data_4BJ0 # _entry.id 4BJ0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4BJ0 pdb_00004bj0 10.2210/pdb4bj0/pdb PDBE EBI-56430 ? ? WWPDB D_1290056430 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4BJ0 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2013-04-15 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schantz, L.' 1 ? 'Hakansson, M.' 2 ? 'Logan, D.T.' 3 ? 'Nordberg-Karlsson, E.' 4 ? 'Ohlin, M.' 5 ? # _citation.id primary _citation.title 'Carbohydrate Binding Module Recognition of Xyloglucan Defined by Polar Contacts with Branching Xyloses and Ch-Pi Interactions.' _citation.journal_abbrev Proteins _citation.journal_volume 82 _citation.page_first 3466 _citation.page_last ? _citation.year 2014 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25302425 _citation.pdbx_database_id_DOI 10.1002/PROT.24700 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'von Schantz, L.' 1 ? primary 'Hakansson, M.' 2 ? primary 'Logan, D.T.' 3 ? primary 'Nordberg-Karlsson, E.' 4 ? primary 'Ohlin, M.' 5 ? # _cell.entry_id 4BJ0 _cell.length_a 71.780 _cell.length_b 48.790 _cell.length_c 44.220 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4BJ0 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man XYLANASE 19021.848 1 3.2.1.8 YES ? ? 2 branched man ;alpha-D-xylopyranose-(1-6)-beta-D-glucopyranose-(1-4)-[alpha-D-xylopyranose-(1-6)]beta-D-glucopyranose-(1-4)-[alpha-D-xylopyranose-(1-6)]beta-D-glucopyranose-(1-4)-beta-D-glucopyranose ; 1062.923 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 non-polymer man alpha-D-glucopyranose 180.156 1 ? ? ? ? 5 water nat water 18.015 316 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVR PGVTYTYTIRARAEQDGAVVSFTVGNQSFDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDG LAIVDLAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;LVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVR PGVTYTYTIRARAEQDGAVVSFTVGNQSFDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDG LAIVDLAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 VAL n 1 3 ALA n 1 4 ASN n 1 5 ILE n 1 6 ASN n 1 7 GLY n 1 8 GLY n 1 9 PHE n 1 10 GLU n 1 11 SER n 1 12 THR n 1 13 PRO n 1 14 ALA n 1 15 GLY n 1 16 VAL n 1 17 VAL n 1 18 THR n 1 19 ASP n 1 20 LEU n 1 21 ALA n 1 22 GLU n 1 23 GLY n 1 24 VAL n 1 25 GLU n 1 26 GLY n 1 27 TRP n 1 28 ASP n 1 29 LEU n 1 30 ASN n 1 31 VAL n 1 32 GLY n 1 33 SER n 1 34 SER n 1 35 VAL n 1 36 THR n 1 37 ASN n 1 38 PRO n 1 39 PRO n 1 40 VAL n 1 41 PHE n 1 42 GLU n 1 43 VAL n 1 44 LEU n 1 45 GLU n 1 46 THR n 1 47 SER n 1 48 ASP n 1 49 ALA n 1 50 PRO n 1 51 GLU n 1 52 GLY n 1 53 ASN n 1 54 LYS n 1 55 VAL n 1 56 LEU n 1 57 ALA n 1 58 VAL n 1 59 THR n 1 60 VAL n 1 61 ASN n 1 62 GLY n 1 63 VAL n 1 64 GLY n 1 65 ASN n 1 66 ASN n 1 67 PRO n 1 68 PHE n 1 69 ASN n 1 70 ILE n 1 71 GLN n 1 72 ALA n 1 73 THR n 1 74 ALA n 1 75 LEU n 1 76 PRO n 1 77 VAL n 1 78 ASN n 1 79 VAL n 1 80 ARG n 1 81 PRO n 1 82 GLY n 1 83 VAL n 1 84 THR n 1 85 TYR n 1 86 THR n 1 87 TYR n 1 88 THR n 1 89 ILE n 1 90 ARG n 1 91 ALA n 1 92 ARG n 1 93 ALA n 1 94 GLU n 1 95 GLN n 1 96 ASP n 1 97 GLY n 1 98 ALA n 1 99 VAL n 1 100 VAL n 1 101 SER n 1 102 PHE n 1 103 THR n 1 104 VAL n 1 105 GLY n 1 106 ASN n 1 107 GLN n 1 108 SER n 1 109 PHE n 1 110 ASP n 1 111 GLU n 1 112 TYR n 1 113 GLY n 1 114 ARG n 1 115 LEU n 1 116 HIS n 1 117 HIS n 1 118 GLN n 1 119 GLN n 1 120 ILE n 1 121 THR n 1 122 THR n 1 123 GLU n 1 124 TRP n 1 125 GLN n 1 126 PRO n 1 127 PHE n 1 128 THR n 1 129 PHE n 1 130 GLU n 1 131 PHE n 1 132 THR n 1 133 VAL n 1 134 SER n 1 135 ASP n 1 136 GLN n 1 137 GLU n 1 138 THR n 1 139 VAL n 1 140 ILE n 1 141 ARG n 1 142 ALA n 1 143 PRO n 1 144 ILE n 1 145 HIS n 1 146 PHE n 1 147 GLY n 1 148 TYR n 1 149 ALA n 1 150 ALA n 1 151 ASN n 1 152 VAL n 1 153 GLY n 1 154 ASN n 1 155 THR n 1 156 ILE n 1 157 TYR n 1 158 ILE n 1 159 ASP n 1 160 GLY n 1 161 LEU n 1 162 ALA n 1 163 ILE n 1 164 VAL n 1 165 ASP n 1 166 LEU n 1 167 ALA n 1 168 ALA n 1 169 LEU n 1 170 GLU n 1 171 HIS n 1 172 HIS n 1 173 HIS n 1 174 HIS n 1 175 HIS n 1 176 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'RHODOTHERMUS MARINUS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29549 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant 'T7 EXPRESS' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET22B _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6V8M0_RHOMR _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q6V8M0 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4BJ0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 165 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6V8M0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 165 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 166 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4BJ0 LEU A 166 ? UNP Q6V8M0 ? ? 'expression tag' 167 1 1 4BJ0 ALA A 167 ? UNP Q6V8M0 ? ? 'expression tag' 168 2 1 4BJ0 ALA A 168 ? UNP Q6V8M0 ? ? 'expression tag' 169 3 1 4BJ0 LEU A 169 ? UNP Q6V8M0 ? ? 'expression tag' 170 4 1 4BJ0 GLU A 170 ? UNP Q6V8M0 ? ? 'expression tag' 171 5 1 4BJ0 HIS A 171 ? UNP Q6V8M0 ? ? 'expression tag' 172 6 1 4BJ0 HIS A 172 ? UNP Q6V8M0 ? ? 'expression tag' 173 7 1 4BJ0 HIS A 173 ? UNP Q6V8M0 ? ? 'expression tag' 174 8 1 4BJ0 HIS A 174 ? UNP Q6V8M0 ? ? 'expression tag' 175 9 1 4BJ0 HIS A 175 ? UNP Q6V8M0 ? ? 'expression tag' 176 10 1 4BJ0 HIS A 176 ? UNP Q6V8M0 ? ? 'expression tag' 177 11 1 4BJ0 PHE A 68 ? UNP Q6V8M0 TRP 68 'engineered mutation' 69 12 1 4BJ0 ASN A 69 ? UNP Q6V8M0 ASP 69 'engineered mutation' 70 13 1 4BJ0 GLN A 71 ? UNP Q6V8M0 GLU 71 'engineered mutation' 72 14 1 4BJ0 LEU A 75 ? UNP Q6V8M0 PHE 75 'engineered mutation' 76 15 1 4BJ0 ARG A 90 ? UNP Q6V8M0 TRP 90 'engineered mutation' 91 16 1 4BJ0 ASP A 110 ? UNP Q6V8M0 GLN 110 'engineered mutation' 111 17 1 4BJ0 HIS A 117 ? UNP Q6V8M0 GLU 117 'engineered mutation' 118 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BGC 'D-saccharide, beta linking' . beta-D-glucopyranose 'beta-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose 'alpha-D-glucose; D-glucose; glucose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XYS 'D-saccharide, alpha linking' . alpha-D-xylopyranose 'alpha-D-xylose; D-xylose; xylose; XYLOPYRANOSE' 'C5 H10 O5' 150.130 # _exptl.entry_id 4BJ0 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.2 _exptl_crystal.density_percent_sol 44 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '25 % W/V PEG 1500, 0.1 M MMT BUFFER PH 5.5, 20 MM SPERMINE, 8 MM XXXG' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2011-12-13 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GERMANIUM CRYSTALS' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.04 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'MAX II BEAMLINE I911-2' _diffrn_source.pdbx_synchrotron_site 'MAX II' _diffrn_source.pdbx_synchrotron_beamline I911-2 _diffrn_source.pdbx_wavelength 1.04 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4BJ0 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 44.00 _reflns.d_resolution_high 1.00 _reflns.number_obs 80063 _reflns.number_all ? _reflns.percent_possible_obs 94.7 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 25.50 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.0 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.00 _reflns_shell.d_res_low 1.03 _reflns_shell.percent_possible_all 89.3 _reflns_shell.Rmerge_I_obs 0.72 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.90 _reflns_shell.pdbx_redundancy 6.9 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4BJ0 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 76023 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.22 _refine.ls_d_res_high 1.00 _refine.ls_percent_reflns_obs 94.73 _refine.ls_R_factor_obs 0.11486 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.11408 _refine.ls_R_factor_R_free 0.12931 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 4040 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.981 _refine.correlation_coeff_Fo_to_Fc_free 0.981 _refine.B_iso_mean 14.097 _refine.aniso_B[1][1] -0.21 _refine.aniso_B[2][2] 0.46 _refine.aniso_B[3][3] -0.25 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS AND REFINED INDIVIDUALLY' _refine.pdbx_starting_model 'PDB ENTRY 2Y6H' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.020 _refine.pdbx_overall_ESU_R_Free 0.020 _refine.overall_SU_ML 0.012 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 0.502 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1261 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 85 _refine_hist.number_atoms_solvent 316 _refine_hist.number_atoms_total 1662 _refine_hist.d_res_high 1.00 _refine_hist.d_res_low 44.22 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.027 0.022 ? 1481 'X-RAY DIFFRACTION' ? r_bond_other_d 0.017 0.020 ? 2034 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.238 1.982 ? 2055 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.747 3.000 ? 3476 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 7.634 5.000 ? 198 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.999 25.139 ? 72 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 11.956 15.000 ? 204 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 13.608 15.000 ? 8 'X-RAY DIFFRACTION' ? r_chiral_restr 0.298 0.200 ? 256 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.013 0.021 ? 1711 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.004 0.020 ? 341 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.375 1.500 ? 884 'X-RAY DIFFRACTION' ? r_mcbond_other 1.700 1.500 ? 1000 'X-RAY DIFFRACTION' ? r_mcangle_it 3.543 2.000 ? 1460 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 4.738 3.000 ? 597 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 6.709 4.500 ? 580 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 1.913 3.000 ? 3515 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.000 _refine_ls_shell.d_res_low 1.026 _refine_ls_shell.number_reflns_R_work 5228 _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.percent_reflns_obs 89.29 _refine_ls_shell.R_factor_R_free 0.287 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 280 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 4BJ0 _struct.title 'Xyloglucan binding module (CBM4-2 X2-L110F) in complex with branched xyloses' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4BJ0 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'HYDROLASE, XYLOGLUCAN, CBM4-2, X2 L110F, CH-PI INTERACTION, ENGINEERED CONSTRUCT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 66 ? ASN A 69 ? ASN A 67 ASN A 70 5 ? 4 HELX_P HELX_P2 2 TYR A 148 ? VAL A 152 ? TYR A 149 VAL A 153 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? D GLC . O4 B ? ? 1_555 B BGC . C1 ? ? A GLC 1169 B BGC 2 1_555 ? ? ? ? ? ? ? 1.387 ? ? covale2 covale both ? B BGC . O4 A ? ? 1_555 B BGC . C1 ? ? B BGC 1 B BGC 2 1_555 ? ? ? ? ? ? ? 1.387 ? ? covale3 covale both ? B BGC . O4 ? ? ? 1_555 B BGC . C1 ? ? B BGC 2 B BGC 3 1_555 ? ? ? ? ? ? ? 1.405 ? ? covale4 covale both ? B BGC . O6 ? ? ? 1_555 B XYS . C1 ? ? B BGC 2 B XYS 7 1_555 ? ? ? ? ? ? ? 1.409 ? ? covale5 covale both ? B BGC . O4 ? ? ? 1_555 B BGC . C1 ? ? B BGC 3 B BGC 4 1_555 ? ? ? ? ? ? ? 1.389 ? ? covale6 covale both ? B BGC . O6 ? ? ? 1_555 B XYS . C1 ? ? B BGC 3 B XYS 6 1_555 ? ? ? ? ? ? ? 1.484 ? ? covale7 covale both ? B BGC . O6 ? ? ? 1_555 B XYS . C1 ? ? B BGC 4 B XYS 5 1_555 ? ? ? ? ? ? ? 1.411 ? ? metalc1 metalc ? ? A GLY 8 O ? ? ? 1_555 C CA . CA ? ? A GLY 9 A CA 1167 1_555 ? ? ? ? ? ? ? 2.419 ? ? metalc2 metalc ? ? A GLU 10 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 11 A CA 1167 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc3 metalc ? ? A GLU 51 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 52 A CA 1167 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc4 metalc ? ? A GLU 51 O ? ? ? 1_555 C CA . CA ? ? A GLU 52 A CA 1167 1_555 ? ? ? ? ? ? ? 2.396 ? ? metalc5 metalc ? ? A LYS 54 O ? ? ? 1_555 C CA . CA ? ? A LYS 55 A CA 1167 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc6 metalc ? ? A ASP 159 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 160 A CA 1167 1_555 ? ? ? ? ? ? ? 2.398 ? ? metalc7 metalc ? ? A ASP 159 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 160 A CA 1167 1_555 ? ? ? ? ? ? ? 2.623 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 75 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 76 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 76 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 77 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -13.32 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 6 ? AB ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLY A 15 ? VAL A 16 ? GLY A 16 VAL A 17 AA 2 VAL A 40 ? GLU A 45 ? VAL A 41 GLU A 46 AA 3 LYS A 54 ? THR A 59 ? LYS A 55 THR A 60 AA 4 THR A 155 ? ASP A 165 ? THR A 156 ASP A 166 AA 5 THR A 84 ? ALA A 93 ? THR A 85 ALA A 94 AA 6 GLN A 125 ? THR A 132 ? GLN A 126 THR A 133 AB 1 TRP A 27 ? ASP A 28 ? TRP A 28 ASP A 29 AB 2 GLN A 71 ? ASN A 78 ? GLN A 72 ASN A 79 AB 3 VAL A 139 ? HIS A 145 ? VAL A 140 HIS A 146 AB 4 ALA A 98 ? GLY A 105 ? ALA A 99 GLY A 106 AB 5 GLU A 111 ? ILE A 120 ? GLU A 112 ILE A 121 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N GLY A 15 ? N GLY A 16 O VAL A 43 ? O VAL A 44 AA 2 3 N LEU A 44 ? N LEU A 45 O VAL A 55 ? O VAL A 56 AA 3 4 N VAL A 58 ? N VAL A 59 O ILE A 156 ? O ILE A 157 AA 4 5 N VAL A 164 ? N VAL A 165 O THR A 86 ? O THR A 87 AA 5 6 N ALA A 91 ? N ALA A 92 O GLN A 125 ? O GLN A 126 AB 1 2 N ASP A 28 ? N ASP A 29 O THR A 73 ? O THR A 74 AB 2 3 N VAL A 77 ? N VAL A 78 O ILE A 140 ? O ILE A 141 AB 3 4 N HIS A 145 ? N HIS A 146 O SER A 101 ? O SER A 102 AB 4 5 O VAL A 104 ? O VAL A 105 N TYR A 112 ? N TYR A 113 # _database_PDB_matrix.entry_id 4BJ0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4BJ0 _atom_sites.fract_transf_matrix[1][1] 0.013931 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020496 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022614 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 2 2 LEU LEU A . n A 1 2 VAL 2 3 3 VAL VAL A . n A 1 3 ALA 3 4 4 ALA ALA A . n A 1 4 ASN 4 5 5 ASN ASN A . n A 1 5 ILE 5 6 6 ILE ILE A . n A 1 6 ASN 6 7 7 ASN ASN A . n A 1 7 GLY 7 8 8 GLY GLY A . n A 1 8 GLY 8 9 9 GLY GLY A . n A 1 9 PHE 9 10 10 PHE PHE A . n A 1 10 GLU 10 11 11 GLU GLU A . n A 1 11 SER 11 12 12 SER SER A . n A 1 12 THR 12 13 13 THR THR A . n A 1 13 PRO 13 14 14 PRO PRO A . n A 1 14 ALA 14 15 15 ALA ALA A . n A 1 15 GLY 15 16 16 GLY GLY A . n A 1 16 VAL 16 17 17 VAL VAL A . n A 1 17 VAL 17 18 18 VAL VAL A . n A 1 18 THR 18 19 19 THR THR A . n A 1 19 ASP 19 20 20 ASP ASP A . n A 1 20 LEU 20 21 21 LEU LEU A . n A 1 21 ALA 21 22 22 ALA ALA A . n A 1 22 GLU 22 23 23 GLU GLU A . n A 1 23 GLY 23 24 24 GLY GLY A . n A 1 24 VAL 24 25 25 VAL VAL A . n A 1 25 GLU 25 26 26 GLU GLU A . n A 1 26 GLY 26 27 27 GLY GLY A . n A 1 27 TRP 27 28 28 TRP TRP A . n A 1 28 ASP 28 29 29 ASP ASP A . n A 1 29 LEU 29 30 30 LEU LEU A . n A 1 30 ASN 30 31 31 ASN ASN A . n A 1 31 VAL 31 32 32 VAL VAL A . n A 1 32 GLY 32 33 33 GLY GLY A . n A 1 33 SER 33 34 34 SER SER A . n A 1 34 SER 34 35 35 SER SER A . n A 1 35 VAL 35 36 36 VAL VAL A . n A 1 36 THR 36 37 37 THR THR A . n A 1 37 ASN 37 38 38 ASN ASN A . n A 1 38 PRO 38 39 39 PRO PRO A . n A 1 39 PRO 39 40 40 PRO PRO A . n A 1 40 VAL 40 41 41 VAL VAL A . n A 1 41 PHE 41 42 42 PHE PHE A . n A 1 42 GLU 42 43 43 GLU GLU A . n A 1 43 VAL 43 44 44 VAL VAL A . n A 1 44 LEU 44 45 45 LEU LEU A . n A 1 45 GLU 45 46 46 GLU GLU A . n A 1 46 THR 46 47 47 THR THR A . n A 1 47 SER 47 48 48 SER SER A . n A 1 48 ASP 48 49 49 ASP ASP A . n A 1 49 ALA 49 50 50 ALA ALA A . n A 1 50 PRO 50 51 51 PRO PRO A . n A 1 51 GLU 51 52 52 GLU GLU A . n A 1 52 GLY 52 53 53 GLY GLY A . n A 1 53 ASN 53 54 54 ASN ASN A . n A 1 54 LYS 54 55 55 LYS LYS A . n A 1 55 VAL 55 56 56 VAL VAL A . n A 1 56 LEU 56 57 57 LEU LEU A . n A 1 57 ALA 57 58 58 ALA ALA A . n A 1 58 VAL 58 59 59 VAL VAL A . n A 1 59 THR 59 60 60 THR THR A . n A 1 60 VAL 60 61 61 VAL VAL A . n A 1 61 ASN 61 62 62 ASN ASN A . n A 1 62 GLY 62 63 63 GLY GLY A . n A 1 63 VAL 63 64 64 VAL VAL A . n A 1 64 GLY 64 65 65 GLY GLY A . n A 1 65 ASN 65 66 66 ASN ASN A . n A 1 66 ASN 66 67 67 ASN ASN A . n A 1 67 PRO 67 68 68 PRO PRO A . n A 1 68 PHE 68 69 69 PHE PHE A . n A 1 69 ASN 69 70 70 ASN ASN A . n A 1 70 ILE 70 71 71 ILE ILE A . n A 1 71 GLN 71 72 72 GLN GLN A . n A 1 72 ALA 72 73 73 ALA ALA A . n A 1 73 THR 73 74 74 THR THR A . n A 1 74 ALA 74 75 75 ALA ALA A . n A 1 75 LEU 75 76 76 LEU LEU A . n A 1 76 PRO 76 77 77 PRO PRO A . n A 1 77 VAL 77 78 78 VAL VAL A . n A 1 78 ASN 78 79 79 ASN ASN A . n A 1 79 VAL 79 80 80 VAL VAL A . n A 1 80 ARG 80 81 81 ARG ARG A . n A 1 81 PRO 81 82 82 PRO PRO A . n A 1 82 GLY 82 83 83 GLY GLY A . n A 1 83 VAL 83 84 84 VAL VAL A . n A 1 84 THR 84 85 85 THR THR A . n A 1 85 TYR 85 86 86 TYR TYR A . n A 1 86 THR 86 87 87 THR THR A . n A 1 87 TYR 87 88 88 TYR TYR A . n A 1 88 THR 88 89 89 THR THR A . n A 1 89 ILE 89 90 90 ILE ILE A . n A 1 90 ARG 90 91 91 ARG ARG A . n A 1 91 ALA 91 92 92 ALA ALA A . n A 1 92 ARG 92 93 93 ARG ARG A . n A 1 93 ALA 93 94 94 ALA ALA A . n A 1 94 GLU 94 95 95 GLU GLU A . n A 1 95 GLN 95 96 96 GLN GLN A . n A 1 96 ASP 96 97 97 ASP ASP A . n A 1 97 GLY 97 98 98 GLY GLY A . n A 1 98 ALA 98 99 99 ALA ALA A . n A 1 99 VAL 99 100 100 VAL VAL A . n A 1 100 VAL 100 101 101 VAL VAL A . n A 1 101 SER 101 102 102 SER SER A . n A 1 102 PHE 102 103 103 PHE PHE A . n A 1 103 THR 103 104 104 THR THR A . n A 1 104 VAL 104 105 105 VAL VAL A . n A 1 105 GLY 105 106 106 GLY GLY A . n A 1 106 ASN 106 107 107 ASN ASN A . n A 1 107 GLN 107 108 108 GLN GLN A . n A 1 108 SER 108 109 109 SER SER A . n A 1 109 PHE 109 110 110 PHE PHE A . n A 1 110 ASP 110 111 111 ASP ASP A . n A 1 111 GLU 111 112 112 GLU GLU A . n A 1 112 TYR 112 113 113 TYR TYR A . n A 1 113 GLY 113 114 114 GLY GLY A . n A 1 114 ARG 114 115 115 ARG ARG A . n A 1 115 LEU 115 116 116 LEU LEU A . n A 1 116 HIS 116 117 117 HIS HIS A . n A 1 117 HIS 117 118 118 HIS HIS A . n A 1 118 GLN 118 119 119 GLN GLN A . n A 1 119 GLN 119 120 120 GLN GLN A . n A 1 120 ILE 120 121 121 ILE ILE A . n A 1 121 THR 121 122 122 THR THR A . n A 1 122 THR 122 123 123 THR THR A . n A 1 123 GLU 123 124 124 GLU GLU A . n A 1 124 TRP 124 125 125 TRP TRP A . n A 1 125 GLN 125 126 126 GLN GLN A . n A 1 126 PRO 126 127 127 PRO PRO A . n A 1 127 PHE 127 128 128 PHE PHE A . n A 1 128 THR 128 129 129 THR THR A . n A 1 129 PHE 129 130 130 PHE PHE A . n A 1 130 GLU 130 131 131 GLU GLU A . n A 1 131 PHE 131 132 132 PHE PHE A . n A 1 132 THR 132 133 133 THR THR A . n A 1 133 VAL 133 134 134 VAL VAL A . n A 1 134 SER 134 135 135 SER SER A . n A 1 135 ASP 135 136 136 ASP ASP A . n A 1 136 GLN 136 137 137 GLN GLN A . n A 1 137 GLU 137 138 138 GLU GLU A . n A 1 138 THR 138 139 139 THR THR A . n A 1 139 VAL 139 140 140 VAL VAL A . n A 1 140 ILE 140 141 141 ILE ILE A . n A 1 141 ARG 141 142 142 ARG ARG A . n A 1 142 ALA 142 143 143 ALA ALA A . n A 1 143 PRO 143 144 144 PRO PRO A . n A 1 144 ILE 144 145 145 ILE ILE A . n A 1 145 HIS 145 146 146 HIS HIS A . n A 1 146 PHE 146 147 147 PHE PHE A . n A 1 147 GLY 147 148 148 GLY GLY A . n A 1 148 TYR 148 149 149 TYR TYR A . n A 1 149 ALA 149 150 150 ALA ALA A . n A 1 150 ALA 150 151 151 ALA ALA A . n A 1 151 ASN 151 152 152 ASN ASN A . n A 1 152 VAL 152 153 153 VAL VAL A . n A 1 153 GLY 153 154 154 GLY GLY A . n A 1 154 ASN 154 155 155 ASN ASN A . n A 1 155 THR 155 156 156 THR THR A . n A 1 156 ILE 156 157 157 ILE ILE A . n A 1 157 TYR 157 158 158 TYR TYR A . n A 1 158 ILE 158 159 159 ILE ILE A . n A 1 159 ASP 159 160 160 ASP ASP A . n A 1 160 GLY 160 161 161 GLY GLY A . n A 1 161 LEU 161 162 162 LEU LEU A . n A 1 162 ALA 162 163 163 ALA ALA A . n A 1 163 ILE 163 164 164 ILE ILE A . n A 1 164 VAL 164 165 165 VAL VAL A . n A 1 165 ASP 165 166 166 ASP ASP A . n A 1 166 LEU 166 167 167 LEU LEU A . n A 1 167 ALA 167 168 168 ALA ALA A . n A 1 168 ALA 168 169 ? ? ? A . n A 1 169 LEU 169 170 ? ? ? A . n A 1 170 GLU 170 171 ? ? ? A . n A 1 171 HIS 171 172 ? ? ? A . n A 1 172 HIS 172 173 ? ? ? A . n A 1 173 HIS 173 174 ? ? ? A . n A 1 174 HIS 174 175 ? ? ? A . n A 1 175 HIS 175 176 ? ? ? A . n A 1 176 HIS 176 177 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 1167 1167 CA CA A . D 4 GLC 1 1169 1169 GLC GLC A . E 5 HOH 1 2001 2001 HOH HOH A . E 5 HOH 2 2002 2002 HOH HOH A . E 5 HOH 3 2003 2003 HOH HOH A . E 5 HOH 4 2004 2004 HOH HOH A . E 5 HOH 5 2005 2005 HOH HOH A . E 5 HOH 6 2006 2006 HOH HOH A . E 5 HOH 7 2007 2007 HOH HOH A . E 5 HOH 8 2008 2008 HOH HOH A . E 5 HOH 9 2009 2009 HOH HOH A . E 5 HOH 10 2010 2010 HOH HOH A . E 5 HOH 11 2011 2011 HOH HOH A . E 5 HOH 12 2012 2012 HOH HOH A . E 5 HOH 13 2013 2013 HOH HOH A . E 5 HOH 14 2014 2014 HOH HOH A . E 5 HOH 15 2015 2015 HOH HOH A . E 5 HOH 16 2016 2016 HOH HOH A . E 5 HOH 17 2017 2017 HOH HOH A . E 5 HOH 18 2018 2018 HOH HOH A . E 5 HOH 19 2019 2019 HOH HOH A . E 5 HOH 20 2020 2020 HOH HOH A . E 5 HOH 21 2021 2021 HOH HOH A . E 5 HOH 22 2022 2022 HOH HOH A . E 5 HOH 23 2023 2023 HOH HOH A . E 5 HOH 24 2024 2024 HOH HOH A . E 5 HOH 25 2025 2025 HOH HOH A . E 5 HOH 26 2026 2026 HOH HOH A . E 5 HOH 27 2027 2027 HOH HOH A . E 5 HOH 28 2028 2028 HOH HOH A . E 5 HOH 29 2029 2029 HOH HOH A . E 5 HOH 30 2030 2030 HOH HOH A . E 5 HOH 31 2031 2031 HOH HOH A . E 5 HOH 32 2032 2032 HOH HOH A . E 5 HOH 33 2033 2033 HOH HOH A . E 5 HOH 34 2034 2034 HOH HOH A . E 5 HOH 35 2035 2035 HOH HOH A . E 5 HOH 36 2036 2036 HOH HOH A . E 5 HOH 37 2037 2037 HOH HOH A . E 5 HOH 38 2038 2038 HOH HOH A . E 5 HOH 39 2039 2039 HOH HOH A . E 5 HOH 40 2040 2040 HOH HOH A . E 5 HOH 41 2041 2041 HOH HOH A . E 5 HOH 42 2042 2042 HOH HOH A . E 5 HOH 43 2043 2043 HOH HOH A . E 5 HOH 44 2044 2044 HOH HOH A . E 5 HOH 45 2045 2045 HOH HOH A . E 5 HOH 46 2046 2046 HOH HOH A . E 5 HOH 47 2047 2047 HOH HOH A . E 5 HOH 48 2048 2048 HOH HOH A . E 5 HOH 49 2049 2049 HOH HOH A . E 5 HOH 50 2050 2050 HOH HOH A . E 5 HOH 51 2051 2051 HOH HOH A . E 5 HOH 52 2052 2052 HOH HOH A . E 5 HOH 53 2053 2053 HOH HOH A . E 5 HOH 54 2054 2054 HOH HOH A . E 5 HOH 55 2055 2055 HOH HOH A . E 5 HOH 56 2056 2056 HOH HOH A . E 5 HOH 57 2057 2057 HOH HOH A . E 5 HOH 58 2058 2058 HOH HOH A . E 5 HOH 59 2059 2059 HOH HOH A . E 5 HOH 60 2060 2060 HOH HOH A . E 5 HOH 61 2061 2061 HOH HOH A . E 5 HOH 62 2062 2062 HOH HOH A . E 5 HOH 63 2063 2063 HOH HOH A . E 5 HOH 64 2064 2064 HOH HOH A . E 5 HOH 65 2065 2065 HOH HOH A . E 5 HOH 66 2066 2066 HOH HOH A . E 5 HOH 67 2067 2067 HOH HOH A . E 5 HOH 68 2068 2068 HOH HOH A . E 5 HOH 69 2069 2069 HOH HOH A . E 5 HOH 70 2070 2070 HOH HOH A . E 5 HOH 71 2071 2071 HOH HOH A . E 5 HOH 72 2072 2072 HOH HOH A . E 5 HOH 73 2073 2073 HOH HOH A . E 5 HOH 74 2074 2074 HOH HOH A . E 5 HOH 75 2075 2075 HOH HOH A . E 5 HOH 76 2076 2076 HOH HOH A . E 5 HOH 77 2077 2077 HOH HOH A . E 5 HOH 78 2078 2078 HOH HOH A . E 5 HOH 79 2079 2079 HOH HOH A . E 5 HOH 80 2080 2080 HOH HOH A . E 5 HOH 81 2081 2081 HOH HOH A . E 5 HOH 82 2082 2082 HOH HOH A . E 5 HOH 83 2083 2083 HOH HOH A . E 5 HOH 84 2084 2084 HOH HOH A . E 5 HOH 85 2085 2085 HOH HOH A . E 5 HOH 86 2086 2086 HOH HOH A . E 5 HOH 87 2087 2087 HOH HOH A . E 5 HOH 88 2088 2088 HOH HOH A . E 5 HOH 89 2089 2089 HOH HOH A . E 5 HOH 90 2090 2090 HOH HOH A . E 5 HOH 91 2091 2091 HOH HOH A . E 5 HOH 92 2092 2092 HOH HOH A . E 5 HOH 93 2093 2093 HOH HOH A . E 5 HOH 94 2094 2094 HOH HOH A . E 5 HOH 95 2095 2095 HOH HOH A . E 5 HOH 96 2096 2096 HOH HOH A . E 5 HOH 97 2097 2097 HOH HOH A . E 5 HOH 98 2098 2098 HOH HOH A . E 5 HOH 99 2099 2099 HOH HOH A . E 5 HOH 100 2100 2100 HOH HOH A . E 5 HOH 101 2101 2101 HOH HOH A . E 5 HOH 102 2102 2102 HOH HOH A . E 5 HOH 103 2103 2103 HOH HOH A . E 5 HOH 104 2104 2104 HOH HOH A . E 5 HOH 105 2105 2105 HOH HOH A . E 5 HOH 106 2106 2106 HOH HOH A . E 5 HOH 107 2107 2107 HOH HOH A . E 5 HOH 108 2108 2108 HOH HOH A . E 5 HOH 109 2109 2109 HOH HOH A . E 5 HOH 110 2110 2110 HOH HOH A . E 5 HOH 111 2111 2111 HOH HOH A . E 5 HOH 112 2112 2112 HOH HOH A . E 5 HOH 113 2113 2113 HOH HOH A . E 5 HOH 114 2114 2114 HOH HOH A . E 5 HOH 115 2115 2115 HOH HOH A . E 5 HOH 116 2116 2116 HOH HOH A . E 5 HOH 117 2117 2117 HOH HOH A . E 5 HOH 118 2118 2118 HOH HOH A . E 5 HOH 119 2119 2119 HOH HOH A . E 5 HOH 120 2120 2120 HOH HOH A . E 5 HOH 121 2121 2121 HOH HOH A . E 5 HOH 122 2122 2122 HOH HOH A . E 5 HOH 123 2123 2123 HOH HOH A . E 5 HOH 124 2124 2124 HOH HOH A . E 5 HOH 125 2125 2125 HOH HOH A . E 5 HOH 126 2126 2126 HOH HOH A . E 5 HOH 127 2127 2127 HOH HOH A . E 5 HOH 128 2128 2128 HOH HOH A . E 5 HOH 129 2129 2129 HOH HOH A . E 5 HOH 130 2130 2130 HOH HOH A . E 5 HOH 131 2131 2131 HOH HOH A . E 5 HOH 132 2132 2132 HOH HOH A . E 5 HOH 133 2133 2133 HOH HOH A . E 5 HOH 134 2134 2134 HOH HOH A . E 5 HOH 135 2135 2135 HOH HOH A . E 5 HOH 136 2136 2136 HOH HOH A . E 5 HOH 137 2137 2137 HOH HOH A . E 5 HOH 138 2138 2138 HOH HOH A . E 5 HOH 139 2139 2139 HOH HOH A . E 5 HOH 140 2140 2140 HOH HOH A . E 5 HOH 141 2141 2141 HOH HOH A . E 5 HOH 142 2142 2142 HOH HOH A . E 5 HOH 143 2143 2143 HOH HOH A . E 5 HOH 144 2144 2144 HOH HOH A . E 5 HOH 145 2145 2145 HOH HOH A . E 5 HOH 146 2146 2146 HOH HOH A . E 5 HOH 147 2147 2147 HOH HOH A . E 5 HOH 148 2148 2148 HOH HOH A . E 5 HOH 149 2149 2149 HOH HOH A . E 5 HOH 150 2150 2150 HOH HOH A . E 5 HOH 151 2151 2151 HOH HOH A . E 5 HOH 152 2152 2152 HOH HOH A . E 5 HOH 153 2153 2153 HOH HOH A . E 5 HOH 154 2154 2154 HOH HOH A . E 5 HOH 155 2155 2155 HOH HOH A . E 5 HOH 156 2156 2156 HOH HOH A . E 5 HOH 157 2157 2157 HOH HOH A . E 5 HOH 158 2158 2158 HOH HOH A . E 5 HOH 159 2159 2159 HOH HOH A . E 5 HOH 160 2160 2160 HOH HOH A . E 5 HOH 161 2161 2161 HOH HOH A . E 5 HOH 162 2162 2162 HOH HOH A . E 5 HOH 163 2163 2163 HOH HOH A . E 5 HOH 164 2164 2164 HOH HOH A . E 5 HOH 165 2165 2165 HOH HOH A . E 5 HOH 166 2166 2166 HOH HOH A . E 5 HOH 167 2167 2167 HOH HOH A . E 5 HOH 168 2168 2168 HOH HOH A . E 5 HOH 169 2169 2169 HOH HOH A . E 5 HOH 170 2170 2170 HOH HOH A . E 5 HOH 171 2171 2171 HOH HOH A . E 5 HOH 172 2172 2172 HOH HOH A . E 5 HOH 173 2173 2173 HOH HOH A . E 5 HOH 174 2174 2174 HOH HOH A . E 5 HOH 175 2175 2175 HOH HOH A . E 5 HOH 176 2176 2176 HOH HOH A . E 5 HOH 177 2177 2177 HOH HOH A . E 5 HOH 178 2178 2178 HOH HOH A . E 5 HOH 179 2179 2179 HOH HOH A . E 5 HOH 180 2180 2180 HOH HOH A . E 5 HOH 181 2181 2181 HOH HOH A . E 5 HOH 182 2182 2182 HOH HOH A . E 5 HOH 183 2183 2183 HOH HOH A . E 5 HOH 184 2184 2184 HOH HOH A . E 5 HOH 185 2185 2185 HOH HOH A . E 5 HOH 186 2186 2186 HOH HOH A . E 5 HOH 187 2187 2187 HOH HOH A . E 5 HOH 188 2188 2188 HOH HOH A . E 5 HOH 189 2189 2189 HOH HOH A . E 5 HOH 190 2190 2190 HOH HOH A . E 5 HOH 191 2191 2191 HOH HOH A . E 5 HOH 192 2192 2192 HOH HOH A . E 5 HOH 193 2193 2193 HOH HOH A . E 5 HOH 194 2194 2194 HOH HOH A . E 5 HOH 195 2195 2195 HOH HOH A . E 5 HOH 196 2196 2196 HOH HOH A . E 5 HOH 197 2197 2197 HOH HOH A . E 5 HOH 198 2198 2198 HOH HOH A . E 5 HOH 199 2199 2199 HOH HOH A . E 5 HOH 200 2200 2200 HOH HOH A . E 5 HOH 201 2201 2201 HOH HOH A . E 5 HOH 202 2202 2202 HOH HOH A . E 5 HOH 203 2203 2203 HOH HOH A . E 5 HOH 204 2204 2204 HOH HOH A . E 5 HOH 205 2205 2205 HOH HOH A . E 5 HOH 206 2206 2206 HOH HOH A . E 5 HOH 207 2207 2207 HOH HOH A . E 5 HOH 208 2208 2208 HOH HOH A . E 5 HOH 209 2209 2209 HOH HOH A . E 5 HOH 210 2210 2210 HOH HOH A . E 5 HOH 211 2211 2211 HOH HOH A . E 5 HOH 212 2212 2212 HOH HOH A . E 5 HOH 213 2213 2213 HOH HOH A . E 5 HOH 214 2214 2214 HOH HOH A . E 5 HOH 215 2215 2215 HOH HOH A . E 5 HOH 216 2216 2216 HOH HOH A . E 5 HOH 217 2217 2217 HOH HOH A . E 5 HOH 218 2218 2218 HOH HOH A . E 5 HOH 219 2219 2219 HOH HOH A . E 5 HOH 220 2220 2220 HOH HOH A . E 5 HOH 221 2221 2221 HOH HOH A . E 5 HOH 222 2222 2222 HOH HOH A . E 5 HOH 223 2223 2223 HOH HOH A . E 5 HOH 224 2224 2224 HOH HOH A . E 5 HOH 225 2225 2225 HOH HOH A . E 5 HOH 226 2226 2226 HOH HOH A . E 5 HOH 227 2227 2227 HOH HOH A . E 5 HOH 228 2228 2228 HOH HOH A . E 5 HOH 229 2229 2229 HOH HOH A . E 5 HOH 230 2230 2230 HOH HOH A . E 5 HOH 231 2231 2231 HOH HOH A . E 5 HOH 232 2232 2232 HOH HOH A . E 5 HOH 233 2233 2233 HOH HOH A . E 5 HOH 234 2234 2234 HOH HOH A . E 5 HOH 235 2235 2235 HOH HOH A . E 5 HOH 236 2236 2236 HOH HOH A . E 5 HOH 237 2237 2237 HOH HOH A . E 5 HOH 238 2238 2238 HOH HOH A . E 5 HOH 239 2239 2239 HOH HOH A . E 5 HOH 240 2240 2240 HOH HOH A . E 5 HOH 241 2241 2241 HOH HOH A . E 5 HOH 242 2242 2242 HOH HOH A . E 5 HOH 243 2243 2243 HOH HOH A . E 5 HOH 244 2244 2244 HOH HOH A . E 5 HOH 245 2245 2245 HOH HOH A . E 5 HOH 246 2246 2246 HOH HOH A . E 5 HOH 247 2247 2247 HOH HOH A . E 5 HOH 248 2248 2248 HOH HOH A . E 5 HOH 249 2249 2249 HOH HOH A . E 5 HOH 250 2250 2250 HOH HOH A . E 5 HOH 251 2251 2251 HOH HOH A . E 5 HOH 252 2252 2252 HOH HOH A . E 5 HOH 253 2253 2253 HOH HOH A . E 5 HOH 254 2254 2254 HOH HOH A . E 5 HOH 255 2255 2255 HOH HOH A . E 5 HOH 256 2256 2256 HOH HOH A . E 5 HOH 257 2257 2257 HOH HOH A . E 5 HOH 258 2258 2258 HOH HOH A . E 5 HOH 259 2259 2259 HOH HOH A . E 5 HOH 260 2260 2260 HOH HOH A . E 5 HOH 261 2261 2261 HOH HOH A . E 5 HOH 262 2262 2262 HOH HOH A . E 5 HOH 263 2263 2263 HOH HOH A . E 5 HOH 264 2264 2264 HOH HOH A . E 5 HOH 265 2265 2265 HOH HOH A . E 5 HOH 266 2266 2266 HOH HOH A . E 5 HOH 267 2267 2267 HOH HOH A . E 5 HOH 268 2268 2268 HOH HOH A . E 5 HOH 269 2269 2269 HOH HOH A . E 5 HOH 270 2270 2270 HOH HOH A . E 5 HOH 271 2271 2271 HOH HOH A . E 5 HOH 272 2272 2272 HOH HOH A . E 5 HOH 273 2273 2273 HOH HOH A . E 5 HOH 274 2274 2274 HOH HOH A . E 5 HOH 275 2275 2275 HOH HOH A . E 5 HOH 276 2276 2276 HOH HOH A . E 5 HOH 277 2277 2277 HOH HOH A . E 5 HOH 278 2278 2278 HOH HOH A . E 5 HOH 279 2279 2279 HOH HOH A . E 5 HOH 280 2280 2280 HOH HOH A . E 5 HOH 281 2281 2281 HOH HOH A . E 5 HOH 282 2282 2282 HOH HOH A . E 5 HOH 283 2283 2283 HOH HOH A . E 5 HOH 284 2284 2284 HOH HOH A . E 5 HOH 285 2285 2285 HOH HOH A . E 5 HOH 286 2286 2286 HOH HOH A . E 5 HOH 287 2287 2287 HOH HOH A . E 5 HOH 288 2288 2288 HOH HOH A . E 5 HOH 289 2289 2289 HOH HOH A . E 5 HOH 290 2290 2290 HOH HOH A . E 5 HOH 291 2291 2291 HOH HOH A . E 5 HOH 292 2292 2292 HOH HOH A . E 5 HOH 293 2293 2293 HOH HOH A . E 5 HOH 294 2294 2294 HOH HOH A . E 5 HOH 295 2295 2295 HOH HOH A . E 5 HOH 296 2296 2296 HOH HOH A . E 5 HOH 297 2297 2297 HOH HOH A . E 5 HOH 298 2298 2298 HOH HOH A . E 5 HOH 299 2299 2299 HOH HOH A . E 5 HOH 300 2300 2300 HOH HOH A . E 5 HOH 301 2301 2301 HOH HOH A . E 5 HOH 302 2302 2302 HOH HOH A . E 5 HOH 303 2303 2303 HOH HOH A . E 5 HOH 304 2304 2304 HOH HOH A . E 5 HOH 305 2305 2305 HOH HOH A . E 5 HOH 306 2306 2306 HOH HOH A . E 5 HOH 307 2307 2307 HOH HOH A . E 5 HOH 308 2308 2308 HOH HOH A . E 5 HOH 309 2309 2309 HOH HOH A . E 5 HOH 310 2310 2310 HOH HOH A . E 5 HOH 311 2311 2311 HOH HOH A . E 5 HOH 312 2312 2312 HOH HOH A . E 5 HOH 313 2313 2313 HOH HOH A . E 5 HOH 314 2314 2314 HOH HOH A . E 5 HOH 315 2315 2315 HOH HOH A . E 5 HOH 316 2316 2316 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2183 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLY 8 ? A GLY 9 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OE2 ? A GLU 10 ? A GLU 11 ? 1_555 80.0 ? 2 O ? A GLY 8 ? A GLY 9 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OE2 ? A GLU 51 ? A GLU 52 ? 1_555 88.9 ? 3 OE2 ? A GLU 10 ? A GLU 11 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OE2 ? A GLU 51 ? A GLU 52 ? 1_555 89.3 ? 4 O ? A GLY 8 ? A GLY 9 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 O ? A GLU 51 ? A GLU 52 ? 1_555 157.9 ? 5 OE2 ? A GLU 10 ? A GLU 11 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 O ? A GLU 51 ? A GLU 52 ? 1_555 82.3 ? 6 OE2 ? A GLU 51 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 O ? A GLU 51 ? A GLU 52 ? 1_555 77.7 ? 7 O ? A GLY 8 ? A GLY 9 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 O ? A LYS 54 ? A LYS 55 ? 1_555 86.4 ? 8 OE2 ? A GLU 10 ? A GLU 11 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 O ? A LYS 54 ? A LYS 55 ? 1_555 86.0 ? 9 OE2 ? A GLU 51 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 O ? A LYS 54 ? A LYS 55 ? 1_555 173.9 ? 10 O ? A GLU 51 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 O ? A LYS 54 ? A LYS 55 ? 1_555 105.5 ? 11 O ? A GLY 8 ? A GLY 9 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD1 ? A ASP 159 ? A ASP 160 ? 1_555 77.0 ? 12 OE2 ? A GLU 10 ? A GLU 11 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD1 ? A ASP 159 ? A ASP 160 ? 1_555 156.7 ? 13 OE2 ? A GLU 51 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD1 ? A ASP 159 ? A ASP 160 ? 1_555 94.0 ? 14 O ? A GLU 51 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD1 ? A ASP 159 ? A ASP 160 ? 1_555 121.0 ? 15 O ? A LYS 54 ? A LYS 55 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD1 ? A ASP 159 ? A ASP 160 ? 1_555 88.8 ? 16 O ? A GLY 8 ? A GLY 9 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD2 ? A ASP 159 ? A ASP 160 ? 1_555 127.0 ? 17 OE2 ? A GLU 10 ? A GLU 11 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD2 ? A ASP 159 ? A ASP 160 ? 1_555 148.1 ? 18 OE2 ? A GLU 51 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD2 ? A ASP 159 ? A ASP 160 ? 1_555 106.0 ? 19 O ? A GLU 51 ? A GLU 52 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD2 ? A ASP 159 ? A ASP 160 ? 1_555 74.2 ? 20 O ? A LYS 54 ? A LYS 55 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD2 ? A ASP 159 ? A ASP 160 ? 1_555 80.0 ? 21 OD1 ? A ASP 159 ? A ASP 160 ? 1_555 CA ? C CA . ? A CA 1167 ? 1_555 OD2 ? A ASP 159 ? A ASP 160 ? 1_555 52.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-23 2 'Structure model' 1 1 2014-10-29 3 'Structure model' 1 2 2014-12-03 4 'Structure model' 1 3 2018-01-17 5 'Structure model' 2 0 2020-07-29 6 'Structure model' 2 1 2023-12-20 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 5 'Structure model' 'Atomic model' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' Other 9 5 'Structure model' 'Structure summary' 10 6 'Structure model' 'Data collection' 11 6 'Structure model' 'Database references' 12 6 'Structure model' 'Refinement description' 13 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation_author 2 4 'Structure model' diffrn_source 3 5 'Structure model' atom_site 4 5 'Structure model' atom_site_anisotrop 5 5 'Structure model' chem_comp 6 5 'Structure model' entity 7 5 'Structure model' pdbx_branch_scheme 8 5 'Structure model' pdbx_chem_comp_identifier 9 5 'Structure model' pdbx_database_status 10 5 'Structure model' pdbx_entity_branch 11 5 'Structure model' pdbx_entity_branch_descriptor 12 5 'Structure model' pdbx_entity_branch_link 13 5 'Structure model' pdbx_entity_branch_list 14 5 'Structure model' pdbx_entity_nonpoly 15 5 'Structure model' pdbx_nonpoly_scheme 16 5 'Structure model' pdbx_struct_assembly_gen 17 5 'Structure model' pdbx_struct_conn_angle 18 5 'Structure model' pdbx_struct_special_symmetry 19 5 'Structure model' struct_asym 20 5 'Structure model' struct_conn 21 5 'Structure model' struct_conn_type 22 5 'Structure model' struct_site 23 5 'Structure model' struct_site_gen 24 6 'Structure model' chem_comp 25 6 'Structure model' chem_comp_atom 26 6 'Structure model' chem_comp_bond 27 6 'Structure model' database_2 28 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation_author.name' 2 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 5 'Structure model' '_atom_site.B_iso_or_equiv' 4 5 'Structure model' '_atom_site.Cartn_x' 5 5 'Structure model' '_atom_site.Cartn_y' 6 5 'Structure model' '_atom_site.Cartn_z' 7 5 'Structure model' '_atom_site.auth_asym_id' 8 5 'Structure model' '_atom_site.auth_atom_id' 9 5 'Structure model' '_atom_site.auth_comp_id' 10 5 'Structure model' '_atom_site.auth_seq_id' 11 5 'Structure model' '_atom_site.label_alt_id' 12 5 'Structure model' '_atom_site.label_asym_id' 13 5 'Structure model' '_atom_site.label_atom_id' 14 5 'Structure model' '_atom_site.label_comp_id' 15 5 'Structure model' '_atom_site.label_entity_id' 16 5 'Structure model' '_atom_site.occupancy' 17 5 'Structure model' '_atom_site.type_symbol' 18 5 'Structure model' '_atom_site_anisotrop.U[1][1]' 19 5 'Structure model' '_atom_site_anisotrop.U[1][2]' 20 5 'Structure model' '_atom_site_anisotrop.U[1][3]' 21 5 'Structure model' '_atom_site_anisotrop.U[2][2]' 22 5 'Structure model' '_atom_site_anisotrop.U[2][3]' 23 5 'Structure model' '_atom_site_anisotrop.U[3][3]' 24 5 'Structure model' '_atom_site_anisotrop.pdbx_auth_asym_id' 25 5 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 26 5 'Structure model' '_atom_site_anisotrop.pdbx_auth_comp_id' 27 5 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 28 5 'Structure model' '_atom_site_anisotrop.pdbx_label_alt_id' 29 5 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 30 5 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 31 5 'Structure model' '_atom_site_anisotrop.pdbx_label_comp_id' 32 5 'Structure model' '_atom_site_anisotrop.type_symbol' 33 5 'Structure model' '_chem_comp.name' 34 5 'Structure model' '_chem_comp.type' 35 5 'Structure model' '_pdbx_database_status.status_code_sf' 36 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 37 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 38 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 39 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 40 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 41 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 42 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 43 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 44 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 45 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 46 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 47 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 48 5 'Structure model' '_pdbx_struct_conn_angle.value' 49 5 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 50 5 'Structure model' '_struct_conn.conn_type_id' 51 5 'Structure model' '_struct_conn.id' 52 5 'Structure model' '_struct_conn.pdbx_dist_value' 53 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 54 5 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id' 55 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 56 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 57 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 58 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 59 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 60 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 61 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 62 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 63 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 64 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 65 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 66 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 67 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 68 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 69 5 'Structure model' '_struct_conn_type.id' 70 6 'Structure model' '_chem_comp.pdbx_synonyms' 71 6 'Structure model' '_database_2.pdbx_DOI' 72 6 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.5.0109 ? 1 XDS 'data reduction' . ? 2 XSCALE 'data scaling' . ? 3 PHASER phasing . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2068 ? ? O A HOH 2123 ? ? 2.08 2 1 O A HOH 2301 ? ? O A HOH 2302 ? ? 2.13 3 1 O A HOH 2272 ? ? O A HOH 2274 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 2241 ? ? 1_555 O A HOH 2272 ? ? 3_455 1.84 2 1 OE1 A GLN 96 ? B 1_555 NE2 A GLN 96 ? B 2_555 2.03 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A VAL 3 ? B CG1 A VAL 3 ? B 1.366 1.524 -0.158 0.021 N 2 1 CB A GLU 52 ? ? CG A GLU 52 ? ? 1.332 1.517 -0.185 0.019 N 3 1 CG A GLU 52 ? ? CD A GLU 52 ? ? 1.648 1.515 0.133 0.015 N 4 1 CD A GLU 95 ? ? OE2 A GLU 95 ? ? 1.184 1.252 -0.068 0.011 N 5 1 CA A SER 109 ? A CB A SER 109 ? A 1.618 1.525 0.093 0.015 N 6 1 CD A GLU 112 ? ? OE2 A GLU 112 ? ? 1.175 1.252 -0.077 0.011 N 7 1 CZ A ARG 142 ? B NH1 A ARG 142 ? B 1.440 1.326 0.114 0.013 N 8 1 CZ A ARG 142 ? A NH2 A ARG 142 ? A 1.231 1.326 -0.095 0.013 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG1 A VAL 3 ? B CB A VAL 3 ? B CG2 A VAL 3 ? B 99.36 110.90 -11.54 1.60 N 2 1 CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 124.75 118.30 6.45 0.90 N 3 1 OE1 A GLU 23 ? ? CD A GLU 23 ? ? OE2 A GLU 23 ? ? 113.05 123.30 -10.25 1.20 N 4 1 CB A ASP 29 ? ? CG A ASP 29 ? ? OD1 A ASP 29 ? ? 124.35 118.30 6.05 0.90 N 5 1 NE A ARG 91 ? A CZ A ARG 91 ? A NH1 A ARG 91 ? A 117.09 120.30 -3.21 0.50 N 6 1 NE A ARG 91 ? B CZ A ARG 91 ? B NH1 A ARG 91 ? B 125.20 120.30 4.90 0.50 N 7 1 NE A ARG 91 ? B CZ A ARG 91 ? B NH2 A ARG 91 ? B 111.41 120.30 -8.89 0.50 N 8 1 CB A ASP 97 ? B CG A ASP 97 ? B OD1 A ASP 97 ? B 123.93 118.30 5.63 0.90 N 9 1 O A ASP 97 ? ? C A ASP 97 ? ? N A GLY 98 ? A 112.15 123.20 -11.05 1.70 Y 10 1 NE A ARG 142 ? A CZ A ARG 142 ? A NH1 A ARG 142 ? A 124.26 120.30 3.96 0.50 N 11 1 NE A ARG 142 ? A CZ A ARG 142 ? A NH2 A ARG 142 ? A 115.76 120.30 -4.54 0.50 N 12 1 NE A ARG 142 ? B CZ A ARG 142 ? B NH2 A ARG 142 ? B 117.03 120.30 -3.27 0.50 N 13 1 CB A ASP 166 ? ? CG A ASP 166 ? ? OD2 A ASP 166 ? ? 112.02 118.30 -6.28 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 136 ? ? -119.33 -167.09 2 1 ILE A 141 ? ? -121.51 -167.32 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2022 ? 5.97 . 2 1 O ? A HOH 2316 ? 6.01 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ALA 168 ? CA ? A ALA 167 CA 2 1 Y 1 A ALA 168 ? C ? A ALA 167 C 3 1 Y 1 A ALA 168 ? O ? A ALA 167 O 4 1 Y 1 A ALA 168 ? CB ? A ALA 167 CB # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 169 ? A ALA 168 2 1 Y 1 A LEU 170 ? A LEU 169 3 1 Y 1 A GLU 171 ? A GLU 170 4 1 Y 1 A HIS 172 ? A HIS 171 5 1 Y 1 A HIS 173 ? A HIS 172 6 1 Y 1 A HIS 174 ? A HIS 173 7 1 Y 1 A HIS 175 ? A HIS 174 8 1 Y 1 A HIS 176 ? A HIS 175 9 1 Y 1 A HIS 177 ? A HIS 176 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BGC C2 C N R 74 BGC C3 C N S 75 BGC C4 C N S 76 BGC C5 C N R 77 BGC C6 C N N 78 BGC C1 C N R 79 BGC O1 O N N 80 BGC O2 O N N 81 BGC O3 O N N 82 BGC O4 O N N 83 BGC O5 O N N 84 BGC O6 O N N 85 BGC H2 H N N 86 BGC H3 H N N 87 BGC H4 H N N 88 BGC H5 H N N 89 BGC H61 H N N 90 BGC H62 H N N 91 BGC H1 H N N 92 BGC HO1 H N N 93 BGC HO2 H N N 94 BGC HO3 H N N 95 BGC HO4 H N N 96 BGC HO6 H N N 97 CA CA CA N N 98 GLC C1 C N S 99 GLC C2 C N R 100 GLC C3 C N S 101 GLC C4 C N S 102 GLC C5 C N R 103 GLC C6 C N N 104 GLC O1 O N N 105 GLC O2 O N N 106 GLC O3 O N N 107 GLC O4 O N N 108 GLC O5 O N N 109 GLC O6 O N N 110 GLC H1 H N N 111 GLC H2 H N N 112 GLC H3 H N N 113 GLC H4 H N N 114 GLC H5 H N N 115 GLC H61 H N N 116 GLC H62 H N N 117 GLC HO1 H N N 118 GLC HO2 H N N 119 GLC HO3 H N N 120 GLC HO4 H N N 121 GLC HO6 H N N 122 GLN N N N N 123 GLN CA C N S 124 GLN C C N N 125 GLN O O N N 126 GLN CB C N N 127 GLN CG C N N 128 GLN CD C N N 129 GLN OE1 O N N 130 GLN NE2 N N N 131 GLN OXT O N N 132 GLN H H N N 133 GLN H2 H N N 134 GLN HA H N N 135 GLN HB2 H N N 136 GLN HB3 H N N 137 GLN HG2 H N N 138 GLN HG3 H N N 139 GLN HE21 H N N 140 GLN HE22 H N N 141 GLN HXT H N N 142 GLU N N N N 143 GLU CA C N S 144 GLU C C N N 145 GLU O O N N 146 GLU CB C N N 147 GLU CG C N N 148 GLU CD C N N 149 GLU OE1 O N N 150 GLU OE2 O N N 151 GLU OXT O N N 152 GLU H H N N 153 GLU H2 H N N 154 GLU HA H N N 155 GLU HB2 H N N 156 GLU HB3 H N N 157 GLU HG2 H N N 158 GLU HG3 H N N 159 GLU HE2 H N N 160 GLU HXT H N N 161 GLY N N N N 162 GLY CA C N N 163 GLY C C N N 164 GLY O O N N 165 GLY OXT O N N 166 GLY H H N N 167 GLY H2 H N N 168 GLY HA2 H N N 169 GLY HA3 H N N 170 GLY HXT H N N 171 HIS N N N N 172 HIS CA C N S 173 HIS C C N N 174 HIS O O N N 175 HIS CB C N N 176 HIS CG C Y N 177 HIS ND1 N Y N 178 HIS CD2 C Y N 179 HIS CE1 C Y N 180 HIS NE2 N Y N 181 HIS OXT O N N 182 HIS H H N N 183 HIS H2 H N N 184 HIS HA H N N 185 HIS HB2 H N N 186 HIS HB3 H N N 187 HIS HD1 H N N 188 HIS HD2 H N N 189 HIS HE1 H N N 190 HIS HE2 H N N 191 HIS HXT H N N 192 HOH O O N N 193 HOH H1 H N N 194 HOH H2 H N N 195 ILE N N N N 196 ILE CA C N S 197 ILE C C N N 198 ILE O O N N 199 ILE CB C N S 200 ILE CG1 C N N 201 ILE CG2 C N N 202 ILE CD1 C N N 203 ILE OXT O N N 204 ILE H H N N 205 ILE H2 H N N 206 ILE HA H N N 207 ILE HB H N N 208 ILE HG12 H N N 209 ILE HG13 H N N 210 ILE HG21 H N N 211 ILE HG22 H N N 212 ILE HG23 H N N 213 ILE HD11 H N N 214 ILE HD12 H N N 215 ILE HD13 H N N 216 ILE HXT H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 PHE N N N N 265 PHE CA C N S 266 PHE C C N N 267 PHE O O N N 268 PHE CB C N N 269 PHE CG C Y N 270 PHE CD1 C Y N 271 PHE CD2 C Y N 272 PHE CE1 C Y N 273 PHE CE2 C Y N 274 PHE CZ C Y N 275 PHE OXT O N N 276 PHE H H N N 277 PHE H2 H N N 278 PHE HA H N N 279 PHE HB2 H N N 280 PHE HB3 H N N 281 PHE HD1 H N N 282 PHE HD2 H N N 283 PHE HE1 H N N 284 PHE HE2 H N N 285 PHE HZ H N N 286 PHE HXT H N N 287 PRO N N N N 288 PRO CA C N S 289 PRO C C N N 290 PRO O O N N 291 PRO CB C N N 292 PRO CG C N N 293 PRO CD C N N 294 PRO OXT O N N 295 PRO H H N N 296 PRO HA H N N 297 PRO HB2 H N N 298 PRO HB3 H N N 299 PRO HG2 H N N 300 PRO HG3 H N N 301 PRO HD2 H N N 302 PRO HD3 H N N 303 PRO HXT H N N 304 SER N N N N 305 SER CA C N S 306 SER C C N N 307 SER O O N N 308 SER CB C N N 309 SER OG O N N 310 SER OXT O N N 311 SER H H N N 312 SER H2 H N N 313 SER HA H N N 314 SER HB2 H N N 315 SER HB3 H N N 316 SER HG H N N 317 SER HXT H N N 318 THR N N N N 319 THR CA C N S 320 THR C C N N 321 THR O O N N 322 THR CB C N R 323 THR OG1 O N N 324 THR CG2 C N N 325 THR OXT O N N 326 THR H H N N 327 THR H2 H N N 328 THR HA H N N 329 THR HB H N N 330 THR HG1 H N N 331 THR HG21 H N N 332 THR HG22 H N N 333 THR HG23 H N N 334 THR HXT H N N 335 TRP N N N N 336 TRP CA C N S 337 TRP C C N N 338 TRP O O N N 339 TRP CB C N N 340 TRP CG C Y N 341 TRP CD1 C Y N 342 TRP CD2 C Y N 343 TRP NE1 N Y N 344 TRP CE2 C Y N 345 TRP CE3 C Y N 346 TRP CZ2 C Y N 347 TRP CZ3 C Y N 348 TRP CH2 C Y N 349 TRP OXT O N N 350 TRP H H N N 351 TRP H2 H N N 352 TRP HA H N N 353 TRP HB2 H N N 354 TRP HB3 H N N 355 TRP HD1 H N N 356 TRP HE1 H N N 357 TRP HE3 H N N 358 TRP HZ2 H N N 359 TRP HZ3 H N N 360 TRP HH2 H N N 361 TRP HXT H N N 362 TYR N N N N 363 TYR CA C N S 364 TYR C C N N 365 TYR O O N N 366 TYR CB C N N 367 TYR CG C Y N 368 TYR CD1 C Y N 369 TYR CD2 C Y N 370 TYR CE1 C Y N 371 TYR CE2 C Y N 372 TYR CZ C Y N 373 TYR OH O N N 374 TYR OXT O N N 375 TYR H H N N 376 TYR H2 H N N 377 TYR HA H N N 378 TYR HB2 H N N 379 TYR HB3 H N N 380 TYR HD1 H N N 381 TYR HD2 H N N 382 TYR HE1 H N N 383 TYR HE2 H N N 384 TYR HH H N N 385 TYR HXT H N N 386 VAL N N N N 387 VAL CA C N S 388 VAL C C N N 389 VAL O O N N 390 VAL CB C N N 391 VAL CG1 C N N 392 VAL CG2 C N N 393 VAL OXT O N N 394 VAL H H N N 395 VAL H2 H N N 396 VAL HA H N N 397 VAL HB H N N 398 VAL HG11 H N N 399 VAL HG12 H N N 400 VAL HG13 H N N 401 VAL HG21 H N N 402 VAL HG22 H N N 403 VAL HG23 H N N 404 VAL HXT H N N 405 XYS C1 C N S 406 XYS C2 C N R 407 XYS C3 C N S 408 XYS C4 C N R 409 XYS C5 C N N 410 XYS O1 O N N 411 XYS O2 O N N 412 XYS O3 O N N 413 XYS O4 O N N 414 XYS O5 O N N 415 XYS H1 H N N 416 XYS H2 H N N 417 XYS H3 H N N 418 XYS H4 H N N 419 XYS H51 H N N 420 XYS H52 H N N 421 XYS HO1 H N N 422 XYS HO2 H N N 423 XYS HO3 H N N 424 XYS HO4 H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BGC C2 C3 sing N N 70 BGC C2 C1 sing N N 71 BGC C2 O2 sing N N 72 BGC C2 H2 sing N N 73 BGC C3 C4 sing N N 74 BGC C3 O3 sing N N 75 BGC C3 H3 sing N N 76 BGC C4 C5 sing N N 77 BGC C4 O4 sing N N 78 BGC C4 H4 sing N N 79 BGC C5 C6 sing N N 80 BGC C5 O5 sing N N 81 BGC C5 H5 sing N N 82 BGC C6 O6 sing N N 83 BGC C6 H61 sing N N 84 BGC C6 H62 sing N N 85 BGC C1 O1 sing N N 86 BGC C1 O5 sing N N 87 BGC C1 H1 sing N N 88 BGC O1 HO1 sing N N 89 BGC O2 HO2 sing N N 90 BGC O3 HO3 sing N N 91 BGC O4 HO4 sing N N 92 BGC O6 HO6 sing N N 93 GLC C1 C2 sing N N 94 GLC C1 O1 sing N N 95 GLC C1 O5 sing N N 96 GLC C1 H1 sing N N 97 GLC C2 C3 sing N N 98 GLC C2 O2 sing N N 99 GLC C2 H2 sing N N 100 GLC C3 C4 sing N N 101 GLC C3 O3 sing N N 102 GLC C3 H3 sing N N 103 GLC C4 C5 sing N N 104 GLC C4 O4 sing N N 105 GLC C4 H4 sing N N 106 GLC C5 C6 sing N N 107 GLC C5 O5 sing N N 108 GLC C5 H5 sing N N 109 GLC C6 O6 sing N N 110 GLC C6 H61 sing N N 111 GLC C6 H62 sing N N 112 GLC O1 HO1 sing N N 113 GLC O2 HO2 sing N N 114 GLC O3 HO3 sing N N 115 GLC O4 HO4 sing N N 116 GLC O6 HO6 sing N N 117 GLN N CA sing N N 118 GLN N H sing N N 119 GLN N H2 sing N N 120 GLN CA C sing N N 121 GLN CA CB sing N N 122 GLN CA HA sing N N 123 GLN C O doub N N 124 GLN C OXT sing N N 125 GLN CB CG sing N N 126 GLN CB HB2 sing N N 127 GLN CB HB3 sing N N 128 GLN CG CD sing N N 129 GLN CG HG2 sing N N 130 GLN CG HG3 sing N N 131 GLN CD OE1 doub N N 132 GLN CD NE2 sing N N 133 GLN NE2 HE21 sing N N 134 GLN NE2 HE22 sing N N 135 GLN OXT HXT sing N N 136 GLU N CA sing N N 137 GLU N H sing N N 138 GLU N H2 sing N N 139 GLU CA C sing N N 140 GLU CA CB sing N N 141 GLU CA HA sing N N 142 GLU C O doub N N 143 GLU C OXT sing N N 144 GLU CB CG sing N N 145 GLU CB HB2 sing N N 146 GLU CB HB3 sing N N 147 GLU CG CD sing N N 148 GLU CG HG2 sing N N 149 GLU CG HG3 sing N N 150 GLU CD OE1 doub N N 151 GLU CD OE2 sing N N 152 GLU OE2 HE2 sing N N 153 GLU OXT HXT sing N N 154 GLY N CA sing N N 155 GLY N H sing N N 156 GLY N H2 sing N N 157 GLY CA C sing N N 158 GLY CA HA2 sing N N 159 GLY CA HA3 sing N N 160 GLY C O doub N N 161 GLY C OXT sing N N 162 GLY OXT HXT sing N N 163 HIS N CA sing N N 164 HIS N H sing N N 165 HIS N H2 sing N N 166 HIS CA C sing N N 167 HIS CA CB sing N N 168 HIS CA HA sing N N 169 HIS C O doub N N 170 HIS C OXT sing N N 171 HIS CB CG sing N N 172 HIS CB HB2 sing N N 173 HIS CB HB3 sing N N 174 HIS CG ND1 sing Y N 175 HIS CG CD2 doub Y N 176 HIS ND1 CE1 doub Y N 177 HIS ND1 HD1 sing N N 178 HIS CD2 NE2 sing Y N 179 HIS CD2 HD2 sing N N 180 HIS CE1 NE2 sing Y N 181 HIS CE1 HE1 sing N N 182 HIS NE2 HE2 sing N N 183 HIS OXT HXT sing N N 184 HOH O H1 sing N N 185 HOH O H2 sing N N 186 ILE N CA sing N N 187 ILE N H sing N N 188 ILE N H2 sing N N 189 ILE CA C sing N N 190 ILE CA CB sing N N 191 ILE CA HA sing N N 192 ILE C O doub N N 193 ILE C OXT sing N N 194 ILE CB CG1 sing N N 195 ILE CB CG2 sing N N 196 ILE CB HB sing N N 197 ILE CG1 CD1 sing N N 198 ILE CG1 HG12 sing N N 199 ILE CG1 HG13 sing N N 200 ILE CG2 HG21 sing N N 201 ILE CG2 HG22 sing N N 202 ILE CG2 HG23 sing N N 203 ILE CD1 HD11 sing N N 204 ILE CD1 HD12 sing N N 205 ILE CD1 HD13 sing N N 206 ILE OXT HXT sing N N 207 LEU N CA sing N N 208 LEU N H sing N N 209 LEU N H2 sing N N 210 LEU CA C sing N N 211 LEU CA CB sing N N 212 LEU CA HA sing N N 213 LEU C O doub N N 214 LEU C OXT sing N N 215 LEU CB CG sing N N 216 LEU CB HB2 sing N N 217 LEU CB HB3 sing N N 218 LEU CG CD1 sing N N 219 LEU CG CD2 sing N N 220 LEU CG HG sing N N 221 LEU CD1 HD11 sing N N 222 LEU CD1 HD12 sing N N 223 LEU CD1 HD13 sing N N 224 LEU CD2 HD21 sing N N 225 LEU CD2 HD22 sing N N 226 LEU CD2 HD23 sing N N 227 LEU OXT HXT sing N N 228 LYS N CA sing N N 229 LYS N H sing N N 230 LYS N H2 sing N N 231 LYS CA C sing N N 232 LYS CA CB sing N N 233 LYS CA HA sing N N 234 LYS C O doub N N 235 LYS C OXT sing N N 236 LYS CB CG sing N N 237 LYS CB HB2 sing N N 238 LYS CB HB3 sing N N 239 LYS CG CD sing N N 240 LYS CG HG2 sing N N 241 LYS CG HG3 sing N N 242 LYS CD CE sing N N 243 LYS CD HD2 sing N N 244 LYS CD HD3 sing N N 245 LYS CE NZ sing N N 246 LYS CE HE2 sing N N 247 LYS CE HE3 sing N N 248 LYS NZ HZ1 sing N N 249 LYS NZ HZ2 sing N N 250 LYS NZ HZ3 sing N N 251 LYS OXT HXT sing N N 252 PHE N CA sing N N 253 PHE N H sing N N 254 PHE N H2 sing N N 255 PHE CA C sing N N 256 PHE CA CB sing N N 257 PHE CA HA sing N N 258 PHE C O doub N N 259 PHE C OXT sing N N 260 PHE CB CG sing N N 261 PHE CB HB2 sing N N 262 PHE CB HB3 sing N N 263 PHE CG CD1 doub Y N 264 PHE CG CD2 sing Y N 265 PHE CD1 CE1 sing Y N 266 PHE CD1 HD1 sing N N 267 PHE CD2 CE2 doub Y N 268 PHE CD2 HD2 sing N N 269 PHE CE1 CZ doub Y N 270 PHE CE1 HE1 sing N N 271 PHE CE2 CZ sing Y N 272 PHE CE2 HE2 sing N N 273 PHE CZ HZ sing N N 274 PHE OXT HXT sing N N 275 PRO N CA sing N N 276 PRO N CD sing N N 277 PRO N H sing N N 278 PRO CA C sing N N 279 PRO CA CB sing N N 280 PRO CA HA sing N N 281 PRO C O doub N N 282 PRO C OXT sing N N 283 PRO CB CG sing N N 284 PRO CB HB2 sing N N 285 PRO CB HB3 sing N N 286 PRO CG CD sing N N 287 PRO CG HG2 sing N N 288 PRO CG HG3 sing N N 289 PRO CD HD2 sing N N 290 PRO CD HD3 sing N N 291 PRO OXT HXT sing N N 292 SER N CA sing N N 293 SER N H sing N N 294 SER N H2 sing N N 295 SER CA C sing N N 296 SER CA CB sing N N 297 SER CA HA sing N N 298 SER C O doub N N 299 SER C OXT sing N N 300 SER CB OG sing N N 301 SER CB HB2 sing N N 302 SER CB HB3 sing N N 303 SER OG HG sing N N 304 SER OXT HXT sing N N 305 THR N CA sing N N 306 THR N H sing N N 307 THR N H2 sing N N 308 THR CA C sing N N 309 THR CA CB sing N N 310 THR CA HA sing N N 311 THR C O doub N N 312 THR C OXT sing N N 313 THR CB OG1 sing N N 314 THR CB CG2 sing N N 315 THR CB HB sing N N 316 THR OG1 HG1 sing N N 317 THR CG2 HG21 sing N N 318 THR CG2 HG22 sing N N 319 THR CG2 HG23 sing N N 320 THR OXT HXT sing N N 321 TRP N CA sing N N 322 TRP N H sing N N 323 TRP N H2 sing N N 324 TRP CA C sing N N 325 TRP CA CB sing N N 326 TRP CA HA sing N N 327 TRP C O doub N N 328 TRP C OXT sing N N 329 TRP CB CG sing N N 330 TRP CB HB2 sing N N 331 TRP CB HB3 sing N N 332 TRP CG CD1 doub Y N 333 TRP CG CD2 sing Y N 334 TRP CD1 NE1 sing Y N 335 TRP CD1 HD1 sing N N 336 TRP CD2 CE2 doub Y N 337 TRP CD2 CE3 sing Y N 338 TRP NE1 CE2 sing Y N 339 TRP NE1 HE1 sing N N 340 TRP CE2 CZ2 sing Y N 341 TRP CE3 CZ3 doub Y N 342 TRP CE3 HE3 sing N N 343 TRP CZ2 CH2 doub Y N 344 TRP CZ2 HZ2 sing N N 345 TRP CZ3 CH2 sing Y N 346 TRP CZ3 HZ3 sing N N 347 TRP CH2 HH2 sing N N 348 TRP OXT HXT sing N N 349 TYR N CA sing N N 350 TYR N H sing N N 351 TYR N H2 sing N N 352 TYR CA C sing N N 353 TYR CA CB sing N N 354 TYR CA HA sing N N 355 TYR C O doub N N 356 TYR C OXT sing N N 357 TYR CB CG sing N N 358 TYR CB HB2 sing N N 359 TYR CB HB3 sing N N 360 TYR CG CD1 doub Y N 361 TYR CG CD2 sing Y N 362 TYR CD1 CE1 sing Y N 363 TYR CD1 HD1 sing N N 364 TYR CD2 CE2 doub Y N 365 TYR CD2 HD2 sing N N 366 TYR CE1 CZ doub Y N 367 TYR CE1 HE1 sing N N 368 TYR CE2 CZ sing Y N 369 TYR CE2 HE2 sing N N 370 TYR CZ OH sing N N 371 TYR OH HH sing N N 372 TYR OXT HXT sing N N 373 VAL N CA sing N N 374 VAL N H sing N N 375 VAL N H2 sing N N 376 VAL CA C sing N N 377 VAL CA CB sing N N 378 VAL CA HA sing N N 379 VAL C O doub N N 380 VAL C OXT sing N N 381 VAL CB CG1 sing N N 382 VAL CB CG2 sing N N 383 VAL CB HB sing N N 384 VAL CG1 HG11 sing N N 385 VAL CG1 HG12 sing N N 386 VAL CG1 HG13 sing N N 387 VAL CG2 HG21 sing N N 388 VAL CG2 HG22 sing N N 389 VAL CG2 HG23 sing N N 390 VAL OXT HXT sing N N 391 XYS C1 C2 sing N N 392 XYS C1 O1 sing N N 393 XYS C1 O5 sing N N 394 XYS C1 H1 sing N N 395 XYS C2 C3 sing N N 396 XYS C2 O2 sing N N 397 XYS C2 H2 sing N N 398 XYS C3 C4 sing N N 399 XYS C3 O3 sing N N 400 XYS C3 H3 sing N N 401 XYS C4 C5 sing N N 402 XYS C4 O4 sing N N 403 XYS C4 H4 sing N N 404 XYS C5 O5 sing N N 405 XYS C5 H51 sing N N 406 XYS C5 H52 sing N N 407 XYS O1 HO1 sing N N 408 XYS O2 HO2 sing N N 409 XYS O3 HO3 sing N N 410 XYS O4 HO4 sing N N 411 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BGC 1 B BGC 1 A BGC 1168 n B 2 BGC 2 B BGC 2 A BGC 1170 n B 2 BGC 3 B BGC 3 A BGC 1171 n B 2 BGC 4 B BGC 4 A BGC 1172 n B 2 XYS 5 B XYS 5 A XYS 1175 n B 2 XYS 6 B XYS 6 A XYS 1174 n B 2 XYS 7 B XYS 7 A XYS 1173 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpb BGC 'COMMON NAME' GMML 1.0 b-D-glucopyranose BGC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Glcp BGC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpa GLC 'COMMON NAME' GMML 1.0 a-D-glucopyranose GLC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Glcp GLC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc XYS 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DXylpa XYS 'COMMON NAME' GMML 1.0 a-D-xylopyranose XYS 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Xylp XYS 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Xyl # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'DXylpa1-6DGlcpb1-4[DXylpa1-6]DGlcpb1-4[DXylpa1-6]DGlcpb1-4DGlcpb1-ROH' 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,7,6/[a2122h-1b_1-5][a212h-1a_1-5]/1-1-1-1-2-2-2/a4-b1_b4-c1_b6-g1_c4-d1_c6-f1_d6-e1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Glcp]{[(4+1)][b-D-Glcp]{[(4+1)][b-D-Glcp]{[(4+1)][b-D-Glcp]{[(6+1)][a-D-Xylp]{}}[(6+1)][a-D-Xylp]{}}[(6+1)][a-D-Xylp]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 BGC C1 O1 1 BGC O4 HO4 sing ? 2 2 3 BGC C1 O1 2 BGC O4 HO4 sing ? 3 2 4 BGC C1 O1 3 BGC O4 HO4 sing ? 4 2 5 XYS C1 O1 4 BGC O6 HO6 sing ? 5 2 6 XYS C1 O1 3 BGC O6 HO6 sing ? 6 2 7 XYS C1 O1 2 BGC O6 HO6 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BGC 1 n 2 BGC 2 n 2 BGC 3 n 2 BGC 4 n 2 XYS 5 n 2 XYS 6 n 2 XYS 7 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 alpha-D-glucopyranose GLC 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2Y6H _pdbx_initial_refinement_model.details 'PDB ENTRY 2Y6H' #