data_4BZO # _entry.id 4BZO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4BZO PDBE EBI-57839 WWPDB D_1290057839 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4BZN _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'CRYSTAL STRUCTURE OF PIM1 IN COMPLEX WITH A PYRROLO( 1,2-A)PYRAZINONE INHIBITOR' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4BZO _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2013-07-29 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Casale, E.' 1 'Casuscelli, F.' 2 'Ardini, E.' 3 'Avanzi, N.' 4 'Cervi, G.' 5 ;D'Anello, M. ; 6 'Donati, D.' 7 'Faiardi, D.' 8 'Ferguson, R.D.' 9 'Fogliatto, G.' 10 'Galvani, A.' 11 'Marsiglio, A.' 12 'Mirizzi, D.G.' 13 'Montemartini, M.' 14 'Orrenius, C.' 15 'Papeo, G.' 16 'Piutti, C.' 17 'Salom, B.' 18 'Felder, E.R.' 19 # _citation.id primary _citation.title 'Discovery and Optimization of Pyrrolo[1,2-A]Pyrazinones Leads to Novel and Selective Inhibitors of Pim Kinases.' _citation.journal_abbrev Bioorg.Med.Chem. _citation.journal_volume 21 _citation.page_first 7364 _citation.page_last ? _citation.year 2013 _citation.journal_id_ASTM BMECEP _citation.country UK _citation.journal_id_ISSN 0968-0896 _citation.journal_id_CSD 1200 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24139169 _citation.pdbx_database_id_DOI 10.1016/J.BMC.2013.09.054 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Casuscelli, F.' 1 primary 'Ardini, E.' 2 primary 'Avanzi, N.' 3 primary 'Casale, E.' 4 primary 'Cervi, G.' 5 primary ;D'Anello, M. ; 6 primary 'Donati, D.' 7 primary 'Faiardi, D.' 8 primary 'Ferguson, R.D.' 9 primary 'Fogliatto, G.' 10 primary 'Galvani, A.' 11 primary 'Marsiglio, A.' 12 primary 'Mirizzi, D.G.' 13 primary 'Montemartini, M.' 14 primary 'Orrenius, C.' 15 primary 'Papeo, G.' 16 primary 'Piutti, C.' 17 primary 'Salom, B.' 18 primary 'Felder, E.R.' 19 # _cell.entry_id 4BZO _cell.length_a 97.932 _cell.length_b 97.932 _cell.length_c 81.431 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4BZO _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SERINE/THREONINE-PROTEIN KINASE PIM-1' 35835.691 1 2.7.11.1 ? 'KINASE DOMAIN, RESIDUES 2-313' ? 2 non-polymer syn 'N-[(1S)-2-AMINO-1-PHENYLETHYL]-2-[(4S)-7-(2-FLUORO-4-PYRIDINYL)-1-OXO-1,2,3,4-TETRAHYDROPYRROLO[1,2-A]PYRAZIN-4-YL]ACETAMIDE' 407.441 1 ? ? ? ? 3 water nat water 18.015 135 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PROTO-ONCOGENE SERINE THREONINE-PROTEIN KINASE PIM-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GPLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD IPFEHDEEIIRGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD IPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 LEU n 1 5 SER n 1 6 LYS n 1 7 ILE n 1 8 ASN n 1 9 SER n 1 10 LEU n 1 11 ALA n 1 12 HIS n 1 13 LEU n 1 14 ARG n 1 15 ALA n 1 16 ALA n 1 17 PRO n 1 18 CYS n 1 19 ASN n 1 20 ASP n 1 21 LEU n 1 22 HIS n 1 23 ALA n 1 24 THR n 1 25 LYS n 1 26 LEU n 1 27 ALA n 1 28 PRO n 1 29 GLY n 1 30 LYS n 1 31 GLU n 1 32 LYS n 1 33 GLU n 1 34 PRO n 1 35 LEU n 1 36 GLU n 1 37 SER n 1 38 GLN n 1 39 TYR n 1 40 GLN n 1 41 VAL n 1 42 GLY n 1 43 PRO n 1 44 LEU n 1 45 LEU n 1 46 GLY n 1 47 SER n 1 48 GLY n 1 49 GLY n 1 50 PHE n 1 51 GLY n 1 52 SER n 1 53 VAL n 1 54 TYR n 1 55 SER n 1 56 GLY n 1 57 ILE n 1 58 ARG n 1 59 VAL n 1 60 SER n 1 61 ASP n 1 62 ASN n 1 63 LEU n 1 64 PRO n 1 65 VAL n 1 66 ALA n 1 67 ILE n 1 68 LYS n 1 69 HIS n 1 70 VAL n 1 71 GLU n 1 72 LYS n 1 73 ASP n 1 74 ARG n 1 75 ILE n 1 76 SER n 1 77 ASP n 1 78 TRP n 1 79 GLY n 1 80 GLU n 1 81 LEU n 1 82 PRO n 1 83 ASN n 1 84 GLY n 1 85 THR n 1 86 ARG n 1 87 VAL n 1 88 PRO n 1 89 MET n 1 90 GLU n 1 91 VAL n 1 92 VAL n 1 93 LEU n 1 94 LEU n 1 95 LYS n 1 96 LYS n 1 97 VAL n 1 98 SER n 1 99 SER n 1 100 GLY n 1 101 PHE n 1 102 SER n 1 103 GLY n 1 104 VAL n 1 105 ILE n 1 106 ARG n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 TRP n 1 111 PHE n 1 112 GLU n 1 113 ARG n 1 114 PRO n 1 115 ASP n 1 116 SER n 1 117 PHE n 1 118 VAL n 1 119 LEU n 1 120 ILE n 1 121 LEU n 1 122 GLU n 1 123 ARG n 1 124 PRO n 1 125 GLU n 1 126 PRO n 1 127 VAL n 1 128 GLN n 1 129 ASP n 1 130 LEU n 1 131 PHE n 1 132 ASP n 1 133 PHE n 1 134 ILE n 1 135 THR n 1 136 GLU n 1 137 ARG n 1 138 GLY n 1 139 ALA n 1 140 LEU n 1 141 GLN n 1 142 GLU n 1 143 GLU n 1 144 LEU n 1 145 ALA n 1 146 ARG n 1 147 SER n 1 148 PHE n 1 149 PHE n 1 150 TRP n 1 151 GLN n 1 152 VAL n 1 153 LEU n 1 154 GLU n 1 155 ALA n 1 156 VAL n 1 157 ARG n 1 158 HIS n 1 159 CYS n 1 160 HIS n 1 161 ASN n 1 162 CYS n 1 163 GLY n 1 164 VAL n 1 165 LEU n 1 166 HIS n 1 167 ARG n 1 168 ASP n 1 169 ILE n 1 170 LYS n 1 171 ASP n 1 172 GLU n 1 173 ASN n 1 174 ILE n 1 175 LEU n 1 176 ILE n 1 177 ASP n 1 178 LEU n 1 179 ASN n 1 180 ARG n 1 181 GLY n 1 182 GLU n 1 183 LEU n 1 184 LYS n 1 185 LEU n 1 186 ILE n 1 187 ASP n 1 188 PHE n 1 189 GLY n 1 190 SER n 1 191 GLY n 1 192 ALA n 1 193 LEU n 1 194 LEU n 1 195 LYS n 1 196 ASP n 1 197 THR n 1 198 VAL n 1 199 TYR n 1 200 THR n 1 201 ASP n 1 202 PHE n 1 203 ASP n 1 204 GLY n 1 205 THR n 1 206 ARG n 1 207 VAL n 1 208 TYR n 1 209 SER n 1 210 PRO n 1 211 PRO n 1 212 GLU n 1 213 TRP n 1 214 ILE n 1 215 ARG n 1 216 TYR n 1 217 HIS n 1 218 ARG n 1 219 TYR n 1 220 HIS n 1 221 GLY n 1 222 ARG n 1 223 SER n 1 224 ALA n 1 225 ALA n 1 226 VAL n 1 227 TRP n 1 228 SER n 1 229 LEU n 1 230 GLY n 1 231 ILE n 1 232 LEU n 1 233 LEU n 1 234 TYR n 1 235 ASP n 1 236 MET n 1 237 VAL n 1 238 CYS n 1 239 GLY n 1 240 ASP n 1 241 ILE n 1 242 PRO n 1 243 PHE n 1 244 GLU n 1 245 HIS n 1 246 ASP n 1 247 GLU n 1 248 GLU n 1 249 ILE n 1 250 ILE n 1 251 ARG n 1 252 GLY n 1 253 GLN n 1 254 VAL n 1 255 PHE n 1 256 PHE n 1 257 ARG n 1 258 GLN n 1 259 ARG n 1 260 VAL n 1 261 SER n 1 262 SEP n 1 263 GLU n 1 264 CYS n 1 265 GLN n 1 266 HIS n 1 267 LEU n 1 268 ILE n 1 269 ARG n 1 270 TRP n 1 271 CYS n 1 272 LEU n 1 273 ALA n 1 274 LEU n 1 275 ARG n 1 276 PRO n 1 277 SER n 1 278 ASP n 1 279 ARG n 1 280 PRO n 1 281 THR n 1 282 PHE n 1 283 GLU n 1 284 GLU n 1 285 ILE n 1 286 GLN n 1 287 ASN n 1 288 HIS n 1 289 PRO n 1 290 TRP n 1 291 MET n 1 292 GLN n 1 293 ASP n 1 294 VAL n 1 295 LEU n 1 296 LEU n 1 297 PRO n 1 298 GLN n 1 299 GLU n 1 300 THR n 1 301 ALA n 1 302 GLU n 1 303 ILE n 1 304 HIS n 1 305 LEU n 1 306 HIS n 1 307 SER n 1 308 LEU n 1 309 SER n 1 310 PRO n 1 311 GLY n 1 312 PRO n 1 313 SER n 1 314 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PIM1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P11309 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4BZO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 314 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11309 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 313 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 313 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4BZO GLY A 1 ? UNP P11309 ? ? 'expression tag' 0 1 1 4BZO PRO A 2 ? UNP P11309 ? ? 'expression tag' 1 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 676 non-polymer . 'N-[(1S)-2-AMINO-1-PHENYLETHYL]-2-[(4S)-7-(2-FLUORO-4-PYRIDINYL)-1-OXO-1,2,3,4-TETRAHYDROPYRROLO[1,2-A]PYRAZIN-4-YL]ACETAMIDE' ? 'C22 H22 F N5 O2' 407.441 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4BZO _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.36 _exptl_crystal.density_percent_sol 63 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '20% PEG 3350K, 0.3 M NACL, 0.1 M TRISHCL PH 7.6' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2009-02-12 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.87 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_wavelength 0.87 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4BZO _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.00 _reflns.d_resolution_high 2.10 _reflns.number_obs 25928 _reflns.number_all ? _reflns.percent_possible_obs 99.6 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.00 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.6 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.18 _reflns_shell.percent_possible_all 99.5 _reflns_shell.Rmerge_I_obs 0.55 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.20 _reflns_shell.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4BZO _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 24590 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.00 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 99.66 _refine.ls_R_factor_obs 0.18315 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18141 _refine.ls_R_factor_R_free 0.21643 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1320 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.953 _refine.correlation_coeff_Fo_to_Fc_free 0.936 _refine.B_iso_mean 29.000 _refine.aniso_B[1][1] 0.28 _refine.aniso_B[2][2] 0.28 _refine.aniso_B[3][3] -0.42 _refine.aniso_B[1][2] 0.14 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.155 _refine.pdbx_overall_ESU_R_Free 0.144 _refine.overall_SU_ML 0.089 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 3.283 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2228 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 135 _refine_hist.number_atoms_total 2393 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.010 0.019 ? 2321 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.334 1.967 ? 3153 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.148 5.000 ? 272 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.617 23.136 ? 118 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.796 15.000 ? 379 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 18.754 15.000 ? 21 'X-RAY DIFFRACTION' ? r_chiral_restr 0.110 0.200 ? 334 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.021 ? 1802 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.154 _refine_ls_shell.number_reflns_R_work 1754 _refine_ls_shell.R_factor_R_work 0.219 _refine_ls_shell.percent_reflns_obs 99.41 _refine_ls_shell.R_factor_R_free 0.276 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 115 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 4BZO _struct.title 'Crystal structure of PIM1 in complex with a Pyrrolo-Pyrazinone inhibitor' _struct.pdbx_descriptor 'SERINE/THREONINE-PROTEIN KINASE PIM-1 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4BZO _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'PIM1, ATP BINDING, KINASE INHIBITOR, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 34 ? GLN A 38 ? PRO A 33 GLN A 37 1 ? 5 HELX_P HELX_P2 2 ASP A 73 ? ILE A 75 ? ASP A 72 ILE A 74 5 ? 3 HELX_P HELX_P3 3 MET A 89 ? SER A 98 ? MET A 88 SER A 97 1 ? 10 HELX_P HELX_P4 4 LEU A 130 ? GLY A 138 ? LEU A 129 GLY A 137 1 ? 9 HELX_P HELX_P5 5 GLN A 141 ? CYS A 162 ? GLN A 140 CYS A 161 1 ? 22 HELX_P HELX_P6 6 LYS A 170 ? GLU A 172 ? LYS A 169 GLU A 171 5 ? 3 HELX_P HELX_P7 7 THR A 205 ? SER A 209 ? THR A 204 SER A 208 5 ? 5 HELX_P HELX_P8 8 PRO A 210 ? HIS A 217 ? PRO A 209 HIS A 216 1 ? 8 HELX_P HELX_P9 9 HIS A 220 ? GLY A 239 ? HIS A 219 GLY A 238 1 ? 20 HELX_P HELX_P10 10 HIS A 245 ? GLY A 252 ? HIS A 244 GLY A 251 1 ? 8 HELX_P HELX_P11 11 SER A 261 ? LEU A 272 ? SER A 260 LEU A 271 1 ? 12 HELX_P HELX_P12 12 ARG A 275 ? ARG A 279 ? ARG A 274 ARG A 278 5 ? 5 HELX_P HELX_P13 13 THR A 281 ? ASN A 287 ? THR A 280 ASN A 286 1 ? 7 HELX_P HELX_P14 14 HIS A 288 ? GLN A 292 ? HIS A 287 GLN A 291 5 ? 5 HELX_P HELX_P15 15 LEU A 296 ? LEU A 305 ? LEU A 295 LEU A 304 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A SER 261 C ? ? ? 1_555 A SEP 262 N ? ? A SER 260 A SEP 261 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? A SEP 262 C ? ? ? 1_555 A GLU 263 N ? ? A SEP 261 A GLU 262 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 125 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 124 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 126 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 125 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -7.43 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 2 ? AC ? 3 ? AD ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AD 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 TYR A 39 ? GLY A 48 ? TYR A 38 GLY A 47 AA 2 GLY A 51 ? ARG A 58 ? GLY A 50 ARG A 57 AA 3 LEU A 63 ? GLU A 71 ? LEU A 62 GLU A 70 AA 4 SER A 116 ? GLU A 122 ? SER A 115 GLU A 121 AA 5 LEU A 107 ? GLU A 112 ? LEU A 106 GLU A 111 AB 1 TRP A 78 ? GLU A 80 ? TRP A 77 GLU A 79 AB 2 ARG A 86 ? PRO A 88 ? ARG A 85 PRO A 87 AC 1 VAL A 127 ? ASP A 129 ? VAL A 126 ASP A 128 AC 2 ILE A 174 ? ASP A 177 ? ILE A 173 ASP A 176 AC 3 GLU A 182 ? LEU A 185 ? GLU A 181 LEU A 184 AD 1 VAL A 164 ? LEU A 165 ? VAL A 163 LEU A 164 AD 2 ALA A 192 ? LEU A 193 ? ALA A 191 LEU A 192 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N GLY A 48 ? N GLY A 47 O GLY A 51 ? O GLY A 50 AA 2 3 N ARG A 58 ? N ARG A 57 O LEU A 63 ? O LEU A 62 AA 3 4 N VAL A 70 ? N VAL A 69 O PHE A 117 ? O PHE A 116 AA 4 5 O ILE A 120 ? O ILE A 119 N LEU A 108 ? N LEU A 107 AB 1 2 N GLY A 79 ? N GLY A 78 O VAL A 87 ? O VAL A 86 AC 1 2 N GLN A 128 ? N GLN A 127 O ILE A 176 ? O ILE A 175 AC 2 3 N ASP A 177 ? N ASP A 176 O GLU A 182 ? O GLU A 181 AD 1 2 N LEU A 165 ? N LEU A 164 O ALA A 192 ? O ALA A 191 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'BINDING SITE FOR RESIDUE 676 A 1306' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 LEU A 45 ? LEU A 44 . ? 1_555 ? 2 AC1 15 GLY A 46 ? GLY A 45 . ? 1_555 ? 3 AC1 15 PHE A 50 ? PHE A 49 . ? 1_555 ? 4 AC1 15 ALA A 66 ? ALA A 65 . ? 1_555 ? 5 AC1 15 LYS A 68 ? LYS A 67 . ? 1_555 ? 6 AC1 15 ILE A 105 ? ILE A 104 . ? 1_555 ? 7 AC1 15 GLU A 122 ? GLU A 121 . ? 1_555 ? 8 AC1 15 ARG A 123 ? ARG A 122 . ? 1_555 ? 9 AC1 15 ASP A 129 ? ASP A 128 . ? 1_555 ? 10 AC1 15 ILE A 186 ? ILE A 185 . ? 1_555 ? 11 AC1 15 ASP A 187 ? ASP A 186 . ? 1_555 ? 12 AC1 15 HOH C . ? HOH A 2005 . ? 1_555 ? 13 AC1 15 HOH C . ? HOH A 2024 . ? 1_555 ? 14 AC1 15 HOH C . ? HOH A 2036 . ? 1_555 ? 15 AC1 15 HOH C . ? HOH A 2037 . ? 1_555 ? # _database_PDB_matrix.entry_id 4BZO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4BZO _atom_sites.fract_transf_matrix[1][1] 0.010211 _atom_sites.fract_transf_matrix[1][2] 0.005895 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011791 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012280 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 PRO 2 1 ? ? ? A . n A 1 3 LEU 3 2 ? ? ? A . n A 1 4 LEU 4 3 ? ? ? A . n A 1 5 SER 5 4 ? ? ? A . n A 1 6 LYS 6 5 ? ? ? A . n A 1 7 ILE 7 6 ? ? ? A . n A 1 8 ASN 8 7 ? ? ? A . n A 1 9 SER 9 8 ? ? ? A . n A 1 10 LEU 10 9 ? ? ? A . n A 1 11 ALA 11 10 ? ? ? A . n A 1 12 HIS 12 11 ? ? ? A . n A 1 13 LEU 13 12 ? ? ? A . n A 1 14 ARG 14 13 ? ? ? A . n A 1 15 ALA 15 14 ? ? ? A . n A 1 16 ALA 16 15 ? ? ? A . n A 1 17 PRO 17 16 ? ? ? A . n A 1 18 CYS 18 17 ? ? ? A . n A 1 19 ASN 19 18 ? ? ? A . n A 1 20 ASP 20 19 ? ? ? A . n A 1 21 LEU 21 20 ? ? ? A . n A 1 22 HIS 22 21 ? ? ? A . n A 1 23 ALA 23 22 ? ? ? A . n A 1 24 THR 24 23 ? ? ? A . n A 1 25 LYS 25 24 ? ? ? A . n A 1 26 LEU 26 25 ? ? ? A . n A 1 27 ALA 27 26 ? ? ? A . n A 1 28 PRO 28 27 ? ? ? A . n A 1 29 GLY 29 28 ? ? ? A . n A 1 30 LYS 30 29 ? ? ? A . n A 1 31 GLU 31 30 ? ? ? A . n A 1 32 LYS 32 31 ? ? ? A . n A 1 33 GLU 33 32 ? ? ? A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 LEU 35 34 34 LEU LEU A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 GLN 38 37 37 GLN GLN A . n A 1 39 TYR 39 38 38 TYR TYR A . n A 1 40 GLN 40 39 39 GLN GLN A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 PRO 43 42 42 PRO PRO A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 GLY 46 45 45 GLY GLY A . n A 1 47 SER 47 46 46 SER SER A . n A 1 48 GLY 48 47 47 GLY GLY A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 PHE 50 49 49 PHE PHE A . n A 1 51 GLY 51 50 50 GLY GLY A . n A 1 52 SER 52 51 51 SER SER A . n A 1 53 VAL 53 52 52 VAL VAL A . n A 1 54 TYR 54 53 53 TYR TYR A . n A 1 55 SER 55 54 54 SER SER A . n A 1 56 GLY 56 55 55 GLY GLY A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 ARG 58 57 57 ARG ARG A . n A 1 59 VAL 59 58 58 VAL VAL A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 ASN 62 61 61 ASN ASN A . n A 1 63 LEU 63 62 62 LEU LEU A . n A 1 64 PRO 64 63 63 PRO PRO A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 ALA 66 65 65 ALA ALA A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 HIS 69 68 68 HIS HIS A . n A 1 70 VAL 70 69 69 VAL VAL A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 ASP 73 72 72 ASP ASP A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 ILE 75 74 74 ILE ILE A . n A 1 76 SER 76 75 75 SER SER A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 TRP 78 77 77 TRP TRP A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 GLU 80 79 79 GLU GLU A . n A 1 81 LEU 81 80 80 LEU LEU A . n A 1 82 PRO 82 81 81 PRO PRO A . n A 1 83 ASN 83 82 82 ASN ASN A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 THR 85 84 84 THR THR A . n A 1 86 ARG 86 85 85 ARG ARG A . n A 1 87 VAL 87 86 86 VAL VAL A . n A 1 88 PRO 88 87 87 PRO PRO A . n A 1 89 MET 89 88 88 MET MET A . n A 1 90 GLU 90 89 89 GLU GLU A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 VAL 92 91 91 VAL VAL A . n A 1 93 LEU 93 92 92 LEU LEU A . n A 1 94 LEU 94 93 93 LEU LEU A . n A 1 95 LYS 95 94 94 LYS LYS A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 VAL 97 96 96 VAL VAL A . n A 1 98 SER 98 97 97 SER SER A . n A 1 99 SER 99 98 98 SER SER A . n A 1 100 GLY 100 99 99 GLY GLY A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 SER 102 101 101 SER SER A . n A 1 103 GLY 103 102 102 GLY GLY A . n A 1 104 VAL 104 103 103 VAL VAL A . n A 1 105 ILE 105 104 104 ILE ILE A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 LEU 108 107 107 LEU LEU A . n A 1 109 ASP 109 108 108 ASP ASP A . n A 1 110 TRP 110 109 109 TRP TRP A . n A 1 111 PHE 111 110 110 PHE PHE A . n A 1 112 GLU 112 111 111 GLU GLU A . n A 1 113 ARG 113 112 112 ARG ARG A . n A 1 114 PRO 114 113 113 PRO PRO A . n A 1 115 ASP 115 114 114 ASP ASP A . n A 1 116 SER 116 115 115 SER SER A . n A 1 117 PHE 117 116 116 PHE PHE A . n A 1 118 VAL 118 117 117 VAL VAL A . n A 1 119 LEU 119 118 118 LEU LEU A . n A 1 120 ILE 120 119 119 ILE ILE A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 GLU 122 121 121 GLU GLU A . n A 1 123 ARG 123 122 122 ARG ARG A . n A 1 124 PRO 124 123 123 PRO PRO A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 PRO 126 125 125 PRO PRO A . n A 1 127 VAL 127 126 126 VAL VAL A . n A 1 128 GLN 128 127 127 GLN GLN A . n A 1 129 ASP 129 128 128 ASP ASP A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 PHE 131 130 130 PHE PHE A . n A 1 132 ASP 132 131 131 ASP ASP A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 THR 135 134 134 THR THR A . n A 1 136 GLU 136 135 135 GLU GLU A . n A 1 137 ARG 137 136 136 ARG ARG A . n A 1 138 GLY 138 137 137 GLY GLY A . n A 1 139 ALA 139 138 138 ALA ALA A . n A 1 140 LEU 140 139 139 LEU LEU A . n A 1 141 GLN 141 140 140 GLN GLN A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 LEU 144 143 143 LEU LEU A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 ARG 146 145 145 ARG ARG A . n A 1 147 SER 147 146 146 SER SER A . n A 1 148 PHE 148 147 147 PHE PHE A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 TRP 150 149 149 TRP TRP A . n A 1 151 GLN 151 150 150 GLN GLN A . n A 1 152 VAL 152 151 151 VAL VAL A . n A 1 153 LEU 153 152 152 LEU LEU A . n A 1 154 GLU 154 153 153 GLU GLU A . n A 1 155 ALA 155 154 154 ALA ALA A . n A 1 156 VAL 156 155 155 VAL VAL A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 HIS 158 157 157 HIS HIS A . n A 1 159 CYS 159 158 158 CYS CYS A . n A 1 160 HIS 160 159 159 HIS HIS A . n A 1 161 ASN 161 160 160 ASN ASN A . n A 1 162 CYS 162 161 161 CYS CYS A . n A 1 163 GLY 163 162 162 GLY GLY A . n A 1 164 VAL 164 163 163 VAL VAL A . n A 1 165 LEU 165 164 164 LEU LEU A . n A 1 166 HIS 166 165 165 HIS HIS A . n A 1 167 ARG 167 166 166 ARG ARG A . n A 1 168 ASP 168 167 167 ASP ASP A . n A 1 169 ILE 169 168 168 ILE ILE A . n A 1 170 LYS 170 169 169 LYS LYS A . n A 1 171 ASP 171 170 170 ASP ASP A . n A 1 172 GLU 172 171 171 GLU GLU A . n A 1 173 ASN 173 172 172 ASN ASN A . n A 1 174 ILE 174 173 173 ILE ILE A . n A 1 175 LEU 175 174 174 LEU LEU A . n A 1 176 ILE 176 175 175 ILE ILE A . n A 1 177 ASP 177 176 176 ASP ASP A . n A 1 178 LEU 178 177 177 LEU LEU A . n A 1 179 ASN 179 178 178 ASN ASN A . n A 1 180 ARG 180 179 179 ARG ARG A . n A 1 181 GLY 181 180 180 GLY GLY A . n A 1 182 GLU 182 181 181 GLU GLU A . n A 1 183 LEU 183 182 182 LEU LEU A . n A 1 184 LYS 184 183 183 LYS LYS A . n A 1 185 LEU 185 184 184 LEU LEU A . n A 1 186 ILE 186 185 185 ILE ILE A . n A 1 187 ASP 187 186 186 ASP ASP A . n A 1 188 PHE 188 187 187 PHE PHE A . n A 1 189 GLY 189 188 188 GLY GLY A . n A 1 190 SER 190 189 189 SER SER A . n A 1 191 GLY 191 190 190 GLY GLY A . n A 1 192 ALA 192 191 191 ALA ALA A . n A 1 193 LEU 193 192 192 LEU LEU A . n A 1 194 LEU 194 193 193 LEU LEU A . n A 1 195 LYS 195 194 194 LYS LYS A . n A 1 196 ASP 196 195 195 ASP ASP A . n A 1 197 THR 197 196 196 THR THR A . n A 1 198 VAL 198 197 197 VAL VAL A . n A 1 199 TYR 199 198 198 TYR TYR A . n A 1 200 THR 200 199 199 THR THR A . n A 1 201 ASP 201 200 200 ASP ASP A . n A 1 202 PHE 202 201 201 PHE PHE A . n A 1 203 ASP 203 202 202 ASP ASP A . n A 1 204 GLY 204 203 203 GLY GLY A . n A 1 205 THR 205 204 204 THR THR A . n A 1 206 ARG 206 205 205 ARG ARG A . n A 1 207 VAL 207 206 206 VAL VAL A . n A 1 208 TYR 208 207 207 TYR TYR A . n A 1 209 SER 209 208 208 SER SER A . n A 1 210 PRO 210 209 209 PRO PRO A . n A 1 211 PRO 211 210 210 PRO PRO A . n A 1 212 GLU 212 211 211 GLU GLU A . n A 1 213 TRP 213 212 212 TRP TRP A . n A 1 214 ILE 214 213 213 ILE ILE A . n A 1 215 ARG 215 214 214 ARG ARG A . n A 1 216 TYR 216 215 215 TYR TYR A . n A 1 217 HIS 217 216 216 HIS HIS A . n A 1 218 ARG 218 217 217 ARG ARG A . n A 1 219 TYR 219 218 218 TYR TYR A . n A 1 220 HIS 220 219 219 HIS HIS A . n A 1 221 GLY 221 220 220 GLY GLY A . n A 1 222 ARG 222 221 221 ARG ARG A . n A 1 223 SER 223 222 222 SER SER A . n A 1 224 ALA 224 223 223 ALA ALA A . n A 1 225 ALA 225 224 224 ALA ALA A . n A 1 226 VAL 226 225 225 VAL VAL A . n A 1 227 TRP 227 226 226 TRP TRP A . n A 1 228 SER 228 227 227 SER SER A . n A 1 229 LEU 229 228 228 LEU LEU A . n A 1 230 GLY 230 229 229 GLY GLY A . n A 1 231 ILE 231 230 230 ILE ILE A . n A 1 232 LEU 232 231 231 LEU LEU A . n A 1 233 LEU 233 232 232 LEU LEU A . n A 1 234 TYR 234 233 233 TYR TYR A . n A 1 235 ASP 235 234 234 ASP ASP A . n A 1 236 MET 236 235 235 MET MET A . n A 1 237 VAL 237 236 236 VAL VAL A . n A 1 238 CYS 238 237 237 CYS CYS A . n A 1 239 GLY 239 238 238 GLY GLY A . n A 1 240 ASP 240 239 239 ASP ASP A . n A 1 241 ILE 241 240 240 ILE ILE A . n A 1 242 PRO 242 241 241 PRO PRO A . n A 1 243 PHE 243 242 242 PHE PHE A . n A 1 244 GLU 244 243 243 GLU GLU A . n A 1 245 HIS 245 244 244 HIS HIS A . n A 1 246 ASP 246 245 245 ASP ASP A . n A 1 247 GLU 247 246 246 GLU GLU A . n A 1 248 GLU 248 247 247 GLU GLU A . n A 1 249 ILE 249 248 248 ILE ILE A . n A 1 250 ILE 250 249 249 ILE ILE A . n A 1 251 ARG 251 250 250 ARG ARG A . n A 1 252 GLY 252 251 251 GLY GLY A . n A 1 253 GLN 253 252 252 GLN GLN A . n A 1 254 VAL 254 253 253 VAL VAL A . n A 1 255 PHE 255 254 254 PHE PHE A . n A 1 256 PHE 256 255 255 PHE PHE A . n A 1 257 ARG 257 256 256 ARG ARG A . n A 1 258 GLN 258 257 257 GLN GLN A . n A 1 259 ARG 259 258 258 ARG ARG A . n A 1 260 VAL 260 259 259 VAL VAL A . n A 1 261 SER 261 260 260 SER SER A . n A 1 262 SEP 262 261 261 SEP SEP A . n A 1 263 GLU 263 262 262 GLU GLU A . n A 1 264 CYS 264 263 263 CYS CYS A . n A 1 265 GLN 265 264 264 GLN GLN A . n A 1 266 HIS 266 265 265 HIS HIS A . n A 1 267 LEU 267 266 266 LEU LEU A . n A 1 268 ILE 268 267 267 ILE ILE A . n A 1 269 ARG 269 268 268 ARG ARG A . n A 1 270 TRP 270 269 269 TRP TRP A . n A 1 271 CYS 271 270 270 CYS CYS A . n A 1 272 LEU 272 271 271 LEU LEU A . n A 1 273 ALA 273 272 272 ALA ALA A . n A 1 274 LEU 274 273 273 LEU LEU A . n A 1 275 ARG 275 274 274 ARG ARG A . n A 1 276 PRO 276 275 275 PRO PRO A . n A 1 277 SER 277 276 276 SER SER A . n A 1 278 ASP 278 277 277 ASP ASP A . n A 1 279 ARG 279 278 278 ARG ARG A . n A 1 280 PRO 280 279 279 PRO PRO A . n A 1 281 THR 281 280 280 THR THR A . n A 1 282 PHE 282 281 281 PHE PHE A . n A 1 283 GLU 283 282 282 GLU GLU A . n A 1 284 GLU 284 283 283 GLU GLU A . n A 1 285 ILE 285 284 284 ILE ILE A . n A 1 286 GLN 286 285 285 GLN GLN A . n A 1 287 ASN 287 286 286 ASN ASN A . n A 1 288 HIS 288 287 287 HIS HIS A . n A 1 289 PRO 289 288 288 PRO PRO A . n A 1 290 TRP 290 289 289 TRP TRP A . n A 1 291 MET 291 290 290 MET MET A . n A 1 292 GLN 292 291 291 GLN GLN A . n A 1 293 ASP 293 292 292 ASP ASP A . n A 1 294 VAL 294 293 293 VAL VAL A . n A 1 295 LEU 295 294 294 LEU LEU A . n A 1 296 LEU 296 295 295 LEU LEU A . n A 1 297 PRO 297 296 296 PRO PRO A . n A 1 298 GLN 298 297 297 GLN GLN A . n A 1 299 GLU 299 298 298 GLU GLU A . n A 1 300 THR 300 299 299 THR THR A . n A 1 301 ALA 301 300 300 ALA ALA A . n A 1 302 GLU 302 301 301 GLU GLU A . n A 1 303 ILE 303 302 302 ILE ILE A . n A 1 304 HIS 304 303 303 HIS HIS A . n A 1 305 LEU 305 304 304 LEU LEU A . n A 1 306 HIS 306 305 305 HIS HIS A . n A 1 307 SER 307 306 ? ? ? A . n A 1 308 LEU 308 307 ? ? ? A . n A 1 309 SER 309 308 ? ? ? A . n A 1 310 PRO 310 309 ? ? ? A . n A 1 311 GLY 311 310 ? ? ? A . n A 1 312 PRO 312 311 ? ? ? A . n A 1 313 SER 313 312 ? ? ? A . n A 1 314 LYS 314 313 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 676 1 1306 1306 676 676 A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . C 3 HOH 47 2047 2047 HOH HOH A . C 3 HOH 48 2048 2048 HOH HOH A . C 3 HOH 49 2049 2049 HOH HOH A . C 3 HOH 50 2050 2050 HOH HOH A . C 3 HOH 51 2051 2051 HOH HOH A . C 3 HOH 52 2052 2052 HOH HOH A . C 3 HOH 53 2053 2053 HOH HOH A . C 3 HOH 54 2054 2054 HOH HOH A . C 3 HOH 55 2055 2055 HOH HOH A . C 3 HOH 56 2056 2056 HOH HOH A . C 3 HOH 57 2057 2057 HOH HOH A . C 3 HOH 58 2058 2058 HOH HOH A . C 3 HOH 59 2059 2059 HOH HOH A . C 3 HOH 60 2060 2060 HOH HOH A . C 3 HOH 61 2061 2061 HOH HOH A . C 3 HOH 62 2062 2062 HOH HOH A . C 3 HOH 63 2063 2063 HOH HOH A . C 3 HOH 64 2064 2064 HOH HOH A . C 3 HOH 65 2065 2065 HOH HOH A . C 3 HOH 66 2066 2066 HOH HOH A . C 3 HOH 67 2067 2067 HOH HOH A . C 3 HOH 68 2068 2068 HOH HOH A . C 3 HOH 69 2069 2069 HOH HOH A . C 3 HOH 70 2070 2070 HOH HOH A . C 3 HOH 71 2071 2071 HOH HOH A . C 3 HOH 72 2072 2072 HOH HOH A . C 3 HOH 73 2073 2073 HOH HOH A . C 3 HOH 74 2074 2074 HOH HOH A . C 3 HOH 75 2075 2075 HOH HOH A . C 3 HOH 76 2076 2076 HOH HOH A . C 3 HOH 77 2077 2077 HOH HOH A . C 3 HOH 78 2078 2078 HOH HOH A . C 3 HOH 79 2079 2079 HOH HOH A . C 3 HOH 80 2080 2080 HOH HOH A . C 3 HOH 81 2081 2081 HOH HOH A . C 3 HOH 82 2082 2082 HOH HOH A . C 3 HOH 83 2083 2083 HOH HOH A . C 3 HOH 84 2084 2084 HOH HOH A . C 3 HOH 85 2085 2085 HOH HOH A . C 3 HOH 86 2086 2086 HOH HOH A . C 3 HOH 87 2087 2087 HOH HOH A . C 3 HOH 88 2088 2088 HOH HOH A . C 3 HOH 89 2089 2089 HOH HOH A . C 3 HOH 90 2090 2090 HOH HOH A . C 3 HOH 91 2091 2091 HOH HOH A . C 3 HOH 92 2092 2092 HOH HOH A . C 3 HOH 93 2093 2093 HOH HOH A . C 3 HOH 94 2094 2094 HOH HOH A . C 3 HOH 95 2095 2095 HOH HOH A . C 3 HOH 96 2096 2096 HOH HOH A . C 3 HOH 97 2097 2097 HOH HOH A . C 3 HOH 98 2098 2098 HOH HOH A . C 3 HOH 99 2099 2099 HOH HOH A . C 3 HOH 100 2100 2100 HOH HOH A . C 3 HOH 101 2101 2101 HOH HOH A . C 3 HOH 102 2102 2102 HOH HOH A . C 3 HOH 103 2103 2103 HOH HOH A . C 3 HOH 104 2104 2104 HOH HOH A . C 3 HOH 105 2105 2105 HOH HOH A . C 3 HOH 106 2106 2106 HOH HOH A . C 3 HOH 107 2107 2107 HOH HOH A . C 3 HOH 108 2108 2108 HOH HOH A . C 3 HOH 109 2109 2109 HOH HOH A . C 3 HOH 110 2110 2110 HOH HOH A . C 3 HOH 111 2111 2111 HOH HOH A . C 3 HOH 112 2112 2112 HOH HOH A . C 3 HOH 113 2113 2113 HOH HOH A . C 3 HOH 114 2114 2114 HOH HOH A . C 3 HOH 115 2115 2115 HOH HOH A . C 3 HOH 116 2116 2116 HOH HOH A . C 3 HOH 117 2117 2117 HOH HOH A . C 3 HOH 118 2118 2118 HOH HOH A . C 3 HOH 119 2119 2119 HOH HOH A . C 3 HOH 120 2120 2120 HOH HOH A . C 3 HOH 121 2121 2121 HOH HOH A . C 3 HOH 122 2122 2122 HOH HOH A . C 3 HOH 123 2123 2123 HOH HOH A . C 3 HOH 124 2124 2124 HOH HOH A . C 3 HOH 125 2125 2125 HOH HOH A . C 3 HOH 126 2126 2126 HOH HOH A . C 3 HOH 127 2127 2127 HOH HOH A . C 3 HOH 128 2128 2128 HOH HOH A . C 3 HOH 129 2129 2129 HOH HOH A . C 3 HOH 130 2130 2130 HOH HOH A . C 3 HOH 131 2131 2131 HOH HOH A . C 3 HOH 132 2132 2132 HOH HOH A . C 3 HOH 133 2133 2133 HOH HOH A . C 3 HOH 134 2134 2134 HOH HOH A . C 3 HOH 135 2135 2135 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 262 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 261 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details PHOSPHOSERINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-10-30 2 'Structure model' 1 1 2013-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.6.0117 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 # _pdbx_entry_details.entry_id 4BZO _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE FIRST TWO RESIDUES AT THE N-TERMINAL GLY AND PRO ARE EXPRESSION TAG ; # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 98 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 105 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 166 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 166 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 166 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 116.29 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -4.01 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 98 ? ? 174.09 -170.53 2 1 ASP A 167 ? ? -149.12 44.84 3 1 ASP A 186 ? ? 68.25 84.97 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A PRO 1 ? A PRO 2 3 1 Y 1 A LEU 2 ? A LEU 3 4 1 Y 1 A LEU 3 ? A LEU 4 5 1 Y 1 A SER 4 ? A SER 5 6 1 Y 1 A LYS 5 ? A LYS 6 7 1 Y 1 A ILE 6 ? A ILE 7 8 1 Y 1 A ASN 7 ? A ASN 8 9 1 Y 1 A SER 8 ? A SER 9 10 1 Y 1 A LEU 9 ? A LEU 10 11 1 Y 1 A ALA 10 ? A ALA 11 12 1 Y 1 A HIS 11 ? A HIS 12 13 1 Y 1 A LEU 12 ? A LEU 13 14 1 Y 1 A ARG 13 ? A ARG 14 15 1 Y 1 A ALA 14 ? A ALA 15 16 1 Y 1 A ALA 15 ? A ALA 16 17 1 Y 1 A PRO 16 ? A PRO 17 18 1 Y 1 A CYS 17 ? A CYS 18 19 1 Y 1 A ASN 18 ? A ASN 19 20 1 Y 1 A ASP 19 ? A ASP 20 21 1 Y 1 A LEU 20 ? A LEU 21 22 1 Y 1 A HIS 21 ? A HIS 22 23 1 Y 1 A ALA 22 ? A ALA 23 24 1 Y 1 A THR 23 ? A THR 24 25 1 Y 1 A LYS 24 ? A LYS 25 26 1 Y 1 A LEU 25 ? A LEU 26 27 1 Y 1 A ALA 26 ? A ALA 27 28 1 Y 1 A PRO 27 ? A PRO 28 29 1 Y 1 A GLY 28 ? A GLY 29 30 1 Y 1 A LYS 29 ? A LYS 30 31 1 Y 1 A GLU 30 ? A GLU 31 32 1 Y 1 A LYS 31 ? A LYS 32 33 1 Y 1 A GLU 32 ? A GLU 33 34 1 Y 1 A SER 306 ? A SER 307 35 1 Y 1 A LEU 307 ? A LEU 308 36 1 Y 1 A SER 308 ? A SER 309 37 1 Y 1 A PRO 309 ? A PRO 310 38 1 Y 1 A GLY 310 ? A GLY 311 39 1 Y 1 A PRO 311 ? A PRO 312 40 1 Y 1 A SER 312 ? A SER 313 41 1 Y 1 A LYS 313 ? A LYS 314 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-[(1S)-2-AMINO-1-PHENYLETHYL]-2-[(4S)-7-(2-FLUORO-4-PYRIDINYL)-1-OXO-1,2,3,4-TETRAHYDROPYRROLO[1,2-A]PYRAZIN-4-YL]ACETAMIDE' 676 3 water HOH #