data_4BDW # _entry.id 4BDW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4BDW PDBE EBI-54394 WWPDB D_1290054394 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4BDX _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'THE STRUCTURE OF THE FNI-EGF TANDEM DOMAIN OF COAGULATION FACTOR XII' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4BDW _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-10-08 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Beringer, D.X.' 1 'Kroon-Batenburg, L.M.J.' 2 # _citation.id primary _citation.title 'The Structure of the Fni-Egf-Like Tandem Domain of Coagulation Factor Xii Solved Using Siras.' _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_volume 69 _citation.page_first 94 _citation.page_last ? _citation.year 2013 _citation.journal_id_ASTM ? _citation.country DK _citation.journal_id_ISSN 1744-3091 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23385745 _citation.pdbx_database_id_DOI 10.1107/S1744309113000286 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Beringer, D.X.' 1 primary 'Kroon-Batenburg, L.M.J.' 2 # _cell.entry_id 4BDW _cell.length_a 96.245 _cell.length_b 96.245 _cell.length_c 47.331 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4BDW _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'COAGULATION FACTOR XIIA HEAVY CHAIN' 9538.882 1 3.4.21.38 ? 'FNI-EGF, RESIDUES 133-215' ? 2 non-polymer syn 'HOLMIUM ATOM' 164.930 2 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 15 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'COAGULATION FACTOR XII, HAGEMAN FACTOR, HAF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCD VDTAA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCD VDTAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLU n 1 4 LYS n 1 5 CYS n 1 6 PHE n 1 7 GLU n 1 8 PRO n 1 9 GLN n 1 10 LEU n 1 11 LEU n 1 12 ARG n 1 13 PHE n 1 14 PHE n 1 15 HIS n 1 16 LYS n 1 17 ASN n 1 18 GLU n 1 19 ILE n 1 20 TRP n 1 21 TYR n 1 22 ARG n 1 23 THR n 1 24 GLU n 1 25 GLN n 1 26 ALA n 1 27 ALA n 1 28 VAL n 1 29 ALA n 1 30 ARG n 1 31 CYS n 1 32 GLN n 1 33 CYS n 1 34 LYS n 1 35 GLY n 1 36 PRO n 1 37 ASP n 1 38 ALA n 1 39 HIS n 1 40 CYS n 1 41 GLN n 1 42 ARG n 1 43 LEU n 1 44 ALA n 1 45 SER n 1 46 GLN n 1 47 ALA n 1 48 CYS n 1 49 ARG n 1 50 THR n 1 51 ASN n 1 52 PRO n 1 53 CYS n 1 54 LEU n 1 55 HIS n 1 56 GLY n 1 57 GLY n 1 58 ARG n 1 59 CYS n 1 60 LEU n 1 61 GLU n 1 62 VAL n 1 63 GLU n 1 64 GLY n 1 65 HIS n 1 66 ARG n 1 67 LEU n 1 68 CYS n 1 69 HIS n 1 70 CYS n 1 71 PRO n 1 72 VAL n 1 73 GLY n 1 74 TYR n 1 75 THR n 1 76 GLY n 1 77 PRO n 1 78 PHE n 1 79 CYS n 1 80 ASP n 1 81 VAL n 1 82 ASP n 1 83 THR n 1 84 ALA n 1 85 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'KOMAGATAELLA PASTORIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain X-33 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PPICZALPHA _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FA12_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P00748 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4BDW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00748 _struct_ref_seq.db_align_beg 133 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 215 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4BDW GLY A 1 ? UNP P00748 ? ? 'expression tag' 1 1 1 4BDW SER A 2 ? UNP P00748 ? ? 'expression tag' 2 2 1 4BDW PRO A 77 ? UNP P00748 ALA 207 variant 77 3 1 4BDW ALA A 84 ? UNP P00748 LYS 214 'cloning artifact' 84 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HO non-polymer . 'HOLMIUM ATOM' ? Ho 164.930 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4BDW _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.89 _exptl_crystal.density_percent_sol 57.4 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1 M TRIS, 16-18% PEG4,000, 0.2 M POTASSIUM ACETATE SOAKED IN SAME BUFFER WITH 10 MM HOLMIUM CHLORIDE, pH 8.5' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2010-05-16 _diffrn_detector.details 'DYNAMICALLY BENDABLE MIRROR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'LN2 COOLED FIXED-EXIT SI(111) MONOCHROMATOR' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.53520 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_wavelength 1.53520 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4BDW _reflns.observed_criterion_sigma_I 4.3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 48.12 _reflns.d_resolution_high 2.50 _reflns.number_obs 4061 _reflns.number_all ? _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.10 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 28.40 _reflns.B_iso_Wilson_estimate 47.34 _reflns.pdbx_redundancy 10.9 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.62 _reflns_shell.percent_possible_all 97.1 _reflns_shell.Rmerge_I_obs 0.35 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.30 _reflns_shell.pdbx_redundancy 5.7 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4BDW _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 4054 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.96 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 48.123 _refine.ls_d_res_high 2.501 _refine.ls_percent_reflns_obs 99.25 _refine.ls_R_factor_obs 0.2193 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2186 _refine.ls_R_factor_R_free 0.2347 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 332 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 63.33 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0 _refine.solvent_model_param_bsol 0 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SIRAS _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.27 _refine.pdbx_overall_phase_error 26.38 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 653 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 671 _refine_hist.d_res_high 2.501 _refine_hist.d_res_low 48.123 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.003 ? ? 675 'X-RAY DIFFRACTION' ? f_angle_d 0.699 ? ? 906 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.551 ? ? 247 'X-RAY DIFFRACTION' ? f_chiral_restr 0.051 ? ? 92 'X-RAY DIFFRACTION' ? f_plane_restr 0.003 ? ? 123 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.5007 3.1505 3451 0.2847 99.00 0.3142 . . 175 . . 'X-RAY DIFFRACTION' . 3.1505 48.1314 3521 0.1973 100.00 0.2006 . . 157 . . # _struct.entry_id 4BDW _struct.title 'The structure of the FnI-EGF tandem domain of coagulation factor XII in complex with Holmium' _struct.pdbx_descriptor 'COAGULATION FACTOR XIIA HEAVY CHAIN (E.C.3.4.21.38)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4BDW _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'HYDROLASE, FNI DOMAIN, EGF DOMAIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 5 A CYS 33 1_555 ? ? ? ? ? ? ? 2.040 ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 31 A CYS 40 1_555 ? ? ? ? ? ? ? 2.036 ? disulf3 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 48 A CYS 59 1_555 ? ? ? ? ? ? ? 2.034 ? disulf4 disulf ? ? A CYS 53 SG ? ? ? 1_555 A CYS 68 SG ? ? A CYS 53 A CYS 68 1_555 ? ? ? ? ? ? ? 2.032 ? disulf5 disulf ? ? A CYS 70 SG ? ? ? 1_555 A CYS 79 SG ? ? A CYS 70 A CYS 79 1_555 ? ? ? ? ? ? ? 2.033 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 35 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 35 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 36 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 36 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.34 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 2 ? AB ? 3 ? AC ? 3 ? AD ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AD 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 CYS A 5 ? GLU A 7 ? CYS A 5 GLU A 7 AA 2 ARG A 12 ? PHE A 14 ? ARG A 12 PHE A 14 AB 1 ILE A 19 ? THR A 23 ? ILE A 19 THR A 23 AB 2 VAL A 28 ? CYS A 33 ? VAL A 28 CYS A 33 AB 3 ALA A 38 ? LEU A 43 ? ALA A 38 LEU A 43 AC 1 GLN A 46 ? ALA A 47 ? GLN A 46 ALA A 47 AC 2 ARG A 58 ? GLU A 61 ? ARG A 58 GLU A 61 AC 3 ARG A 66 ? HIS A 69 ? ARG A 66 HIS A 69 AD 1 TYR A 74 ? THR A 75 ? TYR A 74 THR A 75 AD 2 VAL A 81 ? ASP A 82 ? VAL A 81 ASP A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N GLU A 7 ? N GLU A 7 O ARG A 12 ? O ARG A 12 AB 1 2 N ARG A 22 ? N ARG A 22 O ALA A 29 ? O ALA A 29 AB 2 3 N GLN A 32 ? N GLN A 32 O HIS A 39 ? O HIS A 39 AC 1 2 N GLN A 46 ? N GLN A 46 O GLU A 61 ? O GLU A 61 AC 2 3 N LEU A 60 ? N LEU A 60 O LEU A 67 ? O LEU A 67 AD 1 2 N THR A 75 ? N THR A 75 O VAL A 81 ? O VAL A 81 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE HO A 1086' AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HO A 1087' AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 1088' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASP A 82 ? ASP A 82 . ? 1_555 ? 2 AC1 3 THR A 83 ? THR A 83 . ? 1_555 ? 3 AC1 3 ALA A 85 ? ALA A 85 . ? 1_555 ? 4 AC2 10 ALA A 85 ? ALA A 85 . ? 1_555 ? 5 AC2 10 ALA A 85 ? ALA A 85 . ? 15_555 ? 6 AC2 10 HOH E . ? HOH A 2012 . ? 1_555 ? 7 AC2 10 HOH E . ? HOH A 2012 . ? 15_555 ? 8 AC2 10 HOH E . ? HOH A 2013 . ? 1_555 ? 9 AC2 10 HOH E . ? HOH A 2013 . ? 15_555 ? 10 AC2 10 HOH E . ? HOH A 2014 . ? 15_555 ? 11 AC2 10 HOH E . ? HOH A 2014 . ? 1_555 ? 12 AC2 10 HOH E . ? HOH A 2015 . ? 15_555 ? 13 AC2 10 HOH E . ? HOH A 2015 . ? 1_555 ? 14 AC3 2 LYS A 4 ? LYS A 4 . ? 1_555 ? 15 AC3 2 LYS A 4 ? LYS A 4 . ? 10_555 ? # _database_PDB_matrix.entry_id 4BDW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4BDW _atom_sites.fract_transf_matrix[1][1] 0.010390 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010390 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021128 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL HO N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ALA 85 85 85 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HO 1 1086 1086 HO HO A . C 2 HO 1 1087 1087 HO HO A . D 3 CL 1 1088 1088 CL CL A . E 4 HOH 1 2001 2001 HOH HOH A . E 4 HOH 2 2002 2002 HOH HOH A . E 4 HOH 3 2003 2003 HOH HOH A . E 4 HOH 4 2004 2004 HOH HOH A . E 4 HOH 5 2005 2005 HOH HOH A . E 4 HOH 6 2006 2006 HOH HOH A . E 4 HOH 7 2007 2007 HOH HOH A . E 4 HOH 8 2008 2008 HOH HOH A . E 4 HOH 9 2009 2009 HOH HOH A . E 4 HOH 10 2010 2010 HOH HOH A . E 4 HOH 11 2011 2011 HOH HOH A . E 4 HOH 12 2012 2012 HOH HOH A . E 4 HOH 13 2013 2013 HOH HOH A . E 4 HOH 14 2014 2014 HOH HOH A . E 4 HOH 15 2015 2015 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HO 1087 ? C HO . 2 1 A CL 1088 ? D CL . 3 1 A HOH 2013 ? E HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-02-13 2 'Structure model' 1 1 2013-02-20 3 'Structure model' 1 2 2013-04-17 4 'Structure model' 1 3 2016-12-28 5 'Structure model' 1 4 2017-07-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other 3 3 'Structure model' 'Structure summary' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 5 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 5 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 12.1694 -0.0324 -25.1373 0.2739 0.3152 0.3519 -0.0009 0.0481 0.0954 7.9157 8.4941 6.5857 -2.9984 -3.0808 2.8999 -0.4568 -0.3289 -0.3910 0.1004 0.1612 -0.3085 0.1657 0.6573 0.2960 'X-RAY DIFFRACTION' 2 ? refined 18.4602 -1.7974 -27.8108 0.4987 0.8043 0.4300 0.0074 0.1191 -0.0403 2.0004 4.0901 2.0021 3.0597 5.2363 4.5634 -0.5369 1.5613 -1.6519 -0.2175 1.2191 -0.5078 -0.3097 3.5708 -0.6753 'X-RAY DIFFRACTION' 3 ? refined 17.2608 -6.6759 -28.4130 0.6389 0.6022 0.7600 0.0150 0.2167 -0.0264 2.0021 5.0075 9.7085 8.2896 8.4922 5.6119 0.7833 1.1640 -1.9108 0.3808 -0.2237 -0.6305 1.2231 0.8252 -0.5490 'X-RAY DIFFRACTION' 4 ? refined 24.1296 6.5288 -13.6141 0.5840 0.8814 0.4155 -0.0019 0.0188 0.1223 6.1845 5.7107 9.4356 -0.7553 -0.4373 5.3648 0.1888 0.5606 0.0527 -0.8477 -0.7091 -0.5076 -1.3265 0.4635 0.5109 'X-RAY DIFFRACTION' 5 ? refined 10.8058 5.5369 -8.7253 0.4861 1.0130 0.6367 -0.0324 -0.1221 -0.1613 4.5838 4.2404 7.6539 -3.9586 -1.6577 -0.9763 0.2209 0.4812 0.0683 0.2097 -0.4194 0.7421 0.1023 -1.2696 0.1997 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 3:27 )' 'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 28:33 )' 'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 34:43 )' 'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 44:69 )' 'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 'CHAIN A AND (RESSEQ 70:85 )' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 XDS 'data reduction' . ? 2 Aimless 'data scaling' . ? 3 PHENIX phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 17 ? ? 73.12 -7.93 2 1 THR A 83 ? ? -133.48 -100.61 3 1 ALA A 84 ? ? -82.61 32.36 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A SER 2 ? A SER 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HOLMIUM ATOM' HO 3 'CHLORIDE ION' CL 4 water HOH #