data_4H9K # _entry.id 4H9K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4H9K pdb_00004h9k 10.2210/pdb4h9k/pdb RCSB RCSB075190 ? ? WWPDB D_1000075190 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4H9J _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4H9K _pdbx_database_status.recvd_initial_deposition_date 2012-09-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gottipati, K.' 1 'Ruggli, N.' 2 'Gerber, M.' 3 'Tratschin, J.-D.' 4 'Benning, M.' 5 'Bellamy, H.' 6 'Choi, K.H.' 7 # _citation.id primary _citation.title ;The Structure of Classical Swine Fever Virus N(pro): A Novel Cysteine Autoprotease and Zinc-Binding Protein Involved in Subversion of Type I Interferon Induction. ; _citation.journal_abbrev 'Plos Pathog.' _citation.journal_volume 9 _citation.page_first e1003704 _citation.page_last e1003704 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1553-7366 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24146623 _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1003704 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gottipati, K.' 1 ? primary 'Ruggli, N.' 2 ? primary 'Gerber, M.' 3 ? primary 'Tratschin, J.D.' 4 ? primary 'Benning, M.' 5 ? primary 'Bellamy, H.' 6 ? primary 'Choi, K.H.' 7 ? # _cell.entry_id 4H9K _cell.length_a 41.489 _cell.length_b 58.298 _cell.length_c 75.464 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4H9K _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hog cholera virus' 17256.832 1 ? C168A ? ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 262 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMGVEEPVYDATGKPLFGDPSEVHPQSTLKLPHDRGRGNIKTTLKNLPRKGDCRSGNHLGPVSGIYVKPGPVFYQDYM GPVYHRAPLEFFSEAQFCEVTKRIGRVTGSDGRLYHIYVCIDGCILLKLAKRGEPRTLKWIRNFTDCPLWVTSA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMGVEEPVYDATGKPLFGDPSEVHPQSTLKLPHDRGRGNIKTTLKNLPRKGDCRSGNHLGPVSGIYVKPGPVFYQDYM GPVYHRAPLEFFSEAQFCEVTKRIGRVTGSDGRLYHIYVCIDGCILLKLAKRGEPRTLKWIRNFTDCPLWVTSA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 VAL n 1 7 GLU n 1 8 GLU n 1 9 PRO n 1 10 VAL n 1 11 TYR n 1 12 ASP n 1 13 ALA n 1 14 THR n 1 15 GLY n 1 16 LYS n 1 17 PRO n 1 18 LEU n 1 19 PHE n 1 20 GLY n 1 21 ASP n 1 22 PRO n 1 23 SER n 1 24 GLU n 1 25 VAL n 1 26 HIS n 1 27 PRO n 1 28 GLN n 1 29 SER n 1 30 THR n 1 31 LEU n 1 32 LYS n 1 33 LEU n 1 34 PRO n 1 35 HIS n 1 36 ASP n 1 37 ARG n 1 38 GLY n 1 39 ARG n 1 40 GLY n 1 41 ASN n 1 42 ILE n 1 43 LYS n 1 44 THR n 1 45 THR n 1 46 LEU n 1 47 LYS n 1 48 ASN n 1 49 LEU n 1 50 PRO n 1 51 ARG n 1 52 LYS n 1 53 GLY n 1 54 ASP n 1 55 CYS n 1 56 ARG n 1 57 SER n 1 58 GLY n 1 59 ASN n 1 60 HIS n 1 61 LEU n 1 62 GLY n 1 63 PRO n 1 64 VAL n 1 65 SER n 1 66 GLY n 1 67 ILE n 1 68 TYR n 1 69 VAL n 1 70 LYS n 1 71 PRO n 1 72 GLY n 1 73 PRO n 1 74 VAL n 1 75 PHE n 1 76 TYR n 1 77 GLN n 1 78 ASP n 1 79 TYR n 1 80 MET n 1 81 GLY n 1 82 PRO n 1 83 VAL n 1 84 TYR n 1 85 HIS n 1 86 ARG n 1 87 ALA n 1 88 PRO n 1 89 LEU n 1 90 GLU n 1 91 PHE n 1 92 PHE n 1 93 SER n 1 94 GLU n 1 95 ALA n 1 96 GLN n 1 97 PHE n 1 98 CYS n 1 99 GLU n 1 100 VAL n 1 101 THR n 1 102 LYS n 1 103 ARG n 1 104 ILE n 1 105 GLY n 1 106 ARG n 1 107 VAL n 1 108 THR n 1 109 GLY n 1 110 SER n 1 111 ASP n 1 112 GLY n 1 113 ARG n 1 114 LEU n 1 115 TYR n 1 116 HIS n 1 117 ILE n 1 118 TYR n 1 119 VAL n 1 120 CYS n 1 121 ILE n 1 122 ASP n 1 123 GLY n 1 124 CYS n 1 125 ILE n 1 126 LEU n 1 127 LEU n 1 128 LYS n 1 129 LEU n 1 130 ALA n 1 131 LYS n 1 132 ARG n 1 133 GLY n 1 134 GLU n 1 135 PRO n 1 136 ARG n 1 137 THR n 1 138 LEU n 1 139 LYS n 1 140 TRP n 1 141 ILE n 1 142 ARG n 1 143 ASN n 1 144 PHE n 1 145 THR n 1 146 ASP n 1 147 CYS n 1 148 PRO n 1 149 LEU n 1 150 TRP n 1 151 VAL n 1 152 THR n 1 153 SER n 1 154 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Alfort/187 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Classical swine fever virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 358769 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (Rosetta-DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q68871_9FLAV _struct_ref.pdbx_db_accession Q68871 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGVEEPVYDATGKPLFGDPSEVHPQSTLKLPHDRGRGNIKTTLKNLPRKGDCRSGNHLGPVSGIYVKPGPVFYQDYMGPV YHRAPLEFFSEAQFCEVTKRIGRVTGSDGRLYHIYVCIDGCILLKLAKRGEPRTLKWIRNFTDCPLWVTS ; _struct_ref.pdbx_align_begin 18 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4H9K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q68871 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 167 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 18 _struct_ref_seq.pdbx_auth_seq_align_end 167 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4H9K GLY A 1 ? UNP Q68871 ? ? 'expression tag' 15 1 1 4H9K SER A 2 ? UNP Q68871 ? ? 'expression tag' 16 2 1 4H9K HIS A 3 ? UNP Q68871 ? ? 'expression tag' 17 3 1 4H9K ALA A 154 ? UNP Q68871 ? ? 'expression tag' 168 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 4H9K _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_percent_sol 53.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 290 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '25% PEG3350, 0.2 M (NH4)2SO4 and 0.1 M Hepes, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 85 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.pdbx_collection_date 2011-12-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator none _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU FR-E+ SUPERBRIGHT' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.5418 # _reflns.entry_id 4H9K _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 37.7 _reflns.d_resolution_high 1.59 _reflns.number_obs 24710 _reflns.number_all 24909 _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.037 _reflns.pdbx_netI_over_sigmaI 40.6 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.63 _reflns_shell.percent_possible_all 87.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.452 _reflns_shell.meanI_over_sigI_obs 1.96 _reflns_shell.pdbx_redundancy 2.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1064 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4H9K _refine.ls_number_reflns_obs 23012 _refine.ls_number_reflns_all 23012 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 37.7 _refine.ls_d_res_high 1.599 _refine.ls_percent_reflns_obs 92.53 _refine.ls_R_factor_obs 0.1824 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1793 _refine.ls_R_factor_R_free 0.2159 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 8.69 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 4H9J' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.12 _refine.pdbx_overall_phase_error 20.54 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1164 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 262 _refine_hist.number_atoms_total 1442 _refine_hist.d_res_high 1.599 _refine_hist.d_res_low 37.7 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.006 ? ? 1210 ? 'X-RAY DIFFRACTION' f_angle_d 1.055 ? ? 1641 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 12.807 ? ? 446 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.074 ? ? 172 ? 'X-RAY DIFFRACTION' f_plane_restr 0.005 ? ? 210 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 1.5987 1.6387 489 0.1974 31.00 0.2050 . . 46 . . . . 'X-RAY DIFFRACTION' . 1.6387 1.6830 1035 0.1957 65.00 0.2647 . . 99 . . . . 'X-RAY DIFFRACTION' . 1.6830 1.7326 1552 0.1895 96.00 0.2234 . . 148 . . . . 'X-RAY DIFFRACTION' . 1.7326 1.7885 1588 0.1898 100.00 0.2554 . . 150 . . . . 'X-RAY DIFFRACTION' . 1.7885 1.8524 1590 0.1933 100.00 0.2396 . . 152 . . . . 'X-RAY DIFFRACTION' . 1.8524 1.9266 1613 0.1875 100.00 0.1891 . . 154 . . . . 'X-RAY DIFFRACTION' . 1.9266 2.0142 1602 0.1728 100.00 0.2095 . . 153 . . . . 'X-RAY DIFFRACTION' . 2.0142 2.1204 1621 0.1832 100.00 0.2108 . . 154 . . . . 'X-RAY DIFFRACTION' . 2.1204 2.2533 1618 0.1749 100.00 0.2248 . . 153 . . . . 'X-RAY DIFFRACTION' . 2.2533 2.4272 1624 0.1742 100.00 0.2272 . . 156 . . . . 'X-RAY DIFFRACTION' . 2.4272 2.6714 1624 0.1838 100.00 0.2074 . . 154 . . . . 'X-RAY DIFFRACTION' . 2.6714 3.0578 1638 0.1936 100.00 0.2277 . . 155 . . . . 'X-RAY DIFFRACTION' . 3.0578 3.8519 1666 0.1651 100.00 0.2134 . . 159 . . . . 'X-RAY DIFFRACTION' . 3.8519 37.7425 1752 0.1743 100.00 0.2000 . . 167 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4H9K _struct.title 'Crystal structure of cleavage site mutant of Npro of classical swine fever virus.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4H9K _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'npro, csfv, autoprotease, pestivirus, cysteine protease, IRF-3 antagonist, IRF-3, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 88 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 90 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 102 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 104 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 98 SG ? ? ? 1_555 A CYS 120 SG ? ? A CYS 112 A CYS 134 1_555 ? ? ? ? ? ? ? 2.018 ? ? metalc1 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 E ZN . ZN ? ? A HIS 49 A ZN 204 1_555 ? ? ? ? ? ? ? 2.063 ? ? metalc2 metalc ? ? A CYS 55 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 69 A ZN 204 1_555 ? ? ? ? ? ? ? 2.270 ? ? metalc3 metalc ? ? A ALA 154 OXT ? ? ? 1_555 E ZN . ZN ? ? A ALA 168 A ZN 204 1_555 ? ? ? ? ? ? ? 1.910 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 33 A . ? LEU 47 A PRO 34 A ? PRO 48 A 1 1.22 2 GLY 72 A . ? GLY 86 A PRO 73 A ? PRO 87 A 1 -3.65 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 42 ? THR A 44 ? ILE A 56 THR A 58 A 2 VAL A 74 ? ASP A 78 ? VAL A 88 ASP A 92 A 3 GLY A 66 ? LYS A 70 ? GLY A 80 LYS A 84 A 4 LEU A 149 ? SER A 153 ? LEU A 163 SER A 167 B 1 PHE A 92 ? GLU A 94 ? PHE A 106 GLU A 108 B 2 THR A 137 ? TRP A 140 ? THR A 151 TRP A 154 B 3 ILE A 125 ? LEU A 129 ? ILE A 139 LEU A 143 B 4 LEU A 114 ? CYS A 120 ? LEU A 128 CYS A 134 B 5 THR A 101 ? THR A 108 ? THR A 115 THR A 122 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 42 ? N ILE A 56 O GLN A 77 ? O GLN A 91 A 2 3 O VAL A 74 ? O VAL A 88 N LYS A 70 ? N LYS A 84 A 3 4 N VAL A 69 ? N VAL A 83 O LEU A 149 ? O LEU A 163 B 1 2 N SER A 93 ? N SER A 107 O LYS A 139 ? O LYS A 153 B 2 3 O LEU A 138 ? O LEU A 152 N LEU A 127 ? N LEU A 141 B 3 4 O LYS A 128 ? O LYS A 142 N HIS A 116 ? N HIS A 130 B 4 5 O TYR A 115 ? O TYR A 129 N VAL A 107 ? N VAL A 121 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 4 'BINDING SITE FOR RESIDUE SO4 A 201' AC2 Software A SO4 202 ? 5 'BINDING SITE FOR RESIDUE SO4 A 202' AC3 Software A SO4 203 ? 4 'BINDING SITE FOR RESIDUE SO4 A 203' AC4 Software A ZN 204 ? 4 'BINDING SITE FOR RESIDUE ZN A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 LYS A 102 ? LYS A 116 . ? 1_555 ? 2 AC1 4 ARG A 142 ? ARG A 156 . ? 3_656 ? 3 AC1 4 HOH F . ? HOH A 389 . ? 1_555 ? 4 AC1 4 HOH F . ? HOH A 538 . ? 1_555 ? 5 AC2 5 HIS A 26 ? HIS A 40 . ? 1_555 ? 6 AC2 5 ARG A 113 ? ARG A 127 . ? 1_555 ? 7 AC2 5 LEU A 114 ? LEU A 128 . ? 1_555 ? 8 AC2 5 HOH F . ? HOH A 406 . ? 1_555 ? 9 AC2 5 HOH F . ? HOH A 452 . ? 1_555 ? 10 AC3 4 LYS A 52 ? LYS A 66 . ? 1_555 ? 11 AC3 4 ARG A 106 ? ARG A 120 . ? 1_555 ? 12 AC3 4 HOH F . ? HOH A 390 . ? 1_555 ? 13 AC3 4 HOH F . ? HOH A 478 . ? 1_555 ? 14 AC4 4 HIS A 35 ? HIS A 49 . ? 1_555 ? 15 AC4 4 CYS A 55 ? CYS A 69 . ? 1_555 ? 16 AC4 4 HIS A 60 ? HIS A 74 . ? 4_466 ? 17 AC4 4 ALA A 154 ? ALA A 168 . ? 1_555 ? # _database_PDB_matrix.entry_id 4H9K _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4H9K _atom_sites.fract_transf_matrix[1][1] 0.024103 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017153 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013251 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 15 ? ? ? A . n A 1 2 SER 2 16 ? ? ? A . n A 1 3 HIS 3 17 17 HIS HIS A . n A 1 4 MET 4 18 18 MET MET A . n A 1 5 GLY 5 19 19 GLY GLY A . n A 1 6 VAL 6 20 20 VAL VAL A . n A 1 7 GLU 7 21 21 GLU GLU A . n A 1 8 GLU 8 22 22 GLU GLU A . n A 1 9 PRO 9 23 23 PRO PRO A . n A 1 10 VAL 10 24 24 VAL VAL A . n A 1 11 TYR 11 25 25 TYR TYR A . n A 1 12 ASP 12 26 26 ASP ASP A . n A 1 13 ALA 13 27 27 ALA ALA A . n A 1 14 THR 14 28 28 THR THR A . n A 1 15 GLY 15 29 29 GLY GLY A . n A 1 16 LYS 16 30 30 LYS LYS A . n A 1 17 PRO 17 31 31 PRO PRO A . n A 1 18 LEU 18 32 32 LEU LEU A . n A 1 19 PHE 19 33 33 PHE PHE A . n A 1 20 GLY 20 34 34 GLY GLY A . n A 1 21 ASP 21 35 35 ASP ASP A . n A 1 22 PRO 22 36 36 PRO PRO A . n A 1 23 SER 23 37 37 SER SER A . n A 1 24 GLU 24 38 38 GLU GLU A . n A 1 25 VAL 25 39 39 VAL VAL A . n A 1 26 HIS 26 40 40 HIS HIS A . n A 1 27 PRO 27 41 41 PRO PRO A . n A 1 28 GLN 28 42 42 GLN GLN A . n A 1 29 SER 29 43 43 SER SER A . n A 1 30 THR 30 44 44 THR THR A . n A 1 31 LEU 31 45 45 LEU LEU A . n A 1 32 LYS 32 46 46 LYS LYS A . n A 1 33 LEU 33 47 47 LEU LEU A . n A 1 34 PRO 34 48 48 PRO PRO A . n A 1 35 HIS 35 49 49 HIS HIS A . n A 1 36 ASP 36 50 50 ASP ASP A . n A 1 37 ARG 37 51 51 ARG ARG A . n A 1 38 GLY 38 52 52 GLY GLY A . n A 1 39 ARG 39 53 53 ARG ARG A . n A 1 40 GLY 40 54 54 GLY GLY A . n A 1 41 ASN 41 55 55 ASN ASN A . n A 1 42 ILE 42 56 56 ILE ILE A . n A 1 43 LYS 43 57 57 LYS LYS A . n A 1 44 THR 44 58 58 THR THR A . n A 1 45 THR 45 59 59 THR THR A . n A 1 46 LEU 46 60 60 LEU LEU A . n A 1 47 LYS 47 61 61 LYS LYS A . n A 1 48 ASN 48 62 62 ASN ASN A . n A 1 49 LEU 49 63 63 LEU LEU A . n A 1 50 PRO 50 64 64 PRO PRO A . n A 1 51 ARG 51 65 65 ARG ARG A . n A 1 52 LYS 52 66 66 LYS LYS A . n A 1 53 GLY 53 67 67 GLY GLY A . n A 1 54 ASP 54 68 68 ASP ASP A . n A 1 55 CYS 55 69 69 CYS CYS A . n A 1 56 ARG 56 70 70 ARG ARG A . n A 1 57 SER 57 71 71 SER SER A . n A 1 58 GLY 58 72 72 GLY GLY A . n A 1 59 ASN 59 73 73 ASN ASN A . n A 1 60 HIS 60 74 74 HIS HIS A . n A 1 61 LEU 61 75 75 LEU LEU A . n A 1 62 GLY 62 76 76 GLY GLY A . n A 1 63 PRO 63 77 77 PRO PRO A . n A 1 64 VAL 64 78 78 VAL VAL A . n A 1 65 SER 65 79 79 SER SER A . n A 1 66 GLY 66 80 80 GLY GLY A . n A 1 67 ILE 67 81 81 ILE ILE A . n A 1 68 TYR 68 82 82 TYR TYR A . n A 1 69 VAL 69 83 83 VAL VAL A . n A 1 70 LYS 70 84 84 LYS LYS A . n A 1 71 PRO 71 85 85 PRO PRO A . n A 1 72 GLY 72 86 86 GLY GLY A . n A 1 73 PRO 73 87 87 PRO PRO A . n A 1 74 VAL 74 88 88 VAL VAL A . n A 1 75 PHE 75 89 89 PHE PHE A . n A 1 76 TYR 76 90 90 TYR TYR A . n A 1 77 GLN 77 91 91 GLN GLN A . n A 1 78 ASP 78 92 92 ASP ASP A . n A 1 79 TYR 79 93 93 TYR TYR A . n A 1 80 MET 80 94 94 MET MET A . n A 1 81 GLY 81 95 95 GLY GLY A . n A 1 82 PRO 82 96 96 PRO PRO A . n A 1 83 VAL 83 97 97 VAL VAL A . n A 1 84 TYR 84 98 98 TYR TYR A . n A 1 85 HIS 85 99 99 HIS HIS A . n A 1 86 ARG 86 100 100 ARG ARG A . n A 1 87 ALA 87 101 101 ALA ALA A . n A 1 88 PRO 88 102 102 PRO PRO A . n A 1 89 LEU 89 103 103 LEU LEU A . n A 1 90 GLU 90 104 104 GLU GLU A . n A 1 91 PHE 91 105 105 PHE PHE A . n A 1 92 PHE 92 106 106 PHE PHE A . n A 1 93 SER 93 107 107 SER SER A . n A 1 94 GLU 94 108 108 GLU GLU A . n A 1 95 ALA 95 109 109 ALA ALA A . n A 1 96 GLN 96 110 110 GLN GLN A . n A 1 97 PHE 97 111 111 PHE PHE A . n A 1 98 CYS 98 112 112 CYS CYS A . n A 1 99 GLU 99 113 113 GLU GLU A . n A 1 100 VAL 100 114 114 VAL VAL A . n A 1 101 THR 101 115 115 THR THR A . n A 1 102 LYS 102 116 116 LYS LYS A . n A 1 103 ARG 103 117 117 ARG ARG A . n A 1 104 ILE 104 118 118 ILE ILE A . n A 1 105 GLY 105 119 119 GLY GLY A . n A 1 106 ARG 106 120 120 ARG ARG A . n A 1 107 VAL 107 121 121 VAL VAL A . n A 1 108 THR 108 122 122 THR THR A . n A 1 109 GLY 109 123 123 GLY GLY A . n A 1 110 SER 110 124 124 SER SER A . n A 1 111 ASP 111 125 125 ASP ASP A . n A 1 112 GLY 112 126 126 GLY GLY A . n A 1 113 ARG 113 127 127 ARG ARG A . n A 1 114 LEU 114 128 128 LEU LEU A . n A 1 115 TYR 115 129 129 TYR TYR A . n A 1 116 HIS 116 130 130 HIS HIS A . n A 1 117 ILE 117 131 131 ILE ILE A . n A 1 118 TYR 118 132 132 TYR TYR A . n A 1 119 VAL 119 133 133 VAL VAL A . n A 1 120 CYS 120 134 134 CYS CYS A . n A 1 121 ILE 121 135 135 ILE ILE A . n A 1 122 ASP 122 136 136 ASP ASP A . n A 1 123 GLY 123 137 137 GLY GLY A . n A 1 124 CYS 124 138 138 CYS CYS A . n A 1 125 ILE 125 139 139 ILE ILE A . n A 1 126 LEU 126 140 140 LEU LEU A . n A 1 127 LEU 127 141 141 LEU LEU A . n A 1 128 LYS 128 142 142 LYS LYS A . n A 1 129 LEU 129 143 143 LEU LEU A . n A 1 130 ALA 130 144 144 ALA ALA A . n A 1 131 LYS 131 145 ? ? ? A . n A 1 132 ARG 132 146 ? ? ? A . n A 1 133 GLY 133 147 ? ? ? A . n A 1 134 GLU 134 148 ? ? ? A . n A 1 135 PRO 135 149 ? ? ? A . n A 1 136 ARG 136 150 150 ARG ARG A . n A 1 137 THR 137 151 151 THR THR A . n A 1 138 LEU 138 152 152 LEU LEU A . n A 1 139 LYS 139 153 153 LYS LYS A . n A 1 140 TRP 140 154 154 TRP TRP A . n A 1 141 ILE 141 155 155 ILE ILE A . n A 1 142 ARG 142 156 156 ARG ARG A . n A 1 143 ASN 143 157 157 ASN ASN A . n A 1 144 PHE 144 158 158 PHE PHE A . n A 1 145 THR 145 159 159 THR THR A . n A 1 146 ASP 146 160 160 ASP ASP A . n A 1 147 CYS 147 161 161 CYS CYS A . n A 1 148 PRO 148 162 162 PRO PRO A . n A 1 149 LEU 149 163 163 LEU LEU A . n A 1 150 TRP 150 164 164 TRP TRP A . n A 1 151 VAL 151 165 165 VAL VAL A . n A 1 152 THR 152 166 166 THR THR A . n A 1 153 SER 153 167 167 SER SER A . n A 1 154 ALA 154 168 168 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 921 SO4 SO4 A . C 2 SO4 1 202 923 SO4 SO4 A . D 2 SO4 1 203 924 SO4 SO4 A . E 3 ZN 1 204 925 ZN ZN A . F 4 HOH 1 301 1 HOH HOH A . F 4 HOH 2 302 2 HOH HOH A . F 4 HOH 3 303 3 HOH HOH A . F 4 HOH 4 304 4 HOH HOH A . F 4 HOH 5 305 5 HOH HOH A . F 4 HOH 6 306 6 HOH HOH A . F 4 HOH 7 307 7 HOH HOH A . F 4 HOH 8 308 8 HOH HOH A . F 4 HOH 9 309 9 HOH HOH A . F 4 HOH 10 310 10 HOH HOH A . F 4 HOH 11 311 11 HOH HOH A . F 4 HOH 12 312 12 HOH HOH A . F 4 HOH 13 313 13 HOH HOH A . F 4 HOH 14 314 14 HOH HOH A . F 4 HOH 15 315 15 HOH HOH A . F 4 HOH 16 316 16 HOH HOH A . F 4 HOH 17 317 17 HOH HOH A . F 4 HOH 18 318 18 HOH HOH A . F 4 HOH 19 319 19 HOH HOH A . F 4 HOH 20 320 20 HOH HOH A . F 4 HOH 21 321 21 HOH HOH A . F 4 HOH 22 322 22 HOH HOH A . F 4 HOH 23 323 23 HOH HOH A . F 4 HOH 24 324 24 HOH HOH A . F 4 HOH 25 325 25 HOH HOH A . F 4 HOH 26 326 26 HOH HOH A . F 4 HOH 27 327 27 HOH HOH A . F 4 HOH 28 328 28 HOH HOH A . F 4 HOH 29 329 29 HOH HOH A . F 4 HOH 30 330 30 HOH HOH A . F 4 HOH 31 331 31 HOH HOH A . F 4 HOH 32 332 32 HOH HOH A . F 4 HOH 33 333 33 HOH HOH A . F 4 HOH 34 334 34 HOH HOH A . F 4 HOH 35 335 35 HOH HOH A . F 4 HOH 36 336 36 HOH HOH A . F 4 HOH 37 337 37 HOH HOH A . F 4 HOH 38 338 38 HOH HOH A . F 4 HOH 39 339 39 HOH HOH A . F 4 HOH 40 340 40 HOH HOH A . F 4 HOH 41 341 41 HOH HOH A . F 4 HOH 42 342 42 HOH HOH A . F 4 HOH 43 343 43 HOH HOH A . F 4 HOH 44 344 44 HOH HOH A . F 4 HOH 45 345 45 HOH HOH A . F 4 HOH 46 346 46 HOH HOH A . F 4 HOH 47 347 47 HOH HOH A . F 4 HOH 48 348 48 HOH HOH A . F 4 HOH 49 349 49 HOH HOH A . F 4 HOH 50 350 50 HOH HOH A . F 4 HOH 51 351 51 HOH HOH A . F 4 HOH 52 352 52 HOH HOH A . F 4 HOH 53 353 53 HOH HOH A . F 4 HOH 54 354 54 HOH HOH A . F 4 HOH 55 355 55 HOH HOH A . F 4 HOH 56 356 56 HOH HOH A . F 4 HOH 57 357 57 HOH HOH A . F 4 HOH 58 358 58 HOH HOH A . F 4 HOH 59 359 59 HOH HOH A . F 4 HOH 60 360 60 HOH HOH A . F 4 HOH 61 361 61 HOH HOH A . F 4 HOH 62 362 62 HOH HOH A . F 4 HOH 63 363 63 HOH HOH A . F 4 HOH 64 364 64 HOH HOH A . F 4 HOH 65 365 65 HOH HOH A . F 4 HOH 66 366 66 HOH HOH A . F 4 HOH 67 367 67 HOH HOH A . F 4 HOH 68 368 68 HOH HOH A . F 4 HOH 69 369 69 HOH HOH A . F 4 HOH 70 370 70 HOH HOH A . F 4 HOH 71 371 71 HOH HOH A . F 4 HOH 72 372 72 HOH HOH A . F 4 HOH 73 373 73 HOH HOH A . F 4 HOH 74 374 74 HOH HOH A . F 4 HOH 75 375 75 HOH HOH A . F 4 HOH 76 376 76 HOH HOH A . F 4 HOH 77 377 77 HOH HOH A . F 4 HOH 78 378 78 HOH HOH A . F 4 HOH 79 379 79 HOH HOH A . F 4 HOH 80 380 80 HOH HOH A . F 4 HOH 81 381 81 HOH HOH A . F 4 HOH 82 382 82 HOH HOH A . F 4 HOH 83 383 83 HOH HOH A . F 4 HOH 84 384 84 HOH HOH A . F 4 HOH 85 385 85 HOH HOH A . F 4 HOH 86 386 86 HOH HOH A . F 4 HOH 87 387 87 HOH HOH A . F 4 HOH 88 388 88 HOH HOH A . F 4 HOH 89 389 89 HOH HOH A . F 4 HOH 90 390 90 HOH HOH A . F 4 HOH 91 391 91 HOH HOH A . F 4 HOH 92 392 92 HOH HOH A . F 4 HOH 93 393 93 HOH HOH A . F 4 HOH 94 394 94 HOH HOH A . F 4 HOH 95 395 95 HOH HOH A . F 4 HOH 96 396 96 HOH HOH A . F 4 HOH 97 397 97 HOH HOH A . F 4 HOH 98 398 98 HOH HOH A . F 4 HOH 99 399 99 HOH HOH A . F 4 HOH 100 400 100 HOH HOH A . F 4 HOH 101 401 101 HOH HOH A . F 4 HOH 102 402 102 HOH HOH A . F 4 HOH 103 403 103 HOH HOH A . F 4 HOH 104 404 104 HOH HOH A . F 4 HOH 105 405 105 HOH HOH A . F 4 HOH 106 406 106 HOH HOH A . F 4 HOH 107 407 107 HOH HOH A . F 4 HOH 108 408 108 HOH HOH A . F 4 HOH 109 409 109 HOH HOH A . F 4 HOH 110 410 110 HOH HOH A . F 4 HOH 111 411 111 HOH HOH A . F 4 HOH 112 412 112 HOH HOH A . F 4 HOH 113 413 113 HOH HOH A . F 4 HOH 114 414 114 HOH HOH A . F 4 HOH 115 415 115 HOH HOH A . F 4 HOH 116 416 116 HOH HOH A . F 4 HOH 117 417 117 HOH HOH A . F 4 HOH 118 418 118 HOH HOH A . F 4 HOH 119 419 119 HOH HOH A . F 4 HOH 120 420 120 HOH HOH A . F 4 HOH 121 421 121 HOH HOH A . F 4 HOH 122 422 122 HOH HOH A . F 4 HOH 123 423 123 HOH HOH A . F 4 HOH 124 424 124 HOH HOH A . F 4 HOH 125 425 125 HOH HOH A . F 4 HOH 126 426 126 HOH HOH A . F 4 HOH 127 427 127 HOH HOH A . F 4 HOH 128 428 128 HOH HOH A . F 4 HOH 129 429 129 HOH HOH A . F 4 HOH 130 430 130 HOH HOH A . F 4 HOH 131 431 131 HOH HOH A . F 4 HOH 132 432 132 HOH HOH A . F 4 HOH 133 433 133 HOH HOH A . F 4 HOH 134 434 134 HOH HOH A . F 4 HOH 135 435 135 HOH HOH A . F 4 HOH 136 436 136 HOH HOH A . F 4 HOH 137 437 137 HOH HOH A . F 4 HOH 138 438 138 HOH HOH A . F 4 HOH 139 439 139 HOH HOH A . F 4 HOH 140 440 140 HOH HOH A . F 4 HOH 141 441 141 HOH HOH A . F 4 HOH 142 442 142 HOH HOH A . F 4 HOH 143 443 143 HOH HOH A . F 4 HOH 144 444 144 HOH HOH A . F 4 HOH 145 445 145 HOH HOH A . F 4 HOH 146 446 146 HOH HOH A . F 4 HOH 147 447 147 HOH HOH A . F 4 HOH 148 448 148 HOH HOH A . F 4 HOH 149 449 149 HOH HOH A . F 4 HOH 150 450 150 HOH HOH A . F 4 HOH 151 451 151 HOH HOH A . F 4 HOH 152 452 152 HOH HOH A . F 4 HOH 153 453 153 HOH HOH A . F 4 HOH 154 454 154 HOH HOH A . F 4 HOH 155 455 155 HOH HOH A . F 4 HOH 156 456 156 HOH HOH A . F 4 HOH 157 457 157 HOH HOH A . F 4 HOH 158 458 158 HOH HOH A . F 4 HOH 159 459 159 HOH HOH A . F 4 HOH 160 460 160 HOH HOH A . F 4 HOH 161 461 161 HOH HOH A . F 4 HOH 162 462 162 HOH HOH A . F 4 HOH 163 463 163 HOH HOH A . F 4 HOH 164 464 164 HOH HOH A . F 4 HOH 165 465 165 HOH HOH A . F 4 HOH 166 466 166 HOH HOH A . F 4 HOH 167 467 167 HOH HOH A . F 4 HOH 168 468 168 HOH HOH A . F 4 HOH 169 469 169 HOH HOH A . F 4 HOH 170 470 170 HOH HOH A . F 4 HOH 171 471 171 HOH HOH A . F 4 HOH 172 472 172 HOH HOH A . F 4 HOH 173 473 173 HOH HOH A . F 4 HOH 174 474 174 HOH HOH A . F 4 HOH 175 475 175 HOH HOH A . F 4 HOH 176 476 176 HOH HOH A . F 4 HOH 177 477 177 HOH HOH A . F 4 HOH 178 478 178 HOH HOH A . F 4 HOH 179 479 179 HOH HOH A . F 4 HOH 180 480 180 HOH HOH A . F 4 HOH 181 481 181 HOH HOH A . F 4 HOH 182 482 182 HOH HOH A . F 4 HOH 183 483 183 HOH HOH A . F 4 HOH 184 484 184 HOH HOH A . F 4 HOH 185 485 185 HOH HOH A . F 4 HOH 186 486 186 HOH HOH A . F 4 HOH 187 487 187 HOH HOH A . F 4 HOH 188 488 188 HOH HOH A . F 4 HOH 189 489 189 HOH HOH A . F 4 HOH 190 490 190 HOH HOH A . F 4 HOH 191 491 191 HOH HOH A . F 4 HOH 192 492 192 HOH HOH A . F 4 HOH 193 493 193 HOH HOH A . F 4 HOH 194 494 194 HOH HOH A . F 4 HOH 195 495 195 HOH HOH A . F 4 HOH 196 496 196 HOH HOH A . F 4 HOH 197 497 197 HOH HOH A . F 4 HOH 198 498 198 HOH HOH A . F 4 HOH 199 499 199 HOH HOH A . F 4 HOH 200 500 200 HOH HOH A . F 4 HOH 201 501 201 HOH HOH A . F 4 HOH 202 502 202 HOH HOH A . F 4 HOH 203 503 203 HOH HOH A . F 4 HOH 204 504 204 HOH HOH A . F 4 HOH 205 505 205 HOH HOH A . F 4 HOH 206 506 206 HOH HOH A . F 4 HOH 207 507 207 HOH HOH A . F 4 HOH 208 508 208 HOH HOH A . F 4 HOH 209 509 209 HOH HOH A . F 4 HOH 210 510 210 HOH HOH A . F 4 HOH 211 511 211 HOH HOH A . F 4 HOH 212 512 212 HOH HOH A . F 4 HOH 213 513 213 HOH HOH A . F 4 HOH 214 514 214 HOH HOH A . F 4 HOH 215 515 215 HOH HOH A . F 4 HOH 216 516 216 HOH HOH A . F 4 HOH 217 517 217 HOH HOH A . F 4 HOH 218 518 218 HOH HOH A . F 4 HOH 219 519 219 HOH HOH A . F 4 HOH 220 520 220 HOH HOH A . F 4 HOH 221 521 221 HOH HOH A . F 4 HOH 222 522 222 HOH HOH A . F 4 HOH 223 523 223 HOH HOH A . F 4 HOH 224 524 224 HOH HOH A . F 4 HOH 225 525 225 HOH HOH A . F 4 HOH 226 526 226 HOH HOH A . F 4 HOH 227 527 227 HOH HOH A . F 4 HOH 228 528 228 HOH HOH A . F 4 HOH 229 529 229 HOH HOH A . F 4 HOH 230 530 230 HOH HOH A . F 4 HOH 231 531 231 HOH HOH A . F 4 HOH 232 532 232 HOH HOH A . F 4 HOH 233 533 233 HOH HOH A . F 4 HOH 234 534 234 HOH HOH A . F 4 HOH 235 535 235 HOH HOH A . F 4 HOH 236 536 236 HOH HOH A . F 4 HOH 237 537 237 HOH HOH A . F 4 HOH 238 538 238 HOH HOH A . F 4 HOH 239 539 239 HOH HOH A . F 4 HOH 240 540 240 HOH HOH A . F 4 HOH 241 541 241 HOH HOH A . F 4 HOH 242 542 242 HOH HOH A . F 4 HOH 243 543 243 HOH HOH A . F 4 HOH 244 544 244 HOH HOH A . F 4 HOH 245 545 245 HOH HOH A . F 4 HOH 246 546 246 HOH HOH A . F 4 HOH 247 547 247 HOH HOH A . F 4 HOH 248 548 248 HOH HOH A . F 4 HOH 249 549 249 HOH HOH A . F 4 HOH 250 550 250 HOH HOH A . F 4 HOH 251 551 251 HOH HOH A . F 4 HOH 252 552 252 HOH HOH A . F 4 HOH 253 553 253 HOH HOH A . F 4 HOH 254 554 254 HOH HOH A . F 4 HOH 255 555 255 HOH HOH A . F 4 HOH 256 556 256 HOH HOH A . F 4 HOH 257 557 257 HOH HOH A . F 4 HOH 258 558 258 HOH HOH A . F 4 HOH 259 559 259 HOH HOH A . F 4 HOH 260 560 260 HOH HOH A . F 4 HOH 261 561 261 HOH HOH A . F 4 HOH 262 562 262 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 35 ? A HIS 49 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 SG ? A CYS 55 ? A CYS 69 ? 1_555 120.0 ? 2 NE2 ? A HIS 35 ? A HIS 49 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 OXT ? A ALA 154 ? A ALA 168 ? 1_555 97.9 ? 3 SG ? A CYS 55 ? A CYS 69 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 OXT ? A ALA 154 ? A ALA 168 ? 1_555 109.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-10-30 2 'Structure model' 1 1 2018-01-24 3 'Structure model' 1 2 2023-09-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_ref_seq_dif 9 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.value' 15 3 'Structure model' '_struct_conn.pdbx_dist_value' 16 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 3 'Structure model' '_struct_ref_seq_dif.details' 22 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 23 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 24 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-3000 'data collection' . ? 1 PHENIX 'model building' . ? 2 PHENIX refinement '(phenix.refine: 1.8_1069)' ? 3 HKL-3000 'data reduction' . ? 4 HKL-3000 'data scaling' . ? 5 PHENIX phasing . ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O2 A SO4 201 ? ? O A HOH 538 ? ? 2.11 2 1 O A HOH 386 ? ? O A HOH 488 ? ? 2.18 3 1 O A HOH 371 ? ? O A HOH 433 ? ? 2.19 4 1 O A HOH 453 ? ? O A HOH 497 ? ? 2.19 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 15 ? A GLY 1 2 1 Y 1 A SER 16 ? A SER 2 3 1 Y 1 A LYS 145 ? A LYS 131 4 1 Y 1 A ARG 146 ? A ARG 132 5 1 Y 1 A GLY 147 ? A GLY 133 6 1 Y 1 A GLU 148 ? A GLU 134 7 1 Y 1 A PRO 149 ? A PRO 135 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 ZN ZN ZN N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'ZINC ION' ZN 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4H9J _pdbx_initial_refinement_model.details 'PDB ENTRY 4H9J' #