data_4BD6 # _entry.id 4BD6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4BD6 PDBE EBI-54283 WWPDB D_1290054283 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 4BD2 unspecified 'BAX DOMAIN SWAPPED DIMER IN COMPLEX WITH BIDBH3' PDB 4BD7 unspecified 'BAX DOMAIN SWAPPED DIMER INDUCED BY OCTYLMALTOSIDE' PDB 4BD8 unspecified 'BAX DOMAIN SWAPPED DIMER INDUCED BY BIMBH3 WITH CHAPS' PDB 4BDU unspecified 'BAX BH3-IN-GROOVE DIMER (GFP)' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4BD6 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-10-05 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Czabotar, P.E.' 1 'Westphal, D.' 2 'Adams, J.M.' 3 'Colman, P.M.' 4 # _citation.id primary _citation.title 'Bax Crystal Structures Reveal How Bh3 Domains Activate Bax and Nucleate its Oligomerization to Induce Apoptosis.' _citation.journal_abbrev 'Cell(Cambridge,Mass.)' _citation.journal_volume 152 _citation.page_first 519 _citation.page_last ? _citation.year 2013 _citation.journal_id_ASTM CELLB5 _citation.country US _citation.journal_id_ISSN 0092-8674 _citation.journal_id_CSD 0998 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23374347 _citation.pdbx_database_id_DOI 10.1016/J.CELL.2012.12.031 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Czabotar, P.E.' 1 primary 'Westphal, D.' 2 primary 'Dewson, G.' 3 primary 'Ma, S.' 4 primary 'Hockings, C.' 5 primary 'Fairlie, W.D.' 6 primary 'Lee, E.F.' 7 primary 'Yao, S.' 8 primary 'Robin, A.Y.' 9 primary 'Smith, B.J.' 10 primary 'Huang, D.C.' 11 primary 'Kluck, R.M.' 12 primary 'Adams, J.M.' 13 primary 'Colman, P.M.' 14 # _cell.entry_id 4BD6 _cell.length_a 103.715 _cell.length_b 103.715 _cell.length_c 40.555 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4BD6 _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'APOPTOSIS REGULATOR BAX' 19182.711 1 ? YES 'RESIDUES 1-171' ? 2 polymer syn 'APOPTOSIS REGULATOR BAX' 3837.381 1 ? ? 'RESIDUES 48-81' ? 3 water nat water 18.015 9 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'BCL-2-LIKE PROTEIN 4, BCL2-L-4' 2 'BCL-2-LIKE PROTEIN 4, BCL2-L-4' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSESLKRIGDELDSNMELQRMI AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG LLSYFGTPTWQGSS ; ;MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSESLKRIGDELDSNMELQRMI AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG LLSYFGTPTWQGSS ; A ? 2 'polypeptide(L)' no no DPVPQDASTKKLSECLKRIGDELDSNMELQRMIA DPVPQDASTKKLSECLKRIGDELDSNMELQRMIA C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLY n 1 4 SER n 1 5 GLY n 1 6 GLU n 1 7 GLN n 1 8 PRO n 1 9 ARG n 1 10 GLY n 1 11 GLY n 1 12 GLY n 1 13 PRO n 1 14 THR n 1 15 SER n 1 16 SER n 1 17 GLU n 1 18 GLN n 1 19 ILE n 1 20 MET n 1 21 LYS n 1 22 THR n 1 23 GLY n 1 24 ALA n 1 25 LEU n 1 26 LEU n 1 27 LEU n 1 28 GLN n 1 29 GLY n 1 30 PHE n 1 31 ILE n 1 32 GLN n 1 33 ASP n 1 34 ARG n 1 35 ALA n 1 36 GLY n 1 37 ARG n 1 38 MET n 1 39 GLY n 1 40 GLY n 1 41 GLU n 1 42 ALA n 1 43 PRO n 1 44 GLU n 1 45 LEU n 1 46 ALA n 1 47 LEU n 1 48 ASP n 1 49 PRO n 1 50 VAL n 1 51 PRO n 1 52 GLN n 1 53 ASP n 1 54 ALA n 1 55 SER n 1 56 THR n 1 57 LYS n 1 58 LYS n 1 59 LEU n 1 60 SER n 1 61 GLU n 1 62 SER n 1 63 LEU n 1 64 LYS n 1 65 ARG n 1 66 ILE n 1 67 GLY n 1 68 ASP n 1 69 GLU n 1 70 LEU n 1 71 ASP n 1 72 SER n 1 73 ASN n 1 74 MET n 1 75 GLU n 1 76 LEU n 1 77 GLN n 1 78 ARG n 1 79 MET n 1 80 ILE n 1 81 ALA n 1 82 ALA n 1 83 VAL n 1 84 ASP n 1 85 THR n 1 86 ASP n 1 87 SER n 1 88 PRO n 1 89 ARG n 1 90 GLU n 1 91 VAL n 1 92 PHE n 1 93 PHE n 1 94 ARG n 1 95 VAL n 1 96 ALA n 1 97 ALA n 1 98 ASP n 1 99 MET n 1 100 PHE n 1 101 SER n 1 102 ASP n 1 103 GLY n 1 104 ASN n 1 105 PHE n 1 106 ASN n 1 107 TRP n 1 108 GLY n 1 109 ARG n 1 110 VAL n 1 111 VAL n 1 112 ALA n 1 113 LEU n 1 114 PHE n 1 115 TYR n 1 116 PHE n 1 117 ALA n 1 118 SER n 1 119 LYS n 1 120 LEU n 1 121 VAL n 1 122 LEU n 1 123 LYS n 1 124 ALA n 1 125 LEU n 1 126 SER n 1 127 THR n 1 128 LYS n 1 129 VAL n 1 130 PRO n 1 131 GLU n 1 132 LEU n 1 133 ILE n 1 134 ARG n 1 135 THR n 1 136 ILE n 1 137 MET n 1 138 GLY n 1 139 TRP n 1 140 THR n 1 141 LEU n 1 142 ASP n 1 143 PHE n 1 144 LEU n 1 145 ARG n 1 146 GLU n 1 147 ARG n 1 148 LEU n 1 149 LEU n 1 150 GLY n 1 151 TRP n 1 152 ILE n 1 153 GLN n 1 154 ASP n 1 155 GLN n 1 156 GLY n 1 157 GLY n 1 158 TRP n 1 159 ASP n 1 160 GLY n 1 161 LEU n 1 162 LEU n 1 163 SER n 1 164 TYR n 1 165 PHE n 1 166 GLY n 1 167 THR n 1 168 PRO n 1 169 THR n 1 170 TRP n 1 171 GLN n 1 172 GLY n 1 173 SER n 1 174 SER n 2 1 ASP n 2 2 PRO n 2 3 VAL n 2 4 PRO n 2 5 GLN n 2 6 ASP n 2 7 ALA n 2 8 SER n 2 9 THR n 2 10 LYS n 2 11 LYS n 2 12 LEU n 2 13 SER n 2 14 GLU n 2 15 CYS n 2 16 LEU n 2 17 LYS n 2 18 ARG n 2 19 ILE n 2 20 GLY n 2 21 ASP n 2 22 GLU n 2 23 LEU n 2 24 ASP n 2 25 SER n 2 26 ASN n 2 27 MET n 2 28 GLU n 2 29 LEU n 2 30 GLN n 2 31 ARG n 2 32 MET n 2 33 ILE n 2 34 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'HOMO SAPIENS' _pdbx_entity_src_syn.organism_common_name HUMAN _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP BAX_HUMAN 1 ? ? Q07812 ? 2 UNP BAX_HUMAN 2 ? ? Q07812 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4BD6 A 1 ? 171 ? Q07812 1 ? 171 ? 1 171 2 2 4BD6 C 1 ? 34 ? Q07812 48 ? 81 ? 48 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4BD6 GLY A 172 ? UNP Q07812 ? ? 'expression tag' 172 1 1 4BD6 SER A 173 ? UNP Q07812 ? ? 'expression tag' 173 2 1 4BD6 SER A 174 ? UNP Q07812 ? ? 'expression tag' 174 3 1 4BD6 SER A 62 ? UNP Q07812 CYS 62 'engineered mutation' 62 4 1 4BD6 SER A 126 ? UNP Q07812 CYS 126 'engineered mutation' 126 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4BD6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_percent_sol 48.1 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.4 M SODIUM CITRATE, 0.1 M SODIUM CACODYLATE PH 5.75' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2012-02-14 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_wavelength 0.9537 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4BD6 _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 51.80 _reflns.d_resolution_high 2.49 _reflns.number_obs 8067 _reflns.number_all ? _reflns.percent_possible_obs 98.9 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 26.72 _reflns.B_iso_Wilson_estimate 72.90 _reflns.pdbx_redundancy 12.2 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.49 _reflns_shell.d_res_low 2.85 _reflns_shell.percent_possible_all 94.1 _reflns_shell.Rmerge_I_obs 1.693 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.45 _reflns_shell.pdbx_redundancy 11.5 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4BD6 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8067 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.99 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 51.858 _refine.ls_d_res_high 2.494 _refine.ls_percent_reflns_obs 98.98 _refine.ls_R_factor_obs 0.2482 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2463 _refine.ls_R_factor_R_free 0.2853 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 404 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 83.2 _refine.aniso_B[1][1] -0.0606 _refine.aniso_B[2][2] -0.0606 _refine.aniso_B[3][3] 0.1213 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.341 _refine.solvent_model_param_bsol 65.462 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.98 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'BAX DOMAIN SWAPPED DIMER INDUCED BY OCTYLMALTOSIDE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.42 _refine.pdbx_overall_phase_error 28.82 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1305 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1314 _refine_hist.d_res_high 2.494 _refine_hist.d_res_low 51.858 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.012 ? ? 1326 'X-RAY DIFFRACTION' ? f_angle_d 1.480 ? ? 1781 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.174 ? ? 493 'X-RAY DIFFRACTION' ? f_chiral_restr 0.078 ? ? 197 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 227 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.4938 2.8546 2444 0.3183 97.00 0.3799 . . 130 . . 'X-RAY DIFFRACTION' . 2.8546 3.5964 2538 0.2547 100.00 0.3018 . . 133 . . 'X-RAY DIFFRACTION' . 3.5964 51.8687 2681 0.2347 100.00 0.2687 . . 141 . . # _struct.entry_id 4BD6 _struct.title 'Bax domain swapped dimer in complex with BaxBH3' _struct.pdbx_descriptor 'APOPTOSIS REGULATOR BAX' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4BD6 _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'APOPTOSIS, PROGRAMMED CELL DEATH' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? ARG A 37 ? SER A 15 ARG A 37 1 ? 23 HELX_P HELX_P2 2 ASP A 53 ? ASN A 73 ? ASP A 53 ASN A 73 1 ? 21 HELX_P HELX_P3 3 ASN A 73 ? VAL A 83 ? ASN A 73 VAL A 83 1 ? 11 HELX_P HELX_P4 4 SER A 87 ? PHE A 100 ? SER A 87 PHE A 100 1 ? 14 HELX_P HELX_P5 5 ASN A 106 ? GLN A 155 ? ASN A 106 GLN A 155 1 ? 50 HELX_P HELX_P6 6 TRP A 158 ? PHE A 165 ? TRP A 158 PHE A 165 1 ? 8 HELX_P HELX_P7 7 SER B 8 ? ASN B 26 ? SER C 55 ASN C 73 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 4BD6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4BD6 _atom_sites.fract_transf_matrix[1][1] 0.009642 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009642 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024658 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 GLU 6 6 ? ? ? A . n A 1 7 GLN 7 7 ? ? ? A . n A 1 8 PRO 8 8 ? ? ? A . n A 1 9 ARG 9 9 ? ? ? A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 MET 38 38 ? ? ? A . n A 1 39 GLY 39 39 ? ? ? A . n A 1 40 GLY 40 40 ? ? ? A . n A 1 41 GLU 41 41 ? ? ? A . n A 1 42 ALA 42 42 ? ? ? A . n A 1 43 PRO 43 43 ? ? ? A . n A 1 44 GLU 44 44 ? ? ? A . n A 1 45 LEU 45 45 ? ? ? A . n A 1 46 ALA 46 46 ? ? ? A . n A 1 47 LEU 47 47 ? ? ? A . n A 1 48 ASP 48 48 ? ? ? A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 TRP 107 107 107 TRP TRP A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 MET 137 137 137 MET MET A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 TRP 139 139 139 TRP TRP A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 TRP 151 151 151 TRP TRP A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 THR 167 167 167 THR THR A . n A 1 168 PRO 168 168 ? ? ? A . n A 1 169 THR 169 169 ? ? ? A . n A 1 170 TRP 170 170 ? ? ? A . n A 1 171 GLN 171 171 ? ? ? A . n A 1 172 GLY 172 172 ? ? ? A . n A 1 173 SER 173 173 ? ? ? A . n A 1 174 SER 174 174 ? ? ? A . n B 2 1 ASP 1 48 ? ? ? C . n B 2 2 PRO 2 49 ? ? ? C . n B 2 3 VAL 3 50 ? ? ? C . n B 2 4 PRO 4 51 ? ? ? C . n B 2 5 GLN 5 52 ? ? ? C . n B 2 6 ASP 6 53 ? ? ? C . n B 2 7 ALA 7 54 54 ALA ALA C . n B 2 8 SER 8 55 55 SER SER C . n B 2 9 THR 9 56 56 THR THR C . n B 2 10 LYS 10 57 57 LYS LYS C . n B 2 11 LYS 11 58 58 LYS LYS C . n B 2 12 LEU 12 59 59 LEU LEU C . n B 2 13 SER 13 60 60 SER SER C . n B 2 14 GLU 14 61 61 GLU GLU C . n B 2 15 CYS 15 62 62 CYS CYS C . n B 2 16 LEU 16 63 63 LEU LEU C . n B 2 17 LYS 17 64 64 LYS LYS C . n B 2 18 ARG 18 65 65 ARG ARG C . n B 2 19 ILE 19 66 66 ILE ILE C . n B 2 20 GLY 20 67 67 GLY GLY C . n B 2 21 ASP 21 68 68 ASP ASP C . n B 2 22 GLU 22 69 69 GLU GLU C . n B 2 23 LEU 23 70 70 LEU LEU C . n B 2 24 ASP 24 71 71 ASP ASP C . n B 2 25 SER 25 72 72 SER SER C . n B 2 26 ASN 26 73 73 ASN ASN C . n B 2 27 MET 27 74 ? ? ? C . n B 2 28 GLU 28 75 ? ? ? C . n B 2 29 LEU 29 76 ? ? ? C . n B 2 30 GLN 30 77 ? ? ? C . n B 2 31 ARG 31 78 ? ? ? C . n B 2 32 MET 32 79 ? ? ? C . n B 2 33 ILE 33 80 ? ? ? C . n B 2 34 ALA 34 81 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . D 3 HOH 1 2001 2001 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 10370 ? 1 MORE -116.4 ? 1 'SSA (A^2)' 16230 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2013-02-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 XDS 'data reduction' . ? 2 XDS 'data scaling' . ? 3 PHASER phasing . ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OH _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 TYR _pdbx_validate_symm_contact.auth_seq_id_1 164 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD1 _pdbx_validate_symm_contact.auth_asym_id_2 C _pdbx_validate_symm_contact.auth_comp_id_2 ASP _pdbx_validate_symm_contact.auth_seq_id_2 71 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_555 _pdbx_validate_symm_contact.dist 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 73 ? ? -65.37 99.19 2 1 SER A 87 ? ? -117.92 70.10 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 2 ? A ASP 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A GLU 6 ? A GLU 6 7 1 Y 1 A GLN 7 ? A GLN 7 8 1 Y 1 A PRO 8 ? A PRO 8 9 1 Y 1 A ARG 9 ? A ARG 9 10 1 Y 1 A MET 38 ? A MET 38 11 1 Y 1 A GLY 39 ? A GLY 39 12 1 Y 1 A GLY 40 ? A GLY 40 13 1 Y 1 A GLU 41 ? A GLU 41 14 1 Y 1 A ALA 42 ? A ALA 42 15 1 Y 1 A PRO 43 ? A PRO 43 16 1 Y 1 A GLU 44 ? A GLU 44 17 1 Y 1 A LEU 45 ? A LEU 45 18 1 Y 1 A ALA 46 ? A ALA 46 19 1 Y 1 A LEU 47 ? A LEU 47 20 1 Y 1 A ASP 48 ? A ASP 48 21 1 Y 1 A PRO 168 ? A PRO 168 22 1 Y 1 A THR 169 ? A THR 169 23 1 Y 1 A TRP 170 ? A TRP 170 24 1 Y 1 A GLN 171 ? A GLN 171 25 1 Y 1 A GLY 172 ? A GLY 172 26 1 Y 1 A SER 173 ? A SER 173 27 1 Y 1 A SER 174 ? A SER 174 28 1 Y 1 C ASP 48 ? B ASP 1 29 1 Y 1 C PRO 49 ? B PRO 2 30 1 Y 1 C VAL 50 ? B VAL 3 31 1 Y 1 C PRO 51 ? B PRO 4 32 1 Y 1 C GLN 52 ? B GLN 5 33 1 Y 1 C ASP 53 ? B ASP 6 34 1 Y 1 C MET 74 ? B MET 27 35 1 Y 1 C GLU 75 ? B GLU 28 36 1 Y 1 C LEU 76 ? B LEU 29 37 1 Y 1 C GLN 77 ? B GLN 30 38 1 Y 1 C ARG 78 ? B ARG 31 39 1 Y 1 C MET 79 ? B MET 32 40 1 Y 1 C ILE 80 ? B ILE 33 41 1 Y 1 C ALA 81 ? B ALA 34 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #