 TRP NE1 CE2 sing Y N 307 TRP NE1 HE1 sing N N 308 TRP CE2 CZ2 sing Y N 309 TRP CE3 CZ3 doub Y N 310 TRP CE3 HE3 sing N N 311 TRP CZ2 CH2 doub Y N 312 TRP CZ2 HZ2 sing N N 313 TRP CZ3 CH2 sing Y N 314 TRP CZ3 HZ3 sing N N 315 TRP CH2 HH2 sing N N 316 TRP OXT HXT sing N N 317 TYR N CA sing N N 318 TYR N H sing N N 319 TYR N H2 sing N N 320 TYR CA C sing N N 321 TYR CA CB sing N N 322 TYR CA HA sing N N 323 TYR C O doub N N 324 TYR C OXT sing N N 325 TYR CB CG sing N N 326 TYR CB HB2 sing N N 327 TYR CB HB3 sing N N 328 TYR CG CD1 doub Y N 329 TYR CG CD2 sing Y N 330 TYR CD1 CE1 sing Y N 331 TYR CD1 HD1 sing N N 332 TYR CD2 CE2 doub Y N 333 TYR CD2 HD2 sing N N 334 TYR CE1 CZ doub Y N 335 TYR CE1 HE1 sing N N 336 TYR CE2 CZ sing Y N 337 TYR CE2 HE2 sing N N 338 TYR CZ OH sing N N 339 TYR OH HH sing N N 340 TYR OXT HXT sing N N 341 VAL N CA sing N N 342 VAL N H sing N N 343 VAL N H2 sing N N 344 VAL CA C sing N N 345 VAL CA CB sing N N 346 VAL CA HA sing N N 347 VAL C O doub N N 348 VAL C OXT sing N N 349 VAL CB CG1 sing N N 350 VAL CB CG2 sing N N 351 VAL CB HB sing N N 352 VAL CG1 HG11 sing N N 353 VAL CG1 HG12 sing N N 354 VAL CG1 HG13 sing N N 355 VAL CG2 HG21 sing N N 356 VAL CG2 HG22 sing N N 357 VAL CG2 HG23 sing N N 358 VAL OXT HXT sing N N 359 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 'DI(HYDROXYETHYL)ETHER' PEG 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2BEM _pdbx_initial_refinement_model.details 'PDB ENTRY 2BEM' #