data_4CQI # _entry.id 4CQI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4CQI PDBE EBI-59760 WWPDB D_1290059760 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4CQI _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2014-02-17 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barrack, K.L.' 1 'Fyfe, P.K.' 2 'Hunter, W.N.' 3 # _citation.id primary _citation.title ;The Structure of Tubulin-Binding Cofactor a from Leishmania Major Infers a Mode of Association During the Early Stages of Microtubule Assembly ; _citation.journal_abbrev 'Acta Crystallogr.,Sect.F' _citation.journal_volume 71 _citation.page_first 539 _citation.page_last ? _citation.year 2015 _citation.journal_id_ASTM ? _citation.country DK _citation.journal_id_ISSN 1744-3091 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25945706 _citation.pdbx_database_id_DOI 10.1107/S2053230X15000990 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Barrack, K.L.' 1 primary 'Fyfe, P.K.' 2 primary 'Hunter, W.N.' 3 # _cell.entry_id 4CQI _cell.length_a 76.757 _cell.length_b 76.757 _cell.length_c 39.433 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4CQI _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TUBULIN-BINDING COFACTOR A' 14224.944 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 90 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMSDSTESTNRFASNVRQAEAPNEKTLRIKVSALKRTIKDLEFAKREVERELQRLDTLCQSDPDRVPQQTKVVDEAQMM VPHSVNRIMASVKDLSDYLEKEGSTVSNEELLDLARATMADGQAAVS ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMSDSTESTNRFASNVRQAEAPNEKTLRIKVSALKRTIKDLEFAKREVERELQRLDTLCQSDPDRVPQQTKVVDEAQMM VPHSVNRIMASVKDLSDYLEKEGSTVSNEELLDLARATMADGQAAVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 SER n 1 5 ASP n 1 6 SER n 1 7 THR n 1 8 GLU n 1 9 SER n 1 10 THR n 1 11 ASN n 1 12 ARG n 1 13 PHE n 1 14 ALA n 1 15 SER n 1 16 ASN n 1 17 VAL n 1 18 ARG n 1 19 GLN n 1 20 ALA n 1 21 GLU n 1 22 ALA n 1 23 PRO n 1 24 ASN n 1 25 GLU n 1 26 LYS n 1 27 THR n 1 28 LEU n 1 29 ARG n 1 30 ILE n 1 31 LYS n 1 32 VAL n 1 33 SER n 1 34 ALA n 1 35 LEU n 1 36 LYS n 1 37 ARG n 1 38 THR n 1 39 ILE n 1 40 LYS n 1 41 ASP n 1 42 LEU n 1 43 GLU n 1 44 PHE n 1 45 ALA n 1 46 LYS n 1 47 ARG n 1 48 GLU n 1 49 VAL n 1 50 GLU n 1 51 ARG n 1 52 GLU n 1 53 LEU n 1 54 GLN n 1 55 ARG n 1 56 LEU n 1 57 ASP n 1 58 THR n 1 59 LEU n 1 60 CYS n 1 61 GLN n 1 62 SER n 1 63 ASP n 1 64 PRO n 1 65 ASP n 1 66 ARG n 1 67 VAL n 1 68 PRO n 1 69 GLN n 1 70 GLN n 1 71 THR n 1 72 LYS n 1 73 VAL n 1 74 VAL n 1 75 ASP n 1 76 GLU n 1 77 ALA n 1 78 GLN n 1 79 MET n 1 80 MET n 1 81 VAL n 1 82 PRO n 1 83 HIS n 1 84 SER n 1 85 VAL n 1 86 ASN n 1 87 ARG n 1 88 ILE n 1 89 MET n 1 90 ALA n 1 91 SER n 1 92 VAL n 1 93 LYS n 1 94 ASP n 1 95 LEU n 1 96 SER n 1 97 ASP n 1 98 TYR n 1 99 LEU n 1 100 GLU n 1 101 LYS n 1 102 GLU n 1 103 GLY n 1 104 SER n 1 105 THR n 1 106 VAL n 1 107 SER n 1 108 ASN n 1 109 GLU n 1 110 GLU n 1 111 LEU n 1 112 LEU n 1 113 ASP n 1 114 LEU n 1 115 ALA n 1 116 ARG n 1 117 ALA n 1 118 THR n 1 119 MET n 1 120 ALA n 1 121 ASP n 1 122 GLY n 1 123 GLN n 1 124 ALA n 1 125 ALA n 1 126 VAL n 1 127 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain FRIEDLIN _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'LEISHMANIA MAJOR' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5664 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET15B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9U1D9_LEIMA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9U1D9 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4CQI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 127 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9U1D9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 125 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4CQI GLY A 1 ? UNP Q9U1D9 ? ? 'expression tag' -1 1 1 4CQI HIS A 2 ? UNP Q9U1D9 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4CQI _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_percent_sol 47.82 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'RESERVOIR CONTAINED 0.2M (NH4)2HPO4 AND 1.6M (NH4)2SO4.' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2011-02-17 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8726 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_wavelength 0.8726 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4CQI _reflns.observed_criterion_sigma_I . _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 39.40 _reflns.d_resolution_high 1.90 _reflns.number_obs 10821 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 24.90 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 12.1 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 2.00 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.45 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.80 _reflns_shell.pdbx_redundancy 12.4 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4CQI _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 10286 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.43 _refine.ls_d_res_high 1.90 _refine.ls_percent_reflns_obs 99.96 _refine.ls_R_factor_obs 0.18713 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.18506 _refine.ls_R_factor_R_free 0.22760 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 521 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.951 _refine.correlation_coeff_Fo_to_Fc_free 0.931 _refine.B_iso_mean 23.981 _refine.aniso_B[1][1] -0.35 _refine.aniso_B[2][2] -0.35 _refine.aniso_B[3][3] 0.53 _refine.aniso_B[1][2] -0.18 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. RESIDUES WITH INSUFFICIENT ELECTRON DENSITY WERE NOT MODELED.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.138 _refine.pdbx_overall_ESU_R_Free 0.134 _refine.overall_SU_ML 0.090 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 2.975 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 839 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 90 _refine_hist.number_atoms_total 940 _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 39.43 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.013 0.019 ? 872 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 613 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.586 2.005 ? 1176 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.961 3.000 ? 1506 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.713 5.000 ? 110 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 27.213 25.000 ? 42 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.961 15.000 ? 176 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 23.491 15.000 ? 9 'X-RAY DIFFRACTION' ? r_chiral_restr 0.075 0.200 ? 140 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.021 ? 950 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 151 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.900 _refine_ls_shell.d_res_low 1.950 _refine_ls_shell.number_reflns_R_work 702 _refine_ls_shell.R_factor_R_work 0.211 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.317 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 34 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 4CQI _struct.title 'Crystal structure of recombinant tubulin-binding cofactor A (TBCA) from Leishmania major' _struct.pdbx_descriptor 'TUBULIN-BINDING COFACTOR A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4CQI _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'STRUCTURAL PROTEIN, TUBULIN-BINDING COFACTOR A' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 22 ? ASP A 63 ? ALA A 20 ASP A 61 1 ? 42 HELX_P HELX_P2 2 ARG A 66 ? LYS A 101 ? ARG A 64 LYS A 99 1 ? 36 HELX_P HELX_P3 3 GLU A 102 ? VAL A 106 ? GLU A 100 VAL A 104 5 ? 5 HELX_P HELX_P4 4 ASN A 108 ? VAL A 126 ? ASN A 106 VAL A 124 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 60 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 60 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 58 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 58 _struct_conn.ptnr2_symmetry 6_764 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.210 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 1126' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 1127' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ARG A 47 ? ARG A 45 . ? 1_555 ? 2 AC1 5 ARG A 51 ? ARG A 49 . ? 1_555 ? 3 AC1 5 LYS A 93 ? LYS A 91 . ? 2_654 ? 4 AC1 5 HOH D . ? HOH A 2045 . ? 1_555 ? 5 AC1 5 HOH D . ? HOH A 2090 . ? 1_555 ? 6 AC2 4 LYS A 36 ? LYS A 34 . ? 1_555 ? 7 AC2 4 LYS A 40 ? LYS A 38 . ? 1_555 ? 8 AC2 4 GLU A 43 ? GLU A 41 . ? 1_555 ? 9 AC2 4 ASP A 121 ? ASP A 119 . ? 1_555 ? # _database_PDB_matrix.entry_id 4CQI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4CQI _atom_sites.fract_transf_matrix[1][1] 0.013028 _atom_sites.fract_transf_matrix[1][2] 0.007522 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015044 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025359 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 HIS 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 SER 4 2 ? ? ? A . n A 1 5 ASP 5 3 ? ? ? A . n A 1 6 SER 6 4 ? ? ? A . n A 1 7 THR 7 5 ? ? ? A . n A 1 8 GLU 8 6 ? ? ? A . n A 1 9 SER 9 7 ? ? ? A . n A 1 10 THR 10 8 ? ? ? A . n A 1 11 ASN 11 9 ? ? ? A . n A 1 12 ARG 12 10 ? ? ? A . n A 1 13 PHE 13 11 ? ? ? A . n A 1 14 ALA 14 12 ? ? ? A . n A 1 15 SER 15 13 ? ? ? A . n A 1 16 ASN 16 14 ? ? ? A . n A 1 17 VAL 17 15 ? ? ? A . n A 1 18 ARG 18 16 ? ? ? A . n A 1 19 GLN 19 17 ? ? ? A . n A 1 20 ALA 20 18 ? ? ? A . n A 1 21 GLU 21 19 19 GLU GLU A . n A 1 22 ALA 22 20 20 ALA ALA A . n A 1 23 PRO 23 21 21 PRO PRO A . n A 1 24 ASN 24 22 22 ASN ASN A . n A 1 25 GLU 25 23 23 GLU GLU A . n A 1 26 LYS 26 24 24 LYS LYS A . n A 1 27 THR 27 25 25 THR THR A . n A 1 28 LEU 28 26 26 LEU LEU A . n A 1 29 ARG 29 27 27 ARG ARG A . n A 1 30 ILE 30 28 28 ILE ILE A . n A 1 31 LYS 31 29 29 LYS LYS A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 SER 33 31 31 SER SER A . n A 1 34 ALA 34 32 32 ALA ALA A . n A 1 35 LEU 35 33 33 LEU LEU A . n A 1 36 LYS 36 34 34 LYS LYS A . n A 1 37 ARG 37 35 35 ARG ARG A . n A 1 38 THR 38 36 36 THR THR A . n A 1 39 ILE 39 37 37 ILE ILE A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 ASP 41 39 39 ASP ASP A . n A 1 42 LEU 42 40 40 LEU LEU A . n A 1 43 GLU 43 41 41 GLU GLU A . n A 1 44 PHE 44 42 42 PHE PHE A . n A 1 45 ALA 45 43 43 ALA ALA A . n A 1 46 LYS 46 44 44 LYS LYS A . n A 1 47 ARG 47 45 45 ARG ARG A . n A 1 48 GLU 48 46 46 GLU GLU A . n A 1 49 VAL 49 47 47 VAL VAL A . n A 1 50 GLU 50 48 48 GLU GLU A . n A 1 51 ARG 51 49 49 ARG ARG A . n A 1 52 GLU 52 50 50 GLU GLU A . n A 1 53 LEU 53 51 51 LEU LEU A . n A 1 54 GLN 54 52 52 GLN GLN A . n A 1 55 ARG 55 53 53 ARG ARG A . n A 1 56 LEU 56 54 54 LEU LEU A . n A 1 57 ASP 57 55 55 ASP ASP A . n A 1 58 THR 58 56 56 THR THR A . n A 1 59 LEU 59 57 57 LEU LEU A . n A 1 60 CYS 60 58 58 CYS CYS A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 SER 62 60 60 SER SER A . n A 1 63 ASP 63 61 61 ASP ASP A . n A 1 64 PRO 64 62 62 PRO PRO A . n A 1 65 ASP 65 63 63 ASP ASP A . n A 1 66 ARG 66 64 64 ARG ARG A . n A 1 67 VAL 67 65 65 VAL VAL A . n A 1 68 PRO 68 66 66 PRO PRO A . n A 1 69 GLN 69 67 67 GLN GLN A . n A 1 70 GLN 70 68 68 GLN GLN A . n A 1 71 THR 71 69 69 THR THR A . n A 1 72 LYS 72 70 70 LYS LYS A . n A 1 73 VAL 73 71 71 VAL VAL A . n A 1 74 VAL 74 72 72 VAL VAL A . n A 1 75 ASP 75 73 73 ASP ASP A . n A 1 76 GLU 76 74 74 GLU GLU A . n A 1 77 ALA 77 75 75 ALA ALA A . n A 1 78 GLN 78 76 76 GLN GLN A . n A 1 79 MET 79 77 77 MET MET A . n A 1 80 MET 80 78 78 MET MET A . n A 1 81 VAL 81 79 79 VAL VAL A . n A 1 82 PRO 82 80 80 PRO PRO A . n A 1 83 HIS 83 81 81 HIS HIS A . n A 1 84 SER 84 82 82 SER SER A . n A 1 85 VAL 85 83 83 VAL VAL A . n A 1 86 ASN 86 84 84 ASN ASN A . n A 1 87 ARG 87 85 85 ARG ARG A . n A 1 88 ILE 88 86 86 ILE ILE A . n A 1 89 MET 89 87 87 MET MET A . n A 1 90 ALA 90 88 88 ALA ALA A . n A 1 91 SER 91 89 89 SER SER A . n A 1 92 VAL 92 90 90 VAL VAL A . n A 1 93 LYS 93 91 91 LYS LYS A . n A 1 94 ASP 94 92 92 ASP ASP A . n A 1 95 LEU 95 93 93 LEU LEU A . n A 1 96 SER 96 94 94 SER SER A . n A 1 97 ASP 97 95 95 ASP ASP A . n A 1 98 TYR 98 96 96 TYR TYR A . n A 1 99 LEU 99 97 97 LEU LEU A . n A 1 100 GLU 100 98 98 GLU GLU A . n A 1 101 LYS 101 99 99 LYS LYS A . n A 1 102 GLU 102 100 100 GLU GLU A . n A 1 103 GLY 103 101 101 GLY GLY A . n A 1 104 SER 104 102 102 SER SER A . n A 1 105 THR 105 103 103 THR THR A . n A 1 106 VAL 106 104 104 VAL VAL A . n A 1 107 SER 107 105 105 SER SER A . n A 1 108 ASN 108 106 106 ASN ASN A . n A 1 109 GLU 109 107 107 GLU GLU A . n A 1 110 GLU 110 108 108 GLU GLU A . n A 1 111 LEU 111 109 109 LEU LEU A . n A 1 112 LEU 112 110 110 LEU LEU A . n A 1 113 ASP 113 111 111 ASP ASP A . n A 1 114 LEU 114 112 112 LEU LEU A . n A 1 115 ALA 115 113 113 ALA ALA A . n A 1 116 ARG 116 114 114 ARG ARG A . n A 1 117 ALA 117 115 115 ALA ALA A . n A 1 118 THR 118 116 116 THR THR A . n A 1 119 MET 119 117 117 MET MET A . n A 1 120 ALA 120 118 118 ALA ALA A . n A 1 121 ASP 121 119 119 ASP ASP A . n A 1 122 GLY 122 120 120 GLY GLY A . n A 1 123 GLN 123 121 121 GLN GLN A . n A 1 124 ALA 124 122 122 ALA ALA A . n A 1 125 ALA 125 123 123 ALA ALA A . n A 1 126 VAL 126 124 124 VAL VAL A . n A 1 127 SER 127 125 125 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1126 1126 SO4 SO4 A . C 3 GOL 1 1127 1127 GOL GOL A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-11-26 2 'Structure model' 1 1 2015-05-13 3 'Structure model' 1 2 2015-05-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.6.0117 ? 1 XDS 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 # _pdbx_entry_details.entry_id 4CQI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;TWO RESIDUES AT N-TERMINUS (GH) REMAIN FROM CLEAVED EXPRESSION TAG. ; # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 2011 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 2012 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 MET _pdbx_validate_rmsd_angle.auth_seq_id_1 77 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 SD _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 MET _pdbx_validate_rmsd_angle.auth_seq_id_2 77 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CE _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 MET _pdbx_validate_rmsd_angle.auth_seq_id_3 77 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 87.52 _pdbx_validate_rmsd_angle.angle_target_value 100.20 _pdbx_validate_rmsd_angle.angle_deviation -12.68 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 61 ? ? -165.54 69.32 2 1 LYS A 99 ? ? -106.48 -122.06 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A HIS 0 ? A HIS 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A SER 2 ? A SER 4 5 1 Y 1 A ASP 3 ? A ASP 5 6 1 Y 1 A SER 4 ? A SER 6 7 1 Y 1 A THR 5 ? A THR 7 8 1 Y 1 A GLU 6 ? A GLU 8 9 1 Y 1 A SER 7 ? A SER 9 10 1 Y 1 A THR 8 ? A THR 10 11 1 Y 1 A ASN 9 ? A ASN 11 12 1 Y 1 A ARG 10 ? A ARG 12 13 1 Y 1 A PHE 11 ? A PHE 13 14 1 Y 1 A ALA 12 ? A ALA 14 15 1 Y 1 A SER 13 ? A SER 15 16 1 Y 1 A ASN 14 ? A ASN 16 17 1 Y 1 A VAL 15 ? A VAL 17 18 1 Y 1 A ARG 16 ? A ARG 18 19 1 Y 1 A GLN 17 ? A GLN 19 20 1 Y 1 A ALA 18 ? A ALA 20 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 GLYCEROL GOL 4 water HOH #