data_4F8O # _entry.id 4F8O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4F8O RCSB RCSB072594 WWPDB D_1000072594 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4F8L . unspecified PDB 4F8N . unspecified PDB 4F8P . unspecified # _pdbx_database_status.entry_id 4F8O _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-05-17 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bao, R.' 1 'Esser, L.' 2 'Xia, D.' 3 # _citation.id primary _citation.title ;Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis. ; _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 110 _citation.page_first 1065 _citation.page_last 1070 _citation.year 2013 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23277582 _citation.pdbx_database_id_DOI 10.1073/pnas.1212431110 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bao, R.' 1 ? primary 'Nair, M.K.' 2 ? primary 'Tang, W.K.' 3 ? primary 'Esser, L.' 4 ? primary 'Sadhukhan, A.' 5 ? primary 'Holland, R.L.' 6 ? primary 'Xia, D.' 7 ? primary 'Schifferli, D.M.' 8 ? # _cell.length_a 26.264 _cell.length_b 55.694 _cell.length_c 103.818 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4F8O _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 2 2 21' _symmetry.entry_id 4F8O _symmetry.Int_Tables_number 17 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'pH 6 antigen' 16249.079 1 ? ? ? ? 2 branched man 'beta-D-galactopyranose-(1-4)-beta-D-glucopyranose' 342.297 1 ? ? ? ? 3 non-polymer syn GUANIDINE 59.070 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 non-polymer syn '4-(2-AMINOETHYL)BENZENESULFONYL FLUORIDE' 203.234 1 ? ? ? ? 6 water nat water 18.015 101 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Adhesin, Antigen 4' 2 beta-lactose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNTFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYIN DDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFDNKQSTVINSKDVSGEVTVKQGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNTFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYIN DDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFDNKQSTVINSKDVSGEVTVKQGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 THR n 1 4 PHE n 1 5 HIS n 1 6 VAL n 1 7 ASP n 1 8 PHE n 1 9 ALA n 1 10 PRO n 1 11 ASN n 1 12 THR n 1 13 GLY n 1 14 GLU n 1 15 ILE n 1 16 PHE n 1 17 ALA n 1 18 GLY n 1 19 LYS n 1 20 GLN n 1 21 PRO n 1 22 GLY n 1 23 ASP n 1 24 VAL n 1 25 THR n 1 26 MET n 1 27 PHE n 1 28 THR n 1 29 LEU n 1 30 THR n 1 31 MET n 1 32 GLY n 1 33 ASP n 1 34 THR n 1 35 ALA n 1 36 PRO n 1 37 HIS n 1 38 GLY n 1 39 GLY n 1 40 TRP n 1 41 ARG n 1 42 LEU n 1 43 ILE n 1 44 PRO n 1 45 THR n 1 46 GLY n 1 47 ASP n 1 48 SER n 1 49 LYS n 1 50 GLY n 1 51 GLY n 1 52 TYR n 1 53 MET n 1 54 ILE n 1 55 SER n 1 56 ALA n 1 57 ASP n 1 58 GLY n 1 59 ASP n 1 60 TYR n 1 61 VAL n 1 62 GLY n 1 63 LEU n 1 64 TYR n 1 65 SER n 1 66 TYR n 1 67 MET n 1 68 MET n 1 69 SER n 1 70 TRP n 1 71 VAL n 1 72 GLY n 1 73 ILE n 1 74 ASP n 1 75 ASN n 1 76 ASN n 1 77 TRP n 1 78 TYR n 1 79 ILE n 1 80 ASN n 1 81 ASP n 1 82 ASP n 1 83 SER n 1 84 PRO n 1 85 LYS n 1 86 ASP n 1 87 ILE n 1 88 LYS n 1 89 ASP n 1 90 HIS n 1 91 LEU n 1 92 TYR n 1 93 VAL n 1 94 LYS n 1 95 ALA n 1 96 GLY n 1 97 THR n 1 98 VAL n 1 99 LEU n 1 100 LYS n 1 101 PRO n 1 102 THR n 1 103 THR n 1 104 TYR n 1 105 LYS n 1 106 PHE n 1 107 THR n 1 108 GLY n 1 109 ARG n 1 110 VAL n 1 111 GLU n 1 112 GLU n 1 113 TYR n 1 114 VAL n 1 115 PHE n 1 116 ASP n 1 117 ASN n 1 118 LYS n 1 119 GLN n 1 120 SER n 1 121 THR n 1 122 VAL n 1 123 ILE n 1 124 ASN n 1 125 SER n 1 126 LYS n 1 127 ASP n 1 128 VAL n 1 129 SER n 1 130 GLY n 1 131 GLU n 1 132 VAL n 1 133 THR n 1 134 VAL n 1 135 LYS n 1 136 GLN n 1 137 GLY n 1 138 LEU n 1 139 GLU n 1 140 HIS n 1 141 HIS n 1 142 HIS n 1 143 HIS n 1 144 HIS n 1 145 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 2 115 ? ? 'psaA, YPO1303, y2882, YP_1289' ? ? ? ? ? ? 'Yersinia pestis' 632 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample ? 120 137 ? ? 'psaA, YPO1303, y2882, YP_1289' ? ? ? ? ? ? 'Yersinia pestis' 632 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP PSAA_YERPE P31522 1 ;NTFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYIND DSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVF ; 45 ? 2 UNP PSAA_YERPE P31522 1 STVINSKDVSGEVTVKQG 27 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4F8O A 2 ? 115 ? P31522 45 ? 158 ? 2 115 2 2 4F8O A 120 ? 137 ? P31522 27 ? 44 ? 120 137 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4F8O MET A 1 ? UNP P31522 ? ? 'expression tag' 1 1 1 4F8O ASP A 116 ? UNP P31522 ? ? linker 116 2 1 4F8O ASN A 117 ? UNP P31522 ? ? linker 117 3 1 4F8O LYS A 118 ? UNP P31522 ? ? linker 118 4 1 4F8O GLN A 119 ? UNP P31522 ? ? linker 119 5 2 4F8O LEU A 138 ? UNP P31522 ? ? 'expression tag' 138 6 2 4F8O GLU A 139 ? UNP P31522 ? ? 'expression tag' 139 7 2 4F8O HIS A 140 ? UNP P31522 ? ? 'expression tag' 140 8 2 4F8O HIS A 141 ? UNP P31522 ? ? 'expression tag' 141 9 2 4F8O HIS A 142 ? UNP P31522 ? ? 'expression tag' 142 10 2 4F8O HIS A 143 ? UNP P31522 ? ? 'expression tag' 143 11 2 4F8O HIS A 144 ? UNP P31522 ? ? 'expression tag' 144 12 2 4F8O HIS A 145 ? UNP P31522 ? ? 'expression tag' 145 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AES non-polymer . '4-(2-AMINOETHYL)BENZENESULFONYL FLUORIDE' AEBSF 'C8 H10 F N O2 S' 203.234 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BGC 'D-saccharide, beta linking' . beta-D-glucopyranose ? 'C6 H12 O6' 180.156 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GAI non-polymer . GUANIDINE ? 'C H5 N3' 59.070 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose ? 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4F8O _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 47.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details 'ammonium sulphate, Guanidine HCl, pH 4.2, vapor diffusion, hanging drop, temperature 298K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date 2010-11-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22-ID # _reflns.entry_id 4F8O _reflns.d_resolution_high 1.610 _reflns.d_resolution_low 50.000 _reflns.number_obs 16080 _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.pdbx_netI_over_sigmaI 7.400 _reflns.pdbx_chi_squared 0.974 _reflns.pdbx_redundancy 2.600 _reflns.percent_possible_obs 92.500 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.610 1.670 ? ? ? 0.467 ? ? 0.616 1.900 ? 1465 84.700 1 1 1.670 1.730 ? ? ? 0.453 ? ? 0.725 2.000 ? 1432 86.400 2 1 1.730 1.810 ? ? ? 0.432 ? ? 1.002 2.100 ? 1527 89.500 3 1 1.810 1.910 ? ? ? 0.394 ? ? 1.092 2.300 ? 1577 91.600 4 1 1.910 2.030 ? ? ? 0.340 ? ? 1.075 2.500 ? 1589 93.900 5 1 2.030 2.190 ? ? ? 0.270 ? ? 1.042 2.800 ? 1607 93.500 6 1 2.190 2.400 ? ? ? 0.212 ? ? 1.041 2.900 ? 1664 95.900 7 1 2.400 2.750 ? ? ? 0.151 ? ? 1.010 3.000 ? 1703 96.400 8 1 2.750 3.470 ? ? ? 0.085 ? ? 0.934 3.000 ? 1694 96.100 9 1 3.470 50.000 ? ? ? 0.054 ? ? 0.953 3.200 ? 1822 95.700 10 1 # _refine.entry_id 4F8O _refine.ls_d_res_high 1.9000 _refine.ls_d_res_low 15.3870 _refine.pdbx_ls_sigma_F 1.460 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 94.9900 _refine.ls_number_reflns_obs 12006 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2433 _refine.ls_R_factor_R_work 0.2411 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2863 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.9800 _refine.ls_number_reflns_R_free 598 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 27.0788 _refine.solvent_model_param_bsol 44.6590 _refine.solvent_model_param_ksol 0.3770 _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -0.5274 _refine.aniso_B[2][2] 0.2920 _refine.aniso_B[3][3] 0.2354 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.6900 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.0000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.7300 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 69.490 _refine.B_iso_min 5.860 _refine.pdbx_overall_phase_error 26.9100 _refine.occupancy_max 1.000 _refine.occupancy_min 0.320 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1069 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 44 _refine_hist.number_atoms_solvent 101 _refine_hist.number_atoms_total 1214 _refine_hist.d_res_high 1.9000 _refine_hist.d_res_low 15.3870 # _struct.entry_id 4F8O _struct.title 'X-ray structure of PsaA from Yersinia pestis, in complex with lactose and AEBSF' _struct.pdbx_descriptor 'pH 6 antigen' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4F8O _struct_keywords.text 'Antigens, Bacterial Proteins, Fimbriae, Molecular Sequence Data, Protein Folding, Ig-fold, CELL ADHESION-inhibitor complex' _struct_keywords.pdbx_keywords 'CELL ADHESION/inhibitor' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 6 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 46 ? LYS A 49 ? GLY A 46 LYS A 49 5 ? 4 HELX_P HELX_P2 2 GLY A 72 ? ASN A 75 ? GLY A 72 ASN A 75 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A TYR 52 OH ? ? ? 1_555 F AES . S ? ? A TYR 52 A AES 205 1_555 ? ? ? ? ? ? ? 1.548 ? ? covale2 covale both ? B BGC . O4 ? ? ? 1_555 B GAL . C1 ? ? B BGC 1 B GAL 2 1_555 ? ? ? ? ? ? ? 1.423 sing ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 117 A . ? ASN 117 A LYS 118 A ? LYS 118 A 1 -21.53 2 GLY 137 A . ? GLY 137 A LEU 138 A ? LEU 138 A 1 16.72 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 6 ? D ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel C 4 5 ? anti-parallel C 5 6 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel D 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 5 ? PRO A 10 ? HIS A 5 PRO A 10 A 2 VAL A 24 ? GLY A 32 ? VAL A 24 GLY A 32 A 3 ILE A 87 ? VAL A 93 ? ILE A 87 VAL A 93 A 4 TYR A 64 ? SER A 65 ? TYR A 64 SER A 65 B 1 GLY A 18 ? LYS A 19 ? GLY A 18 LYS A 19 B 2 VAL A 98 ? LEU A 99 ? VAL A 98 LEU A 99 C 1 TYR A 60 ? GLY A 62 ? TYR A 60 GLY A 62 C 2 TYR A 52 ? SER A 55 ? TYR A 52 SER A 55 C 3 THR A 103 ? PHE A 115 ? THR A 103 PHE A 115 C 4 GLY A 39 ? PRO A 44 ? GLY A 39 PRO A 44 C 5 ASN A 76 ? ASN A 80 ? ASN A 76 ASN A 80 C 6 SER A 69 ? VAL A 71 ? SER A 69 VAL A 71 D 1 TYR A 60 ? GLY A 62 ? TYR A 60 GLY A 62 D 2 TYR A 52 ? SER A 55 ? TYR A 52 SER A 55 D 3 THR A 103 ? PHE A 115 ? THR A 103 PHE A 115 D 4 SER A 120 ? THR A 133 ? SER A 120 THR A 133 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 5 ? N HIS A 5 O GLY A 32 ? O GLY A 32 A 2 3 N MET A 26 ? N MET A 26 O LEU A 91 ? O LEU A 91 A 3 4 O TYR A 92 ? O TYR A 92 N TYR A 64 ? N TYR A 64 B 1 2 N GLY A 18 ? N GLY A 18 O LEU A 99 ? O LEU A 99 C 1 2 O VAL A 61 ? O VAL A 61 N MET A 53 ? N MET A 53 C 2 3 N ILE A 54 ? N ILE A 54 O LYS A 105 ? O LYS A 105 C 3 4 O ARG A 109 ? O ARG A 109 N ILE A 43 ? N ILE A 43 C 4 5 N TRP A 40 ? N TRP A 40 O ILE A 79 ? O ILE A 79 C 5 6 O ASN A 76 ? O ASN A 76 N VAL A 71 ? N VAL A 71 D 1 2 O VAL A 61 ? O VAL A 61 N MET A 53 ? N MET A 53 D 2 3 N ILE A 54 ? N ILE A 54 O LYS A 105 ? O LYS A 105 D 3 4 N GLU A 112 ? N GLU A 112 O ILE A 123 ? O ILE A 123 # _atom_sites.entry_id 4F8O _atom_sites.fract_transf_matrix[1][1] 0.038075 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017955 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009632 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H N O S # loop_ _database_PDB_caveat.text 'BGC B 1 HAS WRONG CHIRALITY AT ATOM C1' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET ALA A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 LEU 138 138 138 LEU ALA A . n A 1 139 GLU 139 139 ? ? ? A . n A 1 140 HIS 140 140 ? ? ? A . n A 1 141 HIS 141 141 ? ? ? A . n A 1 142 HIS 142 142 ? ? ? A . n A 1 143 HIS 143 143 ? ? ? A . n A 1 144 HIS 144 144 ? ? ? A . n A 1 145 HIS 145 145 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GAI 1 202 1 GAI GAI A . D 3 GAI 1 203 1 GAI GAI A . E 4 CL 1 204 1 CL CL A . F 5 AES 1 205 1 AES 2AB A . G 6 HOH 1 301 1 HOH HOH A . G 6 HOH 2 302 3 HOH HOH A . G 6 HOH 3 303 4 HOH HOH A . G 6 HOH 4 304 5 HOH HOH A . G 6 HOH 5 305 6 HOH HOH A . G 6 HOH 6 306 7 HOH HOH A . G 6 HOH 7 307 8 HOH HOH A . G 6 HOH 8 308 9 HOH HOH A . G 6 HOH 9 309 10 HOH HOH A . G 6 HOH 10 310 11 HOH HOH A . G 6 HOH 11 311 12 HOH HOH A . G 6 HOH 12 312 13 HOH HOH A . G 6 HOH 13 313 14 HOH HOH A . G 6 HOH 14 314 15 HOH HOH A . G 6 HOH 15 315 16 HOH HOH A . G 6 HOH 16 316 17 HOH HOH A . G 6 HOH 17 317 18 HOH HOH A . G 6 HOH 18 318 19 HOH HOH A . G 6 HOH 19 319 20 HOH HOH A . G 6 HOH 20 320 21 HOH HOH A . G 6 HOH 21 321 22 HOH HOH A . G 6 HOH 22 322 23 HOH HOH A . G 6 HOH 23 323 24 HOH HOH A . G 6 HOH 24 324 27 HOH HOH A . G 6 HOH 25 325 29 HOH HOH A . G 6 HOH 26 326 30 HOH HOH A . G 6 HOH 27 327 31 HOH HOH A . G 6 HOH 28 328 32 HOH HOH A . G 6 HOH 29 329 33 HOH HOH A . G 6 HOH 30 330 34 HOH HOH A . G 6 HOH 31 331 35 HOH HOH A . G 6 HOH 32 332 36 HOH HOH A . G 6 HOH 33 333 37 HOH HOH A . G 6 HOH 34 334 38 HOH HOH A . G 6 HOH 35 335 39 HOH HOH A . G 6 HOH 36 336 40 HOH HOH A . G 6 HOH 37 337 41 HOH HOH A . G 6 HOH 38 338 42 HOH HOH A . G 6 HOH 39 339 43 HOH HOH A . G 6 HOH 40 340 44 HOH HOH A . G 6 HOH 41 341 45 HOH HOH A . G 6 HOH 42 342 46 HOH HOH A . G 6 HOH 43 343 47 HOH HOH A . G 6 HOH 44 344 48 HOH HOH A . G 6 HOH 45 345 49 HOH HOH A . G 6 HOH 46 346 50 HOH HOH A . G 6 HOH 47 347 51 HOH HOH A . G 6 HOH 48 348 52 HOH HOH A . G 6 HOH 49 349 53 HOH HOH A . G 6 HOH 50 350 54 HOH HOH A . G 6 HOH 51 351 55 HOH HOH A . G 6 HOH 52 352 56 HOH HOH A . G 6 HOH 53 353 58 HOH HOH A . G 6 HOH 54 354 59 HOH HOH A . G 6 HOH 55 355 60 HOH HOH A . G 6 HOH 56 356 61 HOH HOH A . G 6 HOH 57 357 62 HOH HOH A . G 6 HOH 58 358 63 HOH HOH A . G 6 HOH 59 359 64 HOH HOH A . G 6 HOH 60 360 65 HOH HOH A . G 6 HOH 61 361 66 HOH HOH A . G 6 HOH 62 362 67 HOH HOH A . G 6 HOH 63 363 68 HOH HOH A . G 6 HOH 64 364 69 HOH HOH A . G 6 HOH 65 365 70 HOH HOH A . G 6 HOH 66 366 71 HOH HOH A . G 6 HOH 67 367 72 HOH HOH A . G 6 HOH 68 368 73 HOH HOH A . G 6 HOH 69 369 74 HOH HOH A . G 6 HOH 70 370 75 HOH HOH A . G 6 HOH 71 371 76 HOH HOH A . G 6 HOH 72 372 77 HOH HOH A . G 6 HOH 73 373 78 HOH HOH A . G 6 HOH 74 374 79 HOH HOH A . G 6 HOH 75 375 80 HOH HOH A . G 6 HOH 76 376 81 HOH HOH A . G 6 HOH 77 377 82 HOH HOH A . G 6 HOH 78 378 83 HOH HOH A . G 6 HOH 79 379 84 HOH HOH A . G 6 HOH 80 380 85 HOH HOH A . G 6 HOH 81 381 86 HOH HOH A . G 6 HOH 82 382 87 HOH HOH A . G 6 HOH 83 383 88 HOH HOH A . G 6 HOH 84 384 89 HOH HOH A . G 6 HOH 85 385 90 HOH HOH A . G 6 HOH 86 386 91 HOH HOH A . G 6 HOH 87 387 92 HOH HOH A . G 6 HOH 88 388 93 HOH HOH A . G 6 HOH 89 389 94 HOH HOH A . G 6 HOH 90 390 95 HOH HOH A . G 6 HOH 91 391 96 HOH HOH A . G 6 HOH 92 392 97 HOH HOH A . G 6 HOH 93 393 98 HOH HOH A . G 6 HOH 94 394 99 HOH HOH A . G 6 HOH 95 395 100 HOH HOH A . G 6 HOH 96 396 101 HOH HOH A . G 6 HOH 97 397 102 HOH HOH A . G 6 HOH 98 398 103 HOH HOH A . G 6 HOH 99 399 104 HOH HOH A . G 6 HOH 100 400 105 HOH HOH A . G 6 HOH 101 401 106 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_900004 _pdbx_molecule_features.name beta-lactose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Nutrient _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900004 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 302 ? G HOH . 2 1 A HOH 374 ? G HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-05-22 2 'Structure model' 1 1 2013-08-07 3 'Structure model' 1 2 2017-08-16 4 'Structure model' 1 3 2017-11-15 5 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Refinement description' 3 3 'Structure model' 'Source and taxonomy' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' Advisory 6 5 'Structure model' 'Atomic model' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Derived calculations' 10 5 'Structure model' 'Non-polymer description' 11 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' entity_src_gen 2 3 'Structure model' software 3 4 'Structure model' software 4 5 'Structure model' atom_site 5 5 'Structure model' chem_comp 6 5 'Structure model' database_PDB_caveat 7 5 'Structure model' entity 8 5 'Structure model' entity_name_com 9 5 'Structure model' pdbx_branch_scheme 10 5 'Structure model' pdbx_chem_comp_identifier 11 5 'Structure model' pdbx_entity_branch 12 5 'Structure model' pdbx_entity_branch_descriptor 13 5 'Structure model' pdbx_entity_branch_link 14 5 'Structure model' pdbx_entity_branch_list 15 5 'Structure model' pdbx_entity_nonpoly 16 5 'Structure model' pdbx_molecule_features 17 5 'Structure model' pdbx_nonpoly_scheme 18 5 'Structure model' pdbx_validate_chiral 19 5 'Structure model' struct_conn 20 5 'Structure model' struct_ref_seq_dif 21 5 'Structure model' struct_site 22 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.contact_author' 3 4 'Structure model' '_software.contact_author_email' 4 4 'Structure model' '_software.date' 5 4 'Structure model' '_software.language' 6 4 'Structure model' '_software.location' 7 4 'Structure model' '_software.name' 8 4 'Structure model' '_software.type' 9 4 'Structure model' '_software.version' 10 5 'Structure model' '_atom_site.B_iso_or_equiv' 11 5 'Structure model' '_atom_site.Cartn_x' 12 5 'Structure model' '_atom_site.Cartn_y' 13 5 'Structure model' '_atom_site.Cartn_z' 14 5 'Structure model' '_atom_site.auth_asym_id' 15 5 'Structure model' '_atom_site.auth_atom_id' 16 5 'Structure model' '_atom_site.auth_comp_id' 17 5 'Structure model' '_atom_site.auth_seq_id' 18 5 'Structure model' '_atom_site.label_atom_id' 19 5 'Structure model' '_atom_site.label_comp_id' 20 5 'Structure model' '_atom_site.type_symbol' 21 5 'Structure model' '_chem_comp.formula' 22 5 'Structure model' '_chem_comp.formula_weight' 23 5 'Structure model' '_chem_comp.id' 24 5 'Structure model' '_chem_comp.mon_nstd_flag' 25 5 'Structure model' '_chem_comp.name' 26 5 'Structure model' '_chem_comp.type' 27 5 'Structure model' '_database_PDB_caveat.text' 28 5 'Structure model' '_entity.formula_weight' 29 5 'Structure model' '_entity.pdbx_description' 30 5 'Structure model' '_entity.type' 31 5 'Structure model' '_pdbx_validate_chiral.auth_asym_id' 32 5 'Structure model' '_pdbx_validate_chiral.auth_atom_id' 33 5 'Structure model' '_pdbx_validate_chiral.auth_comp_id' 34 5 'Structure model' '_pdbx_validate_chiral.auth_seq_id' 35 5 'Structure model' '_struct_ref_seq_dif.details' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 1.610 _diffrn_reflns.pdbx_d_res_low 50.000 _diffrn_reflns.pdbx_number_obs 16080 _diffrn_reflns.pdbx_Rmerge_I_obs 0.115 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared 0.97 _diffrn_reflns.av_sigmaI_over_netI 6.29 _diffrn_reflns.pdbx_redundancy 2.60 _diffrn_reflns.pdbx_percent_possible_obs 92.50 _diffrn_reflns.number 41798 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 3.47 50.00 ? ? 0.054 ? 0.953 3.20 95.70 1 2.75 3.47 ? ? 0.085 ? 0.934 3.00 96.10 1 2.40 2.75 ? ? 0.151 ? 1.010 3.00 96.40 1 2.19 2.40 ? ? 0.212 ? 1.041 2.90 95.90 1 2.03 2.19 ? ? 0.270 ? 1.042 2.80 93.50 1 1.91 2.03 ? ? 0.340 ? 1.075 2.50 93.90 1 1.81 1.91 ? ? 0.394 ? 1.092 2.30 91.60 1 1.73 1.81 ? ? 0.432 ? 1.002 2.10 89.50 1 1.67 1.73 ? ? 0.453 ? 0.725 2.00 86.40 1 1.61 1.67 ? ? 0.467 ? 0.616 1.90 84.70 # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? package 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 PHASER . ? program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 4 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 5 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 HKL-2000 . ? ? ? ? 'data collection' ? ? ? 7 PHENIX 1.7.2_869 ? ? ? ? refinement ? ? ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG A SER 83 ? ? H A LYS 85 ? ? 1.17 2 1 H A ASP 33 ? ? O A HOH 353 ? ? 1.32 3 1 HZ1 A LYS 135 ? ? O A HOH 379 ? ? 1.57 4 1 OE1 A GLN 119 ? ? O A HOH 373 ? ? 1.59 5 1 NZ A LYS 135 ? ? O A HOH 379 ? ? 2.05 6 1 N A ASP 33 ? ? O A HOH 353 ? ? 2.11 7 1 OH A TYR 66 ? ? O A HOH 330 ? ? 2.16 8 1 O1S A AES 205 ? ? O A HOH 401 ? ? 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASN _pdbx_validate_rmsd_angle.auth_seq_id_1 2 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASN _pdbx_validate_rmsd_angle.auth_seq_id_2 2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASN _pdbx_validate_rmsd_angle.auth_seq_id_3 2 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 137.19 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation 26.19 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 95 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -36.86 _pdbx_validate_torsion.psi 123.38 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C1 _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id B _pdbx_validate_chiral.auth_comp_id BGC _pdbx_validate_chiral.auth_seq_id 1 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 1 CG 2 1 Y 1 A MET 1 ? SD ? A MET 1 SD 3 1 Y 1 A MET 1 ? CE ? A MET 1 CE 4 1 Y 1 A LEU 138 ? CG ? A LEU 138 CG 5 1 Y 1 A LEU 138 ? CD1 ? A LEU 138 CD1 6 1 Y 1 A LEU 138 ? CD2 ? A LEU 138 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 139 ? A GLU 139 2 1 Y 1 A HIS 140 ? A HIS 140 3 1 Y 1 A HIS 141 ? A HIS 141 4 1 Y 1 A HIS 142 ? A HIS 142 5 1 Y 1 A HIS 143 ? A HIS 143 6 1 Y 1 A HIS 144 ? A HIS 144 7 1 Y 1 A HIS 145 ? A HIS 145 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BGC 1 B BGC 1 E LAT 1 n B 2 GAL 2 B GAL 2 E LAT 1 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpb BGC 'COMMON NAME' GMML 1.0 b-D-glucopyranose BGC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Glcp BGC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGalpb1-4DGlcpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5][a2112h-1b_1-5]/1-2/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][a-D-Glcp]{[(4+1)][b-D-Galp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 GAL _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 BGC _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BGC 1 n 2 GAL 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GUANIDINE GAI 4 'CHLORIDE ION' CL 5 '4-(2-AMINOETHYL)BENZENESULFONYL FLUORIDE' AES 6 water HOH #