data_4CRP # _entry.id 4CRP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4CRP pdb_00004crp 10.2210/pdb4crp/pdb PDBE EBI-59825 ? ? WWPDB D_1290059825 ? ? BMRB 19824 ? ? # _pdbx_database_related.db_id 19824 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4CRP _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2014-02-28 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shoemark, D.K.' 1 'Fahey, M.' 2 'Williams, C.' 3 'Sessions, R.B.' 4 'Crump, M.P.' 5 'Allen-Birt, S.J.' 6 # _citation.id primary _citation.title ;Design and Nuclear Magnetic Resonance (NMR) Structure Determination of the Second Extracellular Immunoglobulin Tyrosine Kinase a (Trkaig2) Domain Construct for Binding Site Elucidation in Drug Discovery ; _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 58 _citation.page_first 767 _citation.page_last ? _citation.year 2015 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25454499 _citation.pdbx_database_id_DOI 10.1021/JM501307E # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Allen, S.J.' 1 ? primary 'Watson, J.J.' 2 ? primary 'Shoemark, D.K.' 3 ? primary 'Barua, N.U.' 4 ? primary 'Patel, N.K.' 5 ? # _cell.entry_id 4CRP _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4CRP _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HIGH AFFINITY NERVE GROWTH FACTOR RECEPTOR' _entity.formula_weight 11792.068 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.10.1 _entity.pdbx_mutation YES _entity.pdbx_fragment 'EXTRACELLULAR NGF BINDING DOMAIN, RESIDUES 270-383' _entity.details 'P285C, F367C INTRODUCED TO ADD A DISULPHIDE BOND TO IMPROVE PROTEIN STABILITY' # _entity_name_com.entity_id 1 _entity_name_com.name ;NEUROTROPHIC TYROSINE KINASE RECEPTOR TYPE 1, TRK1-TRANSFORMING TYROSINE KINASE PROTEIN, TROPOMYOSIN-RELATED KINASE A, TYROSINE KINASE RECEPTOR, TYROSINE KINASE RECEPTOR A, TRK-A, GP140TRK, P140-TRKA ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DDDDDVSFCASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNN GNYTLLAANPCGQASASIMAAFMDNPF ; _entity_poly.pdbx_seq_one_letter_code_can ;DDDDDVSFCASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNN GNYTLLAANPCGQASASIMAAFMDNPF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ASP n 1 3 ASP n 1 4 ASP n 1 5 ASP n 1 6 VAL n 1 7 SER n 1 8 PHE n 1 9 CYS n 1 10 ALA n 1 11 SER n 1 12 VAL n 1 13 GLN n 1 14 LEU n 1 15 HIS n 1 16 THR n 1 17 ALA n 1 18 VAL n 1 19 GLU n 1 20 MET n 1 21 HIS n 1 22 HIS n 1 23 TRP n 1 24 CYS n 1 25 ILE n 1 26 PRO n 1 27 PHE n 1 28 SER n 1 29 VAL n 1 30 ASP n 1 31 GLY n 1 32 GLN n 1 33 PRO n 1 34 ALA n 1 35 PRO n 1 36 SER n 1 37 LEU n 1 38 ARG n 1 39 TRP n 1 40 LEU n 1 41 PHE n 1 42 ASN n 1 43 GLY n 1 44 SER n 1 45 VAL n 1 46 LEU n 1 47 ASN n 1 48 GLU n 1 49 THR n 1 50 SER n 1 51 PHE n 1 52 ILE n 1 53 PHE n 1 54 THR n 1 55 GLU n 1 56 PHE n 1 57 LEU n 1 58 GLU n 1 59 PRO n 1 60 ALA n 1 61 ALA n 1 62 ASN n 1 63 GLU n 1 64 THR n 1 65 VAL n 1 66 ARG n 1 67 HIS n 1 68 GLY n 1 69 CYS n 1 70 LEU n 1 71 ARG n 1 72 LEU n 1 73 ASN n 1 74 GLN n 1 75 PRO n 1 76 THR n 1 77 HIS n 1 78 VAL n 1 79 ASN n 1 80 ASN n 1 81 GLY n 1 82 ASN n 1 83 TYR n 1 84 THR n 1 85 LEU n 1 86 LEU n 1 87 ALA n 1 88 ALA n 1 89 ASN n 1 90 PRO n 1 91 CYS n 1 92 GLY n 1 93 GLN n 1 94 ALA n 1 95 SER n 1 96 ALA n 1 97 SER n 1 98 ILE n 1 99 MET n 1 100 ALA n 1 101 ALA n 1 102 PHE n 1 103 MET n 1 104 ASP n 1 105 ASN n 1 106 PRO n 1 107 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'PET SYSTEM' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET24A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NTRK1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P04629 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4CRP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04629 _struct_ref_seq.db_align_beg 282 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 383 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4CRP ASP A 1 ? UNP P04629 ? ? 'expression tag' 1 1 1 4CRP ASP A 2 ? UNP P04629 ? ? 'expression tag' 2 2 1 4CRP ASP A 4 ? UNP P04629 ? ? 'expression tag' 4 3 1 4CRP ASP A 5 ? UNP P04629 ? ? 'expression tag' 5 4 1 4CRP CYS A 9 ? UNP P04629 PRO 285 'engineered mutation' 9 5 1 4CRP CYS A 91 ? UNP P04629 PHE 367 'engineered mutation' 91 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 HNCA 1 4 1 HNCACB 1 5 1 CCONH 1 6 1 HCCH-TOCSY 1 7 1 HCCONH 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% H2O, 10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model VNMRS _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 4CRP _pdbx_nmr_refine.method 'ARIA 2.3' _pdbx_nmr_refine.details 'WATER REFINED USING THE RECOORD PROTOCOL' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 4CRP _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 15N AND 13C, 15N-LABELED SAMPLES' # _pdbx_nmr_ensemble.entry_id 4CRP _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY, LEAST VIOLATION' # _pdbx_nmr_representative.entry_id 4CRP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-KUNSTLEVE, JIANG,KUSZEWSKI,NILGES,PANNU,READ,RICE,SIMONSON, WARREN' 1 'structure solution' CNS 1.2 ? 2 # _exptl.entry_id 4CRP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 4CRP _struct.title 'Solution structure of a TrkAIg2 domain construct for use in drug discovery' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4CRP _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'TRANSFERASE, TRKAIG2, NMR CONSTRUCT, PAIN, ALZHEIMERS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 91 SG ? ? A CYS 9 A CYS 91 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 69 SG ? ? A CYS 24 A CYS 69 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 4 ? AB ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 SER A 11 ? LEU A 14 ? SER A 11 LEU A 14 AA 2 TRP A 23 ? ASP A 30 ? TRP A 23 ASP A 30 AA 3 VAL A 65 ? LEU A 72 ? VAL A 65 LEU A 72 AA 4 ILE A 52 ? LEU A 57 ? ILE A 52 LEU A 57 AB 1 SER A 44 ? VAL A 45 ? SER A 44 VAL A 45 AB 2 SER A 36 ? PHE A 41 ? SER A 36 PHE A 41 AB 3 ASN A 82 ? ALA A 88 ? ASN A 82 ALA A 88 AB 4 GLN A 93 ? MET A 99 ? GLN A 93 MET A 99 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N GLN A 13 ? N GLN A 13 O SER A 28 ? O SER A 28 AA 2 3 N VAL A 29 ? N VAL A 29 O ARG A 66 ? O ARG A 66 AA 3 4 N ARG A 71 ? N ARG A 71 O PHE A 53 ? O PHE A 53 AB 1 2 N SER A 44 ? N SER A 44 O PHE A 41 ? O PHE A 41 AB 2 3 N LEU A 40 ? N LEU A 40 O THR A 84 ? O THR A 84 AB 3 4 N ALA A 87 ? N ALA A 87 O ALA A 94 ? O ALA A 94 # _database_PDB_matrix.entry_id 4CRP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4CRP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 PHE 107 107 107 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-01-14 2 'Structure model' 1 1 2015-02-04 3 'Structure model' 1 2 2016-04-27 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Atomic model' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_cs' 4 4 'Structure model' '_pdbx_database_status.status_code_mr' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 4CRP _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;ENGINEERED N-TERMINAL ASP TAG (RESIDUES 1-5) AND DISULPHIDE BOND. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH12 A ARG 38 ? ? OE1 A GLU 48 ? ? 1.59 2 4 H1 A ASP 1 ? ? OD2 A ASP 3 ? ? 1.57 3 4 OD2 A ASP 30 ? ? HG1 A THR 64 ? ? 1.60 4 12 H2 A ASP 1 ? ? OD1 A ASP 4 ? ? 1.59 5 13 OE2 A GLU 48 ? ? HG1 A THR 54 ? ? 1.59 6 19 OE1 A GLU 63 ? ? HE2 A HIS 67 ? ? 1.60 7 23 HH12 A ARG 38 ? ? OE1 A GLU 48 ? ? 1.59 8 24 HD21 A ASN 79 ? ? HH A TYR 83 ? ? 1.23 9 25 OE1 A GLU 63 ? ? HE2 A HIS 67 ? ? 1.58 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 8 CE1 A TYR 83 ? ? CZ A TYR 83 ? ? 1.293 1.381 -0.088 0.013 N 2 16 CE1 A TYR 83 ? ? CZ A TYR 83 ? ? 1.301 1.381 -0.080 0.013 N 3 21 CE1 A TYR 83 ? ? CZ A TYR 83 ? ? 1.287 1.381 -0.094 0.013 N 4 21 CZ A TYR 83 ? ? CE2 A TYR 83 ? ? 1.462 1.381 0.081 0.013 N 5 24 CE1 A TYR 83 ? ? CZ A TYR 83 ? ? 1.282 1.381 -0.099 0.013 N 6 24 CZ A TYR 83 ? ? CE2 A TYR 83 ? ? 1.470 1.381 0.089 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 49 ? ? -126.26 -165.69 2 1 HIS A 77 ? ? -58.54 -6.40 3 1 PHE A 102 ? ? -100.07 78.43 4 2 ASP A 4 ? ? 38.60 54.89 5 2 ASN A 42 ? ? 59.58 17.70 6 2 THR A 49 ? ? -127.16 -165.97 7 2 ASN A 79 ? ? -78.58 26.97 8 2 ASN A 80 ? ? -110.86 53.47 9 3 ASP A 2 ? ? -93.74 -72.30 10 3 VAL A 6 ? ? -50.04 99.55 11 3 CYS A 9 ? ? -92.40 -159.39 12 4 THR A 49 ? ? -103.90 -165.44 13 5 ASP A 3 ? ? -87.87 46.73 14 5 GLU A 19 ? ? -68.54 89.43 15 5 THR A 49 ? ? -106.67 -167.39 16 5 GLU A 58 ? ? -50.94 102.88 17 5 PHE A 102 ? ? -103.47 -87.46 18 6 ASP A 2 ? ? -166.07 -61.20 19 6 GLU A 58 ? ? -47.56 102.05 20 6 PHE A 102 ? ? -93.68 -79.12 21 7 ASP A 2 ? ? 58.53 79.97 22 7 ASP A 4 ? ? -157.61 -51.57 23 7 PHE A 102 ? ? -111.77 -78.93 24 8 ASP A 4 ? ? 59.98 14.14 25 8 THR A 49 ? ? -108.21 -163.84 26 8 PHE A 102 ? ? -65.54 -71.76 27 9 ASP A 2 ? ? 68.89 130.78 28 9 THR A 49 ? ? -120.77 -166.96 29 9 PHE A 102 ? ? -156.99 73.95 30 10 MET A 20 ? ? -169.70 -169.84 31 10 PHE A 102 ? ? -99.29 -84.05 32 11 MET A 20 ? ? -170.30 -177.65 33 11 ASN A 79 ? ? -78.03 26.87 34 12 ASP A 2 ? ? -135.29 -51.13 35 12 PHE A 102 ? ? -92.64 -78.56 36 13 THR A 49 ? ? -104.13 -162.89 37 14 THR A 49 ? ? -123.87 -163.79 38 15 MET A 20 ? ? -166.26 -162.46 39 15 PHE A 102 ? ? -84.37 -72.80 40 16 THR A 49 ? ? -118.48 -166.87 41 16 PHE A 102 ? ? -78.02 -70.87 42 17 VAL A 6 ? ? -68.34 99.33 43 17 GLU A 19 ? ? -67.78 92.26 44 17 GLN A 32 ? ? -122.55 -51.94 45 18 MET A 20 ? ? -170.61 -171.70 46 19 PHE A 102 ? ? -161.33 92.75 47 20 ASP A 2 ? ? -150.67 77.81 48 20 THR A 49 ? ? -126.64 -163.69 49 21 MET A 20 ? ? -176.86 -166.91 50 21 PHE A 102 ? ? -84.97 -76.88 51 22 ASN A 79 ? ? -78.63 26.22 52 22 PHE A 102 ? ? -101.01 -77.05 53 22 ASN A 105 ? ? -55.29 109.15 54 23 ASP A 2 ? ? -104.34 -86.08 55 23 ASP A 5 ? ? -120.47 -50.41 56 23 GLU A 48 ? ? -68.89 92.93 57 24 THR A 64 ? ? -95.64 30.75 58 24 PHE A 102 ? ? -67.97 -71.26 59 25 GLU A 58 ? ? -47.64 105.95 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 23 ARG A 71 ? ? 0.073 'SIDE CHAIN' 2 23 TYR A 83 ? ? 0.059 'SIDE CHAIN' #