data_4BG0 # _entry.id 4BG0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4BG0 PDBE EBI-56255 WWPDB D_1290056255 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4CBE _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'CRYSTAL STRUCTURE OF COMPLEMENT FACTORS H AND FHL-1 BINDING PROTEIN BBH06 OR CRASP-2 FROM BORRELIA BURGDORFERI (NATIVE)' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4BG0 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2013-03-22 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Brangulis, K.' 1 'Petrovskis, I.' 2 'Baumanis, V.' 3 'Tars, K.' 4 # _citation.id primary _citation.title 'Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi.' _citation.journal_abbrev 'FEBS J.' _citation.journal_volume 281 _citation.page_first 2613 _citation.page_last ? _citation.year 2014 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1742-464X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24702793 _citation.pdbx_database_id_DOI 10.1111/FEBS.12808 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Brangulis, K.' 1 primary 'Petrovskis, I.' 2 primary 'Kazaks, A.' 3 primary 'Bogans, J.' 4 primary 'Otikovs, M.' 5 primary 'Jaudzems, K.' 6 primary 'Ranka, R.' 7 primary 'Tars, K.' 8 # _cell.entry_id 4BG0 _cell.length_a 90.480 _cell.length_b 48.890 _cell.length_c 44.310 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4BG0 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2 (CRASP-2)' 25052.602 1 ? ? ? ? 2 water nat water 18.015 77 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BBH06 OR CRASP-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMGRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSEGTFSDQSKVNQAISIFKKDNKIVNKFKELEKII EEYKPMFLSKLIDDFAIELDQAVDNDVSNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVE ENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTLL ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMGRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSEGTFSDQSKVNQAISIFKKDNKIVNKFKELEKII EEYKPMFLSKLIDDFAIELDQAVDNDVSNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVE ENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTLL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 ARG n 1 6 LEU n 1 7 ASN n 1 8 GLN n 1 9 ARG n 1 10 ASN n 1 11 ILE n 1 12 ASN n 1 13 GLU n 1 14 LEU n 1 15 LYS n 1 16 ILE n 1 17 PHE n 1 18 VAL n 1 19 GLU n 1 20 LYS n 1 21 ALA n 1 22 LYS n 1 23 TYR n 1 24 TYR n 1 25 SER n 1 26 ILE n 1 27 LYS n 1 28 LEU n 1 29 ASP n 1 30 ALA n 1 31 ILE n 1 32 TYR n 1 33 ASN n 1 34 GLU n 1 35 CYS n 1 36 THR n 1 37 GLY n 1 38 ALA n 1 39 TYR n 1 40 ASN n 1 41 ASP n 1 42 ILE n 1 43 MET n 1 44 THR n 1 45 TYR n 1 46 SER n 1 47 GLU n 1 48 GLY n 1 49 THR n 1 50 PHE n 1 51 SER n 1 52 ASP n 1 53 GLN n 1 54 SER n 1 55 LYS n 1 56 VAL n 1 57 ASN n 1 58 GLN n 1 59 ALA n 1 60 ILE n 1 61 SER n 1 62 ILE n 1 63 PHE n 1 64 LYS n 1 65 LYS n 1 66 ASP n 1 67 ASN n 1 68 LYS n 1 69 ILE n 1 70 VAL n 1 71 ASN n 1 72 LYS n 1 73 PHE n 1 74 LYS n 1 75 GLU n 1 76 LEU n 1 77 GLU n 1 78 LYS n 1 79 ILE n 1 80 ILE n 1 81 GLU n 1 82 GLU n 1 83 TYR n 1 84 LYS n 1 85 PRO n 1 86 MET n 1 87 PHE n 1 88 LEU n 1 89 SER n 1 90 LYS n 1 91 LEU n 1 92 ILE n 1 93 ASP n 1 94 ASP n 1 95 PHE n 1 96 ALA n 1 97 ILE n 1 98 GLU n 1 99 LEU n 1 100 ASP n 1 101 GLN n 1 102 ALA n 1 103 VAL n 1 104 ASP n 1 105 ASN n 1 106 ASP n 1 107 VAL n 1 108 SER n 1 109 ASN n 1 110 ALA n 1 111 ARG n 1 112 HIS n 1 113 VAL n 1 114 ALA n 1 115 ASP n 1 116 SER n 1 117 TYR n 1 118 LYS n 1 119 LYS n 1 120 LEU n 1 121 ARG n 1 122 LYS n 1 123 SER n 1 124 VAL n 1 125 VAL n 1 126 LEU n 1 127 ALA n 1 128 TYR n 1 129 ILE n 1 130 GLU n 1 131 SER n 1 132 PHE n 1 133 ASP n 1 134 VAL n 1 135 ILE n 1 136 SER n 1 137 SER n 1 138 LYS n 1 139 PHE n 1 140 VAL n 1 141 ASP n 1 142 SER n 1 143 LYS n 1 144 PHE n 1 145 VAL n 1 146 GLU n 1 147 ALA n 1 148 SER n 1 149 LYS n 1 150 LYS n 1 151 PHE n 1 152 VAL n 1 153 ASN n 1 154 LYS n 1 155 ALA n 1 156 LYS n 1 157 GLU n 1 158 PHE n 1 159 VAL n 1 160 GLU n 1 161 GLU n 1 162 ASN n 1 163 ASP n 1 164 LEU n 1 165 ILE n 1 166 ALA n 1 167 LEU n 1 168 GLU n 1 169 CYS n 1 170 ILE n 1 171 VAL n 1 172 LYS n 1 173 THR n 1 174 ILE n 1 175 GLY n 1 176 ASP n 1 177 MET n 1 178 VAL n 1 179 ASN n 1 180 ASP n 1 181 ARG n 1 182 GLU n 1 183 ILE n 1 184 ASN n 1 185 SER n 1 186 ARG n 1 187 SER n 1 188 ARG n 1 189 TYR n 1 190 ASN n 1 191 ASN n 1 192 PHE n 1 193 TYR n 1 194 LYS n 1 195 LYS n 1 196 GLU n 1 197 ALA n 1 198 ASP n 1 199 PHE n 1 200 LEU n 1 201 GLY n 1 202 ALA n 1 203 ALA n 1 204 VAL n 1 205 GLU n 1 206 LEU n 1 207 GLU n 1 208 GLY n 1 209 ALA n 1 210 TYR n 1 211 LYS n 1 212 ALA n 1 213 ILE n 1 214 LYS n 1 215 GLN n 1 216 THR n 1 217 LEU n 1 218 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain B31 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BORRELIA BURGDORFERI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224326 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PETM-11 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O50665_BORBU _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O50665 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4BG0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 218 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O50665 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 236 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 219 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4BG0 GLY A 1 ? UNP O50665 ? ? 'expression tag' 2 1 1 4BG0 ALA A 2 ? UNP O50665 ? ? 'expression tag' 3 2 1 4BG0 MET A 3 ? UNP O50665 ? ? 'expression tag' 4 3 1 4BG0 GLY A 4 ? UNP O50665 ? ? 'expression tag' 5 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4BG0 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.96 _exptl_crystal.density_percent_sol 37.3 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.2M SODIUM ACETATE, 0.1M TRIS PH 8.5, 30% PEG 2000MME' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2013-02-01 _diffrn_detector.details 'RH-COATED TOROIDAL SI MIRROR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DOUBLE CRYSTAL SI(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'MAX II BEAMLINE I911-3' _diffrn_source.pdbx_synchrotron_site 'MAX II' _diffrn_source.pdbx_synchrotron_beamline I911-3 _diffrn_source.pdbx_wavelength 1.000 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4BG0 _reflns.observed_criterion_sigma_I 1.8 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 39.80 _reflns.d_resolution_high 2.10 _reflns.number_obs 12042 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.04 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.40 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 13.8 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.21 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.17 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.70 _reflns_shell.pdbx_redundancy 13.9 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4BG0 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 11437 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.23 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 99.96 _refine.ls_R_factor_obs 0.19173 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18999 _refine.ls_R_factor_R_free 0.22610 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 572 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.956 _refine.correlation_coeff_Fo_to_Fc_free 0.936 _refine.B_iso_mean 36.909 _refine.aniso_B[1][1] 0.15 _refine.aniso_B[2][2] -1.10 _refine.aniso_B[3][3] 0.95 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.253 _refine.pdbx_overall_ESU_R_Free 0.188 _refine.overall_SU_ML 0.142 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 5.320 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1663 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 77 _refine_hist.number_atoms_total 1740 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 33.23 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.014 0.020 ? 1685 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 1658 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.435 1.965 ? 2255 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.776 3.000 ? 3821 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.499 5.000 ? 202 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.136 25.366 ? 82 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 15.475 15.000 ? 336 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.572 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.075 0.200 ? 252 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 1868 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 373 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.554 3.368 ? 817 'X-RAY DIFFRACTION' ? r_mcbond_other 2.554 3.364 ? 816 'X-RAY DIFFRACTION' ? r_mcangle_it 3.640 5.023 ? 1016 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.727 3.890 ? 868 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.154 _refine_ls_shell.number_reflns_R_work 834 _refine_ls_shell.R_factor_R_work 0.222 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.323 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 38 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 4BG0 _struct.title 'Crystal structure of complement factors H and FHL-1 binding protein BBH06 or CRASP-2 from Borrelia burgdorferi' _struct.pdbx_descriptor 'COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2 (CRASP-2)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4BG0 _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text 'CELL ADHESION, OUTER SURFACE LIPOPROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 4 ? ALA A 21 ? GLY A 5 ALA A 22 1 ? 18 HELX_P HELX_P2 2 TYR A 23 ? TYR A 45 ? TYR A 24 TYR A 46 1 ? 23 HELX_P HELX_P3 3 ASP A 52 ? LYS A 65 ? ASP A 53 LYS A 66 1 ? 14 HELX_P HELX_P4 4 ASN A 67 ? ILE A 80 ? ASN A 68 ILE A 81 1 ? 14 HELX_P HELX_P5 5 PHE A 87 ? ASN A 105 ? PHE A 88 ASN A 106 1 ? 19 HELX_P HELX_P6 6 ALA A 110 ? SER A 137 ? ALA A 111 SER A 138 1 ? 28 HELX_P HELX_P7 7 ASP A 141 ? ASN A 162 ? ASP A 142 ASN A 163 1 ? 22 HELX_P HELX_P8 8 ASN A 162 ? ASN A 179 ? ASN A 163 ASN A 180 1 ? 18 HELX_P HELX_P9 9 LYS A 195 ? GLN A 215 ? LYS A 196 GLN A 216 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 4BG0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4BG0 _atom_sites.fract_transf_matrix[1][1] 0.011052 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020454 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022568 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2 ? ? ? A . n A 1 2 ALA 2 3 ? ? ? A . n A 1 3 MET 3 4 ? ? ? A . n A 1 4 GLY 4 5 5 GLY GLY A . n A 1 5 ARG 5 6 6 ARG ARG A . n A 1 6 LEU 6 7 7 LEU LEU A . n A 1 7 ASN 7 8 8 ASN ASN A . n A 1 8 GLN 8 9 9 GLN GLN A . n A 1 9 ARG 9 10 10 ARG ARG A . n A 1 10 ASN 10 11 11 ASN ASN A . n A 1 11 ILE 11 12 12 ILE ILE A . n A 1 12 ASN 12 13 13 ASN ASN A . n A 1 13 GLU 13 14 14 GLU GLU A . n A 1 14 LEU 14 15 15 LEU LEU A . n A 1 15 LYS 15 16 16 LYS LYS A . n A 1 16 ILE 16 17 17 ILE ILE A . n A 1 17 PHE 17 18 18 PHE PHE A . n A 1 18 VAL 18 19 19 VAL VAL A . n A 1 19 GLU 19 20 20 GLU GLU A . n A 1 20 LYS 20 21 21 LYS LYS A . n A 1 21 ALA 21 22 22 ALA ALA A . n A 1 22 LYS 22 23 23 LYS LYS A . n A 1 23 TYR 23 24 24 TYR TYR A . n A 1 24 TYR 24 25 25 TYR TYR A . n A 1 25 SER 25 26 26 SER SER A . n A 1 26 ILE 26 27 27 ILE ILE A . n A 1 27 LYS 27 28 28 LYS LYS A . n A 1 28 LEU 28 29 29 LEU LEU A . n A 1 29 ASP 29 30 30 ASP ASP A . n A 1 30 ALA 30 31 31 ALA ALA A . n A 1 31 ILE 31 32 32 ILE ILE A . n A 1 32 TYR 32 33 33 TYR TYR A . n A 1 33 ASN 33 34 34 ASN ASN A . n A 1 34 GLU 34 35 35 GLU GLU A . n A 1 35 CYS 35 36 36 CYS CYS A . n A 1 36 THR 36 37 37 THR THR A . n A 1 37 GLY 37 38 38 GLY GLY A . n A 1 38 ALA 38 39 39 ALA ALA A . n A 1 39 TYR 39 40 40 TYR TYR A . n A 1 40 ASN 40 41 41 ASN ASN A . n A 1 41 ASP 41 42 42 ASP ASP A . n A 1 42 ILE 42 43 43 ILE ILE A . n A 1 43 MET 43 44 44 MET MET A . n A 1 44 THR 44 45 45 THR THR A . n A 1 45 TYR 45 46 46 TYR TYR A . n A 1 46 SER 46 47 47 SER SER A . n A 1 47 GLU 47 48 ? ? ? A . n A 1 48 GLY 48 49 ? ? ? A . n A 1 49 THR 49 50 ? ? ? A . n A 1 50 PHE 50 51 ? ? ? A . n A 1 51 SER 51 52 ? ? ? A . n A 1 52 ASP 52 53 53 ASP ASP A . n A 1 53 GLN 53 54 54 GLN GLN A . n A 1 54 SER 54 55 55 SER SER A . n A 1 55 LYS 55 56 56 LYS LYS A . n A 1 56 VAL 56 57 57 VAL VAL A . n A 1 57 ASN 57 58 58 ASN ASN A . n A 1 58 GLN 58 59 59 GLN GLN A . n A 1 59 ALA 59 60 60 ALA ALA A . n A 1 60 ILE 60 61 61 ILE ILE A . n A 1 61 SER 61 62 62 SER SER A . n A 1 62 ILE 62 63 63 ILE ILE A . n A 1 63 PHE 63 64 64 PHE PHE A . n A 1 64 LYS 64 65 65 LYS LYS A . n A 1 65 LYS 65 66 66 LYS LYS A . n A 1 66 ASP 66 67 67 ASP ASP A . n A 1 67 ASN 67 68 68 ASN ASN A . n A 1 68 LYS 68 69 69 LYS LYS A . n A 1 69 ILE 69 70 70 ILE ILE A . n A 1 70 VAL 70 71 71 VAL VAL A . n A 1 71 ASN 71 72 72 ASN ASN A . n A 1 72 LYS 72 73 73 LYS LYS A . n A 1 73 PHE 73 74 74 PHE PHE A . n A 1 74 LYS 74 75 75 LYS LYS A . n A 1 75 GLU 75 76 76 GLU GLU A . n A 1 76 LEU 76 77 77 LEU LEU A . n A 1 77 GLU 77 78 78 GLU GLU A . n A 1 78 LYS 78 79 79 LYS LYS A . n A 1 79 ILE 79 80 80 ILE ILE A . n A 1 80 ILE 80 81 81 ILE ILE A . n A 1 81 GLU 81 82 82 GLU GLU A . n A 1 82 GLU 82 83 83 GLU GLU A . n A 1 83 TYR 83 84 84 TYR TYR A . n A 1 84 LYS 84 85 85 LYS LYS A . n A 1 85 PRO 85 86 86 PRO PRO A . n A 1 86 MET 86 87 87 MET MET A . n A 1 87 PHE 87 88 88 PHE PHE A . n A 1 88 LEU 88 89 89 LEU LEU A . n A 1 89 SER 89 90 90 SER SER A . n A 1 90 LYS 90 91 91 LYS LYS A . n A 1 91 LEU 91 92 92 LEU LEU A . n A 1 92 ILE 92 93 93 ILE ILE A . n A 1 93 ASP 93 94 94 ASP ASP A . n A 1 94 ASP 94 95 95 ASP ASP A . n A 1 95 PHE 95 96 96 PHE PHE A . n A 1 96 ALA 96 97 97 ALA ALA A . n A 1 97 ILE 97 98 98 ILE ILE A . n A 1 98 GLU 98 99 99 GLU GLU A . n A 1 99 LEU 99 100 100 LEU LEU A . n A 1 100 ASP 100 101 101 ASP ASP A . n A 1 101 GLN 101 102 102 GLN GLN A . n A 1 102 ALA 102 103 103 ALA ALA A . n A 1 103 VAL 103 104 104 VAL VAL A . n A 1 104 ASP 104 105 105 ASP ASP A . n A 1 105 ASN 105 106 106 ASN ASN A . n A 1 106 ASP 106 107 ? ? ? A . n A 1 107 VAL 107 108 ? ? ? A . n A 1 108 SER 108 109 ? ? ? A . n A 1 109 ASN 109 110 ? ? ? A . n A 1 110 ALA 110 111 111 ALA ALA A . n A 1 111 ARG 111 112 112 ARG ARG A . n A 1 112 HIS 112 113 113 HIS HIS A . n A 1 113 VAL 113 114 114 VAL VAL A . n A 1 114 ALA 114 115 115 ALA ALA A . n A 1 115 ASP 115 116 116 ASP ASP A . n A 1 116 SER 116 117 117 SER SER A . n A 1 117 TYR 117 118 118 TYR TYR A . n A 1 118 LYS 118 119 119 LYS LYS A . n A 1 119 LYS 119 120 120 LYS LYS A . n A 1 120 LEU 120 121 121 LEU LEU A . n A 1 121 ARG 121 122 122 ARG ARG A . n A 1 122 LYS 122 123 123 LYS LYS A . n A 1 123 SER 123 124 124 SER SER A . n A 1 124 VAL 124 125 125 VAL VAL A . n A 1 125 VAL 125 126 126 VAL VAL A . n A 1 126 LEU 126 127 127 LEU LEU A . n A 1 127 ALA 127 128 128 ALA ALA A . n A 1 128 TYR 128 129 129 TYR TYR A . n A 1 129 ILE 129 130 130 ILE ILE A . n A 1 130 GLU 130 131 131 GLU GLU A . n A 1 131 SER 131 132 132 SER SER A . n A 1 132 PHE 132 133 133 PHE PHE A . n A 1 133 ASP 133 134 134 ASP ASP A . n A 1 134 VAL 134 135 135 VAL VAL A . n A 1 135 ILE 135 136 136 ILE ILE A . n A 1 136 SER 136 137 137 SER SER A . n A 1 137 SER 137 138 138 SER SER A . n A 1 138 LYS 138 139 139 LYS LYS A . n A 1 139 PHE 139 140 140 PHE PHE A . n A 1 140 VAL 140 141 141 VAL VAL A . n A 1 141 ASP 141 142 142 ASP ASP A . n A 1 142 SER 142 143 143 SER SER A . n A 1 143 LYS 143 144 144 LYS LYS A . n A 1 144 PHE 144 145 145 PHE PHE A . n A 1 145 VAL 145 146 146 VAL VAL A . n A 1 146 GLU 146 147 147 GLU GLU A . n A 1 147 ALA 147 148 148 ALA ALA A . n A 1 148 SER 148 149 149 SER SER A . n A 1 149 LYS 149 150 150 LYS LYS A . n A 1 150 LYS 150 151 151 LYS LYS A . n A 1 151 PHE 151 152 152 PHE PHE A . n A 1 152 VAL 152 153 153 VAL VAL A . n A 1 153 ASN 153 154 154 ASN ASN A . n A 1 154 LYS 154 155 155 LYS LYS A . n A 1 155 ALA 155 156 156 ALA ALA A . n A 1 156 LYS 156 157 157 LYS LYS A . n A 1 157 GLU 157 158 158 GLU GLU A . n A 1 158 PHE 158 159 159 PHE PHE A . n A 1 159 VAL 159 160 160 VAL VAL A . n A 1 160 GLU 160 161 161 GLU GLU A . n A 1 161 GLU 161 162 162 GLU GLU A . n A 1 162 ASN 162 163 163 ASN ASN A . n A 1 163 ASP 163 164 164 ASP ASP A . n A 1 164 LEU 164 165 165 LEU LEU A . n A 1 165 ILE 165 166 166 ILE ILE A . n A 1 166 ALA 166 167 167 ALA ALA A . n A 1 167 LEU 167 168 168 LEU LEU A . n A 1 168 GLU 168 169 169 GLU GLU A . n A 1 169 CYS 169 170 170 CYS CYS A . n A 1 170 ILE 170 171 171 ILE ILE A . n A 1 171 VAL 171 172 172 VAL VAL A . n A 1 172 LYS 172 173 173 LYS LYS A . n A 1 173 THR 173 174 174 THR THR A . n A 1 174 ILE 174 175 175 ILE ILE A . n A 1 175 GLY 175 176 176 GLY GLY A . n A 1 176 ASP 176 177 177 ASP ASP A . n A 1 177 MET 177 178 178 MET MET A . n A 1 178 VAL 178 179 179 VAL VAL A . n A 1 179 ASN 179 180 180 ASN ASN A . n A 1 180 ASP 180 181 181 ASP ASP A . n A 1 181 ARG 181 182 182 ARG ARG A . n A 1 182 GLU 182 183 183 GLU GLU A . n A 1 183 ILE 183 184 184 ILE ILE A . n A 1 184 ASN 184 185 185 ASN ASN A . n A 1 185 SER 185 186 186 SER SER A . n A 1 186 ARG 186 187 187 ARG ARG A . n A 1 187 SER 187 188 188 SER SER A . n A 1 188 ARG 188 189 189 ARG ARG A . n A 1 189 TYR 189 190 190 TYR TYR A . n A 1 190 ASN 190 191 191 ASN ASN A . n A 1 191 ASN 191 192 192 ASN ASN A . n A 1 192 PHE 192 193 193 PHE PHE A . n A 1 193 TYR 193 194 194 TYR TYR A . n A 1 194 LYS 194 195 195 LYS LYS A . n A 1 195 LYS 195 196 196 LYS LYS A . n A 1 196 GLU 196 197 197 GLU GLU A . n A 1 197 ALA 197 198 198 ALA ALA A . n A 1 198 ASP 198 199 199 ASP ASP A . n A 1 199 PHE 199 200 200 PHE PHE A . n A 1 200 LEU 200 201 201 LEU LEU A . n A 1 201 GLY 201 202 202 GLY GLY A . n A 1 202 ALA 202 203 203 ALA ALA A . n A 1 203 ALA 203 204 204 ALA ALA A . n A 1 204 VAL 204 205 205 VAL VAL A . n A 1 205 GLU 205 206 206 GLU GLU A . n A 1 206 LEU 206 207 207 LEU LEU A . n A 1 207 GLU 207 208 208 GLU GLU A . n A 1 208 GLY 208 209 209 GLY GLY A . n A 1 209 ALA 209 210 210 ALA ALA A . n A 1 210 TYR 210 211 211 TYR TYR A . n A 1 211 LYS 211 212 212 LYS LYS A . n A 1 212 ALA 212 213 213 ALA ALA A . n A 1 213 ILE 213 214 214 ILE ILE A . n A 1 214 LYS 214 215 215 LYS LYS A . n A 1 215 GLN 215 216 216 GLN GLN A . n A 1 216 THR 216 217 217 THR THR A . n A 1 217 LEU 217 218 218 LEU LEU A . n A 1 218 LEU 218 219 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . B 2 HOH 27 2027 2027 HOH HOH A . B 2 HOH 28 2028 2028 HOH HOH A . B 2 HOH 29 2029 2029 HOH HOH A . B 2 HOH 30 2030 2030 HOH HOH A . B 2 HOH 31 2031 2031 HOH HOH A . B 2 HOH 32 2032 2032 HOH HOH A . B 2 HOH 33 2033 2033 HOH HOH A . B 2 HOH 34 2034 2034 HOH HOH A . B 2 HOH 35 2035 2035 HOH HOH A . B 2 HOH 36 2036 2036 HOH HOH A . B 2 HOH 37 2037 2037 HOH HOH A . B 2 HOH 38 2038 2038 HOH HOH A . B 2 HOH 39 2039 2039 HOH HOH A . B 2 HOH 40 2040 2040 HOH HOH A . B 2 HOH 41 2041 2041 HOH HOH A . B 2 HOH 42 2042 2042 HOH HOH A . B 2 HOH 43 2043 2043 HOH HOH A . B 2 HOH 44 2044 2044 HOH HOH A . B 2 HOH 45 2045 2045 HOH HOH A . B 2 HOH 46 2046 2046 HOH HOH A . B 2 HOH 47 2047 2047 HOH HOH A . B 2 HOH 48 2048 2048 HOH HOH A . B 2 HOH 49 2049 2049 HOH HOH A . B 2 HOH 50 2050 2050 HOH HOH A . B 2 HOH 51 2051 2051 HOH HOH A . B 2 HOH 52 2052 2052 HOH HOH A . B 2 HOH 53 2053 2053 HOH HOH A . B 2 HOH 54 2054 2054 HOH HOH A . B 2 HOH 55 2055 2055 HOH HOH A . B 2 HOH 56 2056 2056 HOH HOH A . B 2 HOH 57 2057 2057 HOH HOH A . B 2 HOH 58 2058 2058 HOH HOH A . B 2 HOH 59 2059 2059 HOH HOH A . B 2 HOH 60 2060 2060 HOH HOH A . B 2 HOH 61 2061 2061 HOH HOH A . B 2 HOH 62 2062 2062 HOH HOH A . B 2 HOH 63 2063 2063 HOH HOH A . B 2 HOH 64 2064 2064 HOH HOH A . B 2 HOH 65 2065 2065 HOH HOH A . B 2 HOH 66 2066 2066 HOH HOH A . B 2 HOH 67 2067 2067 HOH HOH A . B 2 HOH 68 2068 2068 HOH HOH A . B 2 HOH 69 2069 2069 HOH HOH A . B 2 HOH 70 2070 2070 HOH HOH A . B 2 HOH 71 2071 2071 HOH HOH A . B 2 HOH 72 2072 2072 HOH HOH A . B 2 HOH 73 2073 2073 HOH HOH A . B 2 HOH 74 2074 2074 HOH HOH A . B 2 HOH 75 2075 2075 HOH HOH A . B 2 HOH 76 2076 2076 HOH HOH A . B 2 HOH 77 2077 2077 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-09 2 'Structure model' 1 1 2014-04-16 3 'Structure model' 1 2 2014-06-18 4 'Structure model' 1 3 2018-01-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category diffrn_source # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_diffrn_source.pdbx_synchrotron_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.7.0032 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 SHELX phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 190 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 N _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ASN _pdbx_validate_close_contact.auth_seq_id_2 191 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.79 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 2025 ? ? 1_555 O A HOH 2069 ? ? 1_556 0.64 2 1 O A HOH 2025 ? ? 1_555 O A HOH 2068 ? ? 1_556 2.13 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A TYR 190 ? ? N A ASN 191 ? ? 0.827 1.336 -0.509 0.023 Y 2 1 C A ASN 191 ? ? N A ASN 192 ? ? 1.114 1.336 -0.222 0.023 Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 191 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 33.85 _pdbx_validate_torsion.psi 52.21 # loop_ _pdbx_validate_polymer_linkage.id _pdbx_validate_polymer_linkage.PDB_model_num _pdbx_validate_polymer_linkage.auth_atom_id_1 _pdbx_validate_polymer_linkage.auth_asym_id_1 _pdbx_validate_polymer_linkage.auth_comp_id_1 _pdbx_validate_polymer_linkage.auth_seq_id_1 _pdbx_validate_polymer_linkage.PDB_ins_code_1 _pdbx_validate_polymer_linkage.label_alt_id_1 _pdbx_validate_polymer_linkage.auth_atom_id_2 _pdbx_validate_polymer_linkage.auth_asym_id_2 _pdbx_validate_polymer_linkage.auth_comp_id_2 _pdbx_validate_polymer_linkage.auth_seq_id_2 _pdbx_validate_polymer_linkage.PDB_ins_code_2 _pdbx_validate_polymer_linkage.label_alt_id_2 _pdbx_validate_polymer_linkage.dist 1 1 C A TYR 190 ? ? N A ASN 191 ? ? 0.83 2 1 C A ASN 191 ? ? N A ASN 192 ? ? 1.11 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 54 ? CG ? A GLN 53 CG 2 1 Y 1 A GLN 54 ? CD ? A GLN 53 CD 3 1 Y 1 A GLN 54 ? OE1 ? A GLN 53 OE1 4 1 Y 1 A GLN 54 ? NE2 ? A GLN 53 NE2 5 1 Y 1 A ASN 106 ? CG ? A ASN 105 CG 6 1 Y 1 A ASN 106 ? OD1 ? A ASN 105 OD1 7 1 Y 1 A ASN 106 ? ND2 ? A ASN 105 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 2 ? A GLY 1 2 1 Y 1 A ALA 3 ? A ALA 2 3 1 Y 1 A MET 4 ? A MET 3 4 1 Y 1 A GLU 48 ? A GLU 47 5 1 Y 1 A GLY 49 ? A GLY 48 6 1 Y 1 A THR 50 ? A THR 49 7 1 Y 1 A PHE 51 ? A PHE 50 8 1 Y 1 A SER 52 ? A SER 51 9 1 Y 1 A ASP 107 ? A ASP 106 10 1 Y 1 A VAL 108 ? A VAL 107 11 1 Y 1 A SER 109 ? A SER 108 12 1 Y 1 A ASN 110 ? A ASN 109 13 1 Y 1 A LEU 219 ? A LEU 218 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #