data_4HIR # _entry.id 4HIR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4HIR pdb_00004hir 10.2210/pdb4hir/pdb WWPDB D_1000179341 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 6HIR _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4HIR _pdbx_database_status.recvd_initial_deposition_date 1988-12-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clore, G.M.' 1 'Gronenborn, A.M.' 2 # _citation.id primary _citation.title ;Solution structure of recombinant hirudin and the Lys-47----Glu mutant: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 28 _citation.page_first 2601 _citation.page_last 2617 _citation.year 1989 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 2567183 _citation.pdbx_database_id_DOI 10.1021/bi00432a038 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Folkers, P.J.' 1 ? primary 'Clore, G.M.' 2 ? primary 'Driscoll, P.C.' 3 ? primary 'Dodt, J.' 4 ? primary 'Kohler, S.' 5 ? primary 'Gronenborn, A.M.' 6 ? # _cell.entry_id 4HIR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4HIR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HIRUDIN VARIANT-1' _entity.formula_weight 6973.439 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPEPQSHNDGDFEEIPEEYLQ _entity_poly.pdbx_seq_one_letter_code_can VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPEPQSHNDGDFEEIPEEYLQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 VAL n 1 3 TYR n 1 4 THR n 1 5 ASP n 1 6 CYS n 1 7 THR n 1 8 GLU n 1 9 SER n 1 10 GLY n 1 11 GLN n 1 12 ASN n 1 13 LEU n 1 14 CYS n 1 15 LEU n 1 16 CYS n 1 17 GLU n 1 18 GLY n 1 19 SER n 1 20 ASN n 1 21 VAL n 1 22 CYS n 1 23 GLY n 1 24 GLN n 1 25 GLY n 1 26 ASN n 1 27 LYS n 1 28 CYS n 1 29 ILE n 1 30 LEU n 1 31 GLY n 1 32 SER n 1 33 ASP n 1 34 GLY n 1 35 GLU n 1 36 LYS n 1 37 ASN n 1 38 GLN n 1 39 CYS n 1 40 VAL n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 GLY n 1 45 THR n 1 46 PRO n 1 47 GLU n 1 48 PRO n 1 49 GLN n 1 50 SER n 1 51 HIS n 1 52 ASN n 1 53 ASP n 1 54 GLY n 1 55 ASP n 1 56 PHE n 1 57 GLU n 1 58 GLU n 1 59 ILE n 1 60 PRO n 1 61 GLU n 1 62 GLU n 1 63 TYR n 1 64 LEU n 1 65 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'medicinal leech' _entity_src_gen.gene_src_genus Hirudo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hirudo medicinalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITH1_HIRME _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01050 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4HIR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01050 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 65 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4HIR _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 47 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01050 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 47 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 47 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_refine.entry_id 4HIR _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;ONLY RESIDUES 1-49 ARE WELL DEFINED. RESIDUES 50-65 FORM A DISORDERED C-TERMINAL TAIL. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 4HIR _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 32 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 4HIR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 4HIR _struct.title ;SOLUTION STRUCTURE OF RECOMBINANT HIRUDIN AND THE LYS-47 (RIGHT ARROW) GLU MUTANT. A NUCLEAR MAGNETIC RESONANCE AND HYBRID DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING STUDY ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4HIR _struct_keywords.pdbx_keywords 'COAGULATION INHIBITOR' _struct_keywords.text 'COAGULATION INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 6 A CYS 14 1_555 ? ? ? ? ? ? ? 1.999 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 16 A CYS 28 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 22 A CYS 39 1_555 ? ? ? ? ? ? ? 2.007 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 9 ? GLN A 11 ? SER A 9 GLN A 11 A 2 LYS A 27 ? GLY A 31 ? LYS A 27 GLY A 31 A 3 LYS A 36 ? VAL A 40 ? LYS A 36 VAL A 40 B 1 CYS A 14 ? CYS A 16 ? CYS A 14 CYS A 16 B 2 VAL A 21 ? CYS A 22 ? VAL A 21 CYS A 22 # _database_PDB_matrix.entry_id 4HIR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4HIR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 SER 50 50 ? ? ? A . n A 1 51 HIS 51 51 ? ? ? A . n A 1 52 ASN 52 52 ? ? ? A . n A 1 53 ASP 53 53 ? ? ? A . n A 1 54 GLY 54 54 ? ? ? A . n A 1 55 ASP 55 55 ? ? ? A . n A 1 56 PHE 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 GLU 58 58 ? ? ? A . n A 1 59 ILE 59 59 ? ? ? A . n A 1 60 PRO 60 60 ? ? ? A . n A 1 61 GLU 61 61 ? ? ? A . n A 1 62 GLU 62 62 ? ? ? A . n A 1 63 TYR 63 63 ? ? ? A . n A 1 64 LEU 64 64 ? ? ? A . n A 1 65 GLN 65 65 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1990-01-15 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conf 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 H A THR 7 ? ? HE22 A GLN 11 ? ? 1.26 2 3 O A SER 32 ? ? H A GLY 34 ? ? 1.57 3 3 O A ASN 12 ? ? H A CYS 14 ? ? 1.60 4 4 HG A SER 32 ? ? H A ASP 33 ? ? 1.30 5 4 O A GLY 34 ? ? N A LYS 36 ? ? 2.18 6 7 H A THR 7 ? ? HE22 A GLN 11 ? ? 1.25 7 7 O A SER 32 ? ? H A GLY 34 ? ? 1.59 8 9 H A THR 7 ? ? HE22 A GLN 11 ? ? 1.26 9 9 O A SER 32 ? ? H A GLY 34 ? ? 1.58 10 11 O A SER 32 ? ? H A GLY 34 ? ? 1.60 11 12 O A SER 32 ? ? H A GLY 34 ? ? 1.57 12 13 HG1 A THR 4 ? ? H A ASP 5 ? ? 1.27 13 14 HG1 A THR 4 ? ? H A ASP 5 ? ? 1.32 14 17 O A SER 32 ? ? H A GLY 34 ? ? 1.57 15 24 O A SER 32 ? ? H A GLY 34 ? ? 1.57 16 25 O A SER 32 ? ? H A GLY 34 ? ? 1.56 17 26 O A SER 32 ? ? H A GLY 34 ? ? 1.58 18 28 O A SER 32 ? ? H A GLY 34 ? ? 1.57 19 29 H A THR 7 ? ? HE22 A GLN 11 ? ? 1.26 20 29 O A SER 32 ? ? H A GLY 34 ? ? 1.55 21 31 O A SER 32 ? ? H A GLY 34 ? ? 1.60 22 32 O A SER 32 ? ? H A GLY 34 ? ? 1.54 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 131.61 113.10 18.51 2.50 N 2 1 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 131.09 113.10 17.99 2.50 N 3 3 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 128.64 113.10 15.54 2.50 N 4 3 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.27 113.10 17.17 2.50 N 5 5 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 130.91 113.10 17.81 2.50 N 6 5 N A GLY 31 ? ? CA A GLY 31 ? ? C A GLY 31 ? ? 128.90 113.10 15.80 2.50 N 7 8 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 131.48 113.10 18.38 2.50 N 8 8 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.85 113.10 17.75 2.50 N 9 9 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 129.92 113.10 16.82 2.50 N 10 9 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.29 113.10 17.19 2.50 N 11 10 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 130.29 113.10 17.19 2.50 N 12 10 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 128.94 113.10 15.84 2.50 N 13 11 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.87 113.10 17.77 2.50 N 14 13 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 131.00 113.10 17.90 2.50 N 15 14 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 129.57 113.10 16.47 2.50 N 16 15 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 131.79 113.10 18.69 2.50 N 17 15 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 129.78 113.10 16.68 2.50 N 18 16 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 130.12 113.10 17.02 2.50 N 19 16 N A GLY 31 ? ? CA A GLY 31 ? ? C A GLY 31 ? ? 133.82 113.10 20.72 2.50 N 20 17 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 130.52 113.10 17.42 2.50 N 21 17 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 129.34 113.10 16.24 2.50 N 22 18 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 130.54 113.10 17.44 2.50 N 23 19 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 129.64 113.10 16.54 2.50 N 24 19 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 129.64 113.10 16.54 2.50 N 25 19 N A GLY 31 ? ? CA A GLY 31 ? ? C A GLY 31 ? ? 132.00 113.10 18.90 2.50 N 26 19 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 130.31 113.10 17.21 2.50 N 27 20 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 129.64 113.10 16.54 2.50 N 28 21 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 130.15 113.10 17.05 2.50 N 29 21 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 130.01 113.10 16.91 2.50 N 30 21 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 131.12 113.10 18.02 2.50 N 31 23 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 130.25 113.10 17.15 2.50 N 32 23 N A GLY 31 ? ? CA A GLY 31 ? ? C A GLY 31 ? ? 130.07 113.10 16.97 2.50 N 33 26 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 130.22 113.10 17.12 2.50 N 34 27 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 130.68 113.10 17.58 2.50 N 35 27 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 130.08 113.10 16.98 2.50 N 36 27 N A GLY 31 ? ? CA A GLY 31 ? ? C A GLY 31 ? ? 130.95 113.10 17.85 2.50 N 37 27 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.25 113.10 17.15 2.50 N 38 27 N A GLY 44 ? ? CA A GLY 44 ? ? C A GLY 44 ? ? 131.71 113.10 18.61 2.50 N 39 28 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 129.97 113.10 16.87 2.50 N 40 28 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 129.68 113.10 16.58 2.50 N 41 30 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 130.22 113.10 17.12 2.50 N 42 30 N A GLY 18 ? ? CA A GLY 18 ? ? C A GLY 18 ? ? 128.93 113.10 15.83 2.50 N 43 30 N A GLY 23 ? ? CA A GLY 23 ? ? C A GLY 23 ? ? 131.49 113.10 18.39 2.50 N 44 30 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 131.20 113.10 18.10 2.50 N 45 31 N A GLY 10 ? ? CA A GLY 10 ? ? C A GLY 10 ? ? 130.16 113.10 17.06 2.50 N 46 31 N A GLY 42 ? ? CA A GLY 42 ? ? C A GLY 42 ? ? 130.49 113.10 17.39 2.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 3 ? ? -126.05 -166.91 2 1 ASN A 12 ? ? -135.53 -69.98 3 1 CYS A 14 ? ? -123.81 -161.02 4 1 ASN A 26 ? ? -121.15 -169.70 5 1 SER A 32 ? ? -68.45 -124.20 6 1 GLU A 35 ? ? -116.47 -134.54 7 2 GLN A 11 ? ? -62.22 -166.08 8 2 ASN A 12 ? ? -144.20 -78.94 9 2 LEU A 13 ? ? -75.25 48.66 10 2 CYS A 14 ? ? -120.91 -151.87 11 2 CYS A 16 ? ? -120.59 -68.10 12 2 SER A 32 ? ? -75.51 -128.54 13 2 GLU A 35 ? ? -120.42 -136.58 14 3 GLN A 11 ? ? -51.89 -169.04 15 3 ASN A 12 ? ? -140.68 -83.22 16 3 LEU A 13 ? ? -75.42 45.28 17 3 CYS A 14 ? ? -109.23 -158.16 18 3 CYS A 16 ? ? -120.91 -65.95 19 3 SER A 32 ? ? -80.87 -123.41 20 3 GLU A 35 ? ? -127.53 -134.25 21 3 THR A 41 ? ? -41.28 157.44 22 4 TYR A 3 ? ? -112.29 -166.09 23 4 GLN A 11 ? ? -53.05 170.35 24 4 ASN A 12 ? ? -144.56 -63.42 25 4 LEU A 13 ? ? -76.50 41.85 26 4 CYS A 14 ? ? -121.94 -157.67 27 4 CYS A 16 ? ? -96.32 -74.29 28 4 GLN A 24 ? ? -32.93 117.29 29 4 SER A 32 ? ? 80.65 -54.35 30 4 GLU A 35 ? ? 10.79 33.13 31 4 LYS A 36 ? ? -84.96 -153.63 32 5 THR A 7 ? ? -150.56 16.84 33 5 ASN A 12 ? ? -151.48 -55.50 34 5 LEU A 13 ? ? -75.79 41.70 35 5 CYS A 14 ? ? -124.21 -148.23 36 5 CYS A 16 ? ? -104.56 -61.51 37 5 GLN A 24 ? ? -31.86 124.52 38 5 ASN A 26 ? ? -111.41 -162.29 39 5 SER A 32 ? ? -139.28 -137.99 40 5 GLU A 35 ? ? -106.00 -117.28 41 5 LYS A 36 ? ? -45.39 175.47 42 5 ASN A 37 ? ? -174.67 133.28 43 5 PRO A 46 ? ? -60.48 -169.25 44 6 THR A 7 ? ? -157.02 15.87 45 6 GLN A 11 ? ? -51.80 -173.60 46 6 ASN A 12 ? ? -158.85 -51.88 47 6 LEU A 13 ? ? -76.49 40.10 48 6 CYS A 14 ? ? -124.76 -158.36 49 6 GLN A 24 ? ? -37.36 -5.20 50 6 SER A 32 ? ? -139.00 -137.68 51 6 GLU A 35 ? ? -98.01 -115.07 52 6 THR A 41 ? ? -43.76 161.48 53 6 GLU A 47 ? ? -36.01 98.52 54 6 PRO A 48 ? ? -58.42 104.30 55 7 TYR A 3 ? ? -107.72 -167.38 56 7 GLN A 11 ? ? -51.72 -176.63 57 7 ASN A 12 ? ? -144.64 -64.40 58 7 CYS A 14 ? ? -125.56 -152.01 59 7 GLU A 17 ? ? -152.30 83.30 60 7 SER A 19 ? ? -140.42 -2.18 61 7 ASN A 26 ? ? -158.22 -146.65 62 7 SER A 32 ? ? -68.32 -122.94 63 7 GLU A 35 ? ? -113.62 -136.67 64 7 CYS A 39 ? ? -115.82 74.33 65 8 THR A 7 ? ? -152.81 13.41 66 8 ASN A 12 ? ? -153.76 -70.37 67 8 LEU A 13 ? ? -77.97 45.60 68 8 CYS A 14 ? ? -123.82 -154.88 69 8 ASN A 26 ? ? -110.21 -167.58 70 8 SER A 32 ? ? -152.91 -136.56 71 8 LYS A 36 ? ? -35.21 -20.07 72 8 ASN A 37 ? ? -174.37 131.37 73 8 GLU A 43 ? ? -116.26 72.61 74 9 THR A 4 ? ? -118.76 -169.07 75 9 THR A 7 ? ? -159.09 16.26 76 9 GLN A 11 ? ? -49.55 -178.59 77 9 ASN A 12 ? ? -143.68 -67.83 78 9 LEU A 13 ? ? -77.78 48.28 79 9 CYS A 14 ? ? -122.93 -159.35 80 9 CYS A 16 ? ? -110.18 -73.47 81 9 SER A 32 ? ? -76.14 -129.61 82 9 GLU A 35 ? ? -127.00 -128.94 83 9 ASN A 37 ? ? -49.28 161.02 84 9 THR A 41 ? ? -47.61 163.17 85 9 PRO A 46 ? ? -54.96 -159.81 86 10 TYR A 3 ? ? -103.75 -167.19 87 10 GLN A 11 ? ? -49.66 179.35 88 10 ASN A 12 ? ? -138.12 -76.49 89 10 LEU A 13 ? ? -78.36 47.34 90 10 CYS A 14 ? ? -117.03 -157.13 91 10 ASN A 26 ? ? -123.11 -167.18 92 10 SER A 32 ? ? 73.87 -18.91 93 11 TYR A 3 ? ? -100.48 -165.07 94 11 SER A 9 ? ? -62.59 -175.79 95 11 GLN A 11 ? ? -53.79 -173.02 96 11 ASN A 12 ? ? -151.59 -57.63 97 11 LEU A 13 ? ? -75.70 49.75 98 11 CYS A 14 ? ? -130.37 -142.31 99 11 SER A 32 ? ? -67.13 -134.00 100 11 GLU A 35 ? ? -121.44 -135.19 101 11 GLU A 43 ? ? -160.13 106.55 102 12 THR A 7 ? ? -141.67 12.47 103 12 GLN A 11 ? ? -74.77 -167.43 104 12 ASN A 12 ? ? -155.09 -80.31 105 12 CYS A 14 ? ? -122.36 -156.07 106 12 CYS A 16 ? ? -108.19 -68.24 107 12 SER A 32 ? ? -74.54 -128.20 108 12 GLU A 35 ? ? -123.67 -130.09 109 13 THR A 7 ? ? -155.13 11.88 110 13 GLN A 11 ? ? -40.24 164.03 111 13 ASN A 12 ? ? -140.69 -50.45 112 13 LEU A 13 ? ? -77.35 43.47 113 13 CYS A 14 ? ? -123.05 -148.44 114 13 GLN A 24 ? ? -36.06 132.43 115 13 ASN A 26 ? ? -102.13 -159.77 116 13 SER A 32 ? ? -87.41 -133.92 117 13 GLU A 35 ? ? -130.08 -132.88 118 13 PRO A 46 ? ? -56.82 -175.88 119 13 PRO A 48 ? ? -55.40 -178.75 120 14 TYR A 3 ? ? -107.77 -163.96 121 14 ASN A 12 ? ? -143.85 -72.18 122 14 LEU A 13 ? ? -75.51 48.31 123 14 CYS A 14 ? ? -122.39 -151.50 124 14 CYS A 16 ? ? -107.40 -70.41 125 14 SER A 32 ? ? -109.96 -127.35 126 14 GLU A 35 ? ? -91.59 -111.28 127 14 LYS A 36 ? ? -58.52 76.94 128 14 PRO A 46 ? ? -58.54 -163.16 129 15 TYR A 3 ? ? -100.32 -169.44 130 15 GLN A 11 ? ? -76.24 -165.24 131 15 ASN A 12 ? ? -150.63 -77.33 132 15 CYS A 14 ? ? -123.53 -152.47 133 15 GLU A 17 ? ? -157.51 82.20 134 15 SER A 32 ? ? -152.56 -145.81 135 15 LYS A 36 ? ? -31.42 -157.40 136 15 PRO A 46 ? ? -52.44 -176.97 137 16 SER A 9 ? ? -65.10 -168.11 138 16 GLN A 11 ? ? -74.79 -167.00 139 16 ASN A 12 ? ? -143.01 -70.24 140 16 CYS A 14 ? ? -119.76 -146.48 141 16 GLU A 17 ? ? -146.41 55.16 142 16 SER A 32 ? ? -149.35 -130.78 143 16 LYS A 36 ? ? -34.75 -31.22 144 16 ASN A 37 ? ? -160.60 108.01 145 16 PRO A 46 ? ? -53.51 -164.79 146 17 ASN A 12 ? ? -146.62 -71.67 147 17 CYS A 14 ? ? -119.06 -156.44 148 17 ASN A 26 ? ? -111.14 -155.14 149 17 GLU A 47 ? ? -35.02 97.07 150 18 THR A 7 ? ? -159.47 18.31 151 18 GLN A 11 ? ? -47.65 178.68 152 18 ASN A 12 ? ? -144.38 -59.21 153 18 LEU A 13 ? ? -76.79 48.07 154 18 CYS A 14 ? ? -123.38 -160.24 155 18 ASN A 26 ? ? -115.31 -168.99 156 18 SER A 32 ? ? -154.14 -147.02 157 18 LYS A 36 ? ? -25.88 -156.12 158 18 GLU A 47 ? ? -36.74 101.05 159 19 TYR A 3 ? ? -130.00 -164.59 160 19 THR A 7 ? ? -153.90 7.72 161 19 GLN A 11 ? ? -56.21 -167.19 162 19 ASN A 12 ? ? -142.18 -69.20 163 19 CYS A 14 ? ? -114.22 -153.14 164 19 CYS A 16 ? ? -125.11 -77.85 165 19 ASN A 26 ? ? -126.00 -162.21 166 19 SER A 32 ? ? -167.34 -149.42 167 19 LYS A 36 ? ? -31.78 -175.56 168 19 PRO A 46 ? ? -53.50 171.88 169 20 TYR A 3 ? ? -126.29 -166.60 170 20 THR A 7 ? ? -151.84 11.11 171 20 GLN A 11 ? ? -56.86 -166.21 172 20 ASN A 12 ? ? -141.37 -66.78 173 20 CYS A 14 ? ? -123.62 -154.22 174 20 ASN A 26 ? ? -128.84 -159.94 175 20 SER A 32 ? ? -138.96 -132.15 176 20 GLU A 35 ? ? -93.82 -116.60 177 20 ASN A 37 ? ? -178.19 136.11 178 20 PRO A 48 ? ? -58.11 99.81 179 21 THR A 7 ? ? -152.69 10.84 180 21 GLN A 11 ? ? -58.42 -158.92 181 21 ASN A 12 ? ? -147.41 -67.13 182 21 LEU A 13 ? ? -77.96 49.33 183 21 CYS A 14 ? ? -119.41 -154.46 184 21 CYS A 16 ? ? -120.35 -58.76 185 21 SER A 32 ? ? -160.02 -131.71 186 21 LYS A 36 ? ? -35.40 -18.44 187 22 TYR A 3 ? ? -114.89 -166.49 188 22 THR A 7 ? ? -157.15 15.18 189 22 GLN A 11 ? ? -54.93 -171.36 190 22 ASN A 12 ? ? -148.40 -66.33 191 22 LEU A 13 ? ? -77.17 49.80 192 22 CYS A 14 ? ? -125.84 -156.42 193 22 ASN A 26 ? ? -142.67 -154.83 194 22 SER A 32 ? ? -155.82 -137.56 195 22 LYS A 36 ? ? -32.53 -153.55 196 23 VAL A 2 ? ? -79.45 -162.64 197 23 THR A 7 ? ? -157.46 17.65 198 23 GLN A 11 ? ? -54.78 -170.03 199 23 ASN A 12 ? ? -141.82 -66.92 200 23 CYS A 14 ? ? -124.89 -160.64 201 23 ASN A 26 ? ? -122.40 -166.86 202 23 SER A 32 ? ? -68.25 -120.60 203 23 ASP A 33 ? ? -69.06 69.24 204 23 GLU A 35 ? ? -109.80 -129.69 205 23 LYS A 36 ? ? -93.86 -86.21 206 24 GLN A 11 ? ? -44.09 168.39 207 24 ASN A 12 ? ? -141.90 -69.70 208 24 LEU A 13 ? ? -75.63 46.71 209 24 CYS A 14 ? ? -123.58 -156.93 210 24 GLN A 24 ? ? -39.33 129.81 211 24 SER A 32 ? ? -78.76 -127.46 212 24 GLU A 35 ? ? -125.70 -124.17 213 24 PRO A 46 ? ? -56.16 -170.61 214 25 GLN A 11 ? ? -61.17 -164.51 215 25 ASN A 12 ? ? -160.51 -66.96 216 25 LEU A 13 ? ? -75.85 41.10 217 25 CYS A 14 ? ? -120.30 -165.83 218 25 CYS A 22 ? ? -80.70 -135.44 219 25 GLN A 24 ? ? -34.32 131.92 220 25 SER A 32 ? ? -66.01 -127.78 221 25 GLU A 35 ? ? -125.70 -125.91 222 26 THR A 7 ? ? -148.68 21.02 223 26 GLN A 11 ? ? -60.75 -165.10 224 26 ASN A 12 ? ? -148.76 -70.26 225 26 LEU A 13 ? ? -75.74 47.46 226 26 CYS A 14 ? ? -124.74 -156.58 227 26 CYS A 16 ? ? -141.38 21.88 228 26 GLU A 17 ? ? -157.03 77.43 229 26 SER A 19 ? ? -145.56 11.67 230 26 SER A 32 ? ? -83.30 -134.48 231 26 GLU A 35 ? ? -126.71 -136.00 232 26 LYS A 36 ? ? -102.89 -154.84 233 26 THR A 41 ? ? -49.62 151.69 234 26 PRO A 46 ? ? -53.04 -168.92 235 27 TYR A 3 ? ? -122.82 -167.74 236 27 THR A 7 ? ? -155.04 12.95 237 27 SER A 9 ? ? -74.66 -160.11 238 27 ASN A 12 ? ? -138.92 -65.63 239 27 LEU A 13 ? ? -77.94 47.33 240 27 CYS A 14 ? ? -125.35 -167.40 241 27 SER A 32 ? ? -164.08 -129.70 242 27 LYS A 36 ? ? -36.23 -157.59 243 27 GLU A 47 ? ? -39.64 106.52 244 28 THR A 7 ? ? -154.37 18.56 245 28 SER A 9 ? ? -83.91 -158.52 246 28 ASN A 12 ? ? -147.57 -62.59 247 28 LEU A 13 ? ? -76.86 47.43 248 28 CYS A 14 ? ? -129.85 -168.07 249 28 SER A 32 ? ? -72.19 -130.48 250 28 GLU A 35 ? ? -122.27 -131.30 251 28 LYS A 36 ? ? -101.72 -168.59 252 29 THR A 4 ? ? -123.22 -167.44 253 29 GLN A 11 ? ? -47.31 176.39 254 29 ASN A 12 ? ? -147.93 -60.56 255 29 LEU A 13 ? ? -76.10 39.71 256 29 CYS A 14 ? ? -122.27 -164.58 257 29 CYS A 16 ? ? -100.91 -61.62 258 29 CYS A 22 ? ? -77.76 -130.85 259 29 GLN A 24 ? ? -36.61 129.69 260 29 ASN A 26 ? ? -107.50 -161.25 261 29 SER A 32 ? ? -84.42 -134.13 262 29 GLU A 35 ? ? -129.00 -128.84 263 29 PRO A 48 ? ? -59.93 -176.80 264 30 TYR A 3 ? ? -114.39 -165.41 265 30 SER A 9 ? ? -72.64 -163.75 266 30 GLN A 11 ? ? -71.09 -163.38 267 30 ASN A 12 ? ? -148.52 -77.55 268 30 LEU A 13 ? ? -78.08 42.13 269 30 CYS A 14 ? ? -113.33 -159.88 270 30 CYS A 16 ? ? -111.92 -74.42 271 30 ASN A 26 ? ? -119.80 -159.17 272 30 SER A 32 ? ? -125.15 -148.94 273 30 GLU A 35 ? ? -104.26 -113.40 274 30 LYS A 36 ? ? -58.91 173.15 275 30 THR A 41 ? ? -78.79 47.41 276 30 PRO A 46 ? ? -52.77 -164.03 277 30 PRO A 48 ? ? -68.39 -168.75 278 31 THR A 7 ? ? -143.72 17.50 279 31 SER A 9 ? ? -68.97 -168.37 280 31 GLN A 11 ? ? -69.67 -164.97 281 31 ASN A 12 ? ? -150.43 -70.17 282 31 LEU A 13 ? ? -77.28 48.96 283 31 CYS A 14 ? ? -125.39 -161.47 284 31 GLU A 17 ? ? -100.04 76.63 285 31 ASN A 26 ? ? -129.67 -160.47 286 31 SER A 32 ? ? -76.99 -129.28 287 31 GLU A 35 ? ? -120.30 -134.13 288 31 PRO A 46 ? ? -48.35 177.20 289 32 THR A 4 ? ? -114.45 -165.66 290 32 THR A 7 ? ? -140.94 13.31 291 32 ASN A 12 ? ? -153.51 -69.51 292 32 LEU A 13 ? ? -75.22 45.96 293 32 CYS A 14 ? ? -122.37 -149.50 294 32 CYS A 22 ? ? -77.94 -135.34 295 32 GLN A 24 ? ? -36.22 135.19 296 32 SER A 32 ? ? -90.94 -125.64 297 32 ASP A 33 ? ? -69.66 63.03 298 32 GLU A 35 ? ? -124.93 -132.69 299 32 GLU A 43 ? ? -160.87 81.78 300 32 PRO A 46 ? ? -55.85 -175.43 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 18 Y 1 A GLN 49 ? C ? A GLN 49 C 2 18 Y 1 A GLN 49 ? O ? A GLN 49 O 3 18 Y 1 A GLN 49 ? CG ? A GLN 49 CG 4 18 Y 1 A GLN 49 ? CD ? A GLN 49 CD 5 18 Y 1 A GLN 49 ? OE1 ? A GLN 49 OE1 6 18 Y 1 A GLN 49 ? NE2 ? A GLN 49 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 50 ? A SER 50 2 1 Y 1 A HIS 51 ? A HIS 51 3 1 Y 1 A ASN 52 ? A ASN 52 4 1 Y 1 A ASP 53 ? A ASP 53 5 1 Y 1 A GLY 54 ? A GLY 54 6 1 Y 1 A ASP 55 ? A ASP 55 7 1 Y 1 A PHE 56 ? A PHE 56 8 1 Y 1 A GLU 57 ? A GLU 57 9 1 Y 1 A GLU 58 ? A GLU 58 10 1 Y 1 A ILE 59 ? A ILE 59 11 1 Y 1 A PRO 60 ? A PRO 60 12 1 Y 1 A GLU 61 ? A GLU 61 13 1 Y 1 A GLU 62 ? A GLU 62 14 1 Y 1 A TYR 63 ? A TYR 63 15 1 Y 1 A LEU 64 ? A LEU 64 16 1 Y 1 A GLN 65 ? A GLN 65 17 2 Y 1 A SER 50 ? A SER 50 18 2 Y 1 A HIS 51 ? A HIS 51 19 2 Y 1 A ASN 52 ? A ASN 52 20 2 Y 1 A ASP 53 ? A ASP 53 21 2 Y 1 A GLY 54 ? A GLY 54 22 2 Y 1 A ASP 55 ? A ASP 55 23 2 Y 1 A PHE 56 ? A PHE 56 24 2 Y 1 A GLU 57 ? A GLU 57 25 2 Y 1 A GLU 58 ? A GLU 58 26 2 Y 1 A ILE 59 ? A ILE 59 27 2 Y 1 A PRO 60 ? A PRO 60 28 2 Y 1 A GLU 61 ? A GLU 61 29 2 Y 1 A GLU 62 ? A GLU 62 30 2 Y 1 A TYR 63 ? A TYR 63 31 2 Y 1 A LEU 64 ? A LEU 64 32 2 Y 1 A GLN 65 ? A GLN 65 33 3 Y 1 A SER 50 ? A SER 50 34 3 Y 1 A HIS 51 ? A HIS 51 35 3 Y 1 A ASN 52 ? A ASN 52 36 3 Y 1 A ASP 53 ? A ASP 53 37 3 Y 1 A GLY 54 ? A GLY 54 38 3 Y 1 A ASP 55 ? A ASP 55 39 3 Y 1 A PHE 56 ? A PHE 56 40 3 Y 1 A GLU 57 ? A GLU 57 41 3 Y 1 A GLU 58 ? A GLU 58 42 3 Y 1 A ILE 59 ? A ILE 59 43 3 Y 1 A PRO 60 ? A PRO 60 44 3 Y 1 A GLU 61 ? A GLU 61 45 3 Y 1 A GLU 62 ? A GLU 62 46 3 Y 1 A TYR 63 ? A TYR 63 47 3 Y 1 A LEU 64 ? A LEU 64 48 3 Y 1 A GLN 65 ? A GLN 65 49 4 Y 1 A SER 50 ? A SER 50 50 4 Y 1 A HIS 51 ? A HIS 51 51 4 Y 1 A ASN 52 ? A ASN 52 52 4 Y 1 A ASP 53 ? A ASP 53 53 4 Y 1 A GLY 54 ? A GLY 54 54 4 Y 1 A ASP 55 ? A ASP 55 55 4 Y 1 A PHE 56 ? A PHE 56 56 4 Y 1 A GLU 57 ? A GLU 57 57 4 Y 1 A GLU 58 ? A GLU 58 58 4 Y 1 A ILE 59 ? A ILE 59 59 4 Y 1 A PRO 60 ? A PRO 60 60 4 Y 1 A GLU 61 ? A GLU 61 61 4 Y 1 A GLU 62 ? A GLU 62 62 4 Y 1 A TYR 63 ? A TYR 63 63 4 Y 1 A LEU 64 ? A LEU 64 64 4 Y 1 A GLN 65 ? A GLN 65 65 5 Y 1 A SER 50 ? A SER 50 66 5 Y 1 A HIS 51 ? A HIS 51 67 5 Y 1 A ASN 52 ? A ASN 52 68 5 Y 1 A ASP 53 ? A ASP 53 69 5 Y 1 A GLY 54 ? A GLY 54 70 5 Y 1 A ASP 55 ? A ASP 55 71 5 Y 1 A PHE 56 ? A PHE 56 72 5 Y 1 A GLU 57 ? A GLU 57 73 5 Y 1 A GLU 58 ? A GLU 58 74 5 Y 1 A ILE 59 ? A ILE 59 75 5 Y 1 A PRO 60 ? A PRO 60 76 5 Y 1 A GLU 61 ? A GLU 61 77 5 Y 1 A GLU 62 ? A GLU 62 78 5 Y 1 A TYR 63 ? A TYR 63 79 5 Y 1 A LEU 64 ? A LEU 64 80 5 Y 1 A GLN 65 ? A GLN 65 81 6 Y 1 A SER 50 ? A SER 50 82 6 Y 1 A HIS 51 ? A HIS 51 83 6 Y 1 A ASN 52 ? A ASN 52 84 6 Y 1 A ASP 53 ? A ASP 53 85 6 Y 1 A GLY 54 ? A GLY 54 86 6 Y 1 A ASP 55 ? A ASP 55 87 6 Y 1 A PHE 56 ? A PHE 56 88 6 Y 1 A GLU 57 ? A GLU 57 89 6 Y 1 A GLU 58 ? A GLU 58 90 6 Y 1 A ILE 59 ? A ILE 59 91 6 Y 1 A PRO 60 ? A PRO 60 92 6 Y 1 A GLU 61 ? A GLU 61 93 6 Y 1 A GLU 62 ? A GLU 62 94 6 Y 1 A TYR 63 ? A TYR 63 95 6 Y 1 A LEU 64 ? A LEU 64 96 6 Y 1 A GLN 65 ? A GLN 65 97 7 Y 1 A SER 50 ? A SER 50 98 7 Y 1 A HIS 51 ? A HIS 51 99 7 Y 1 A ASN 52 ? A ASN 52 100 7 Y 1 A ASP 53 ? A ASP 53 101 7 Y 1 A GLY 54 ? A GLY 54 102 7 Y 1 A ASP 55 ? A ASP 55 103 7 Y 1 A PHE 56 ? A PHE 56 104 7 Y 1 A GLU 57 ? A GLU 57 105 7 Y 1 A GLU 58 ? A GLU 58 106 7 Y 1 A ILE 59 ? A ILE 59 107 7 Y 1 A PRO 60 ? A PRO 60 108 7 Y 1 A GLU 61 ? A GLU 61 109 7 Y 1 A GLU 62 ? A GLU 62 110 7 Y 1 A TYR 63 ? A TYR 63 111 7 Y 1 A LEU 64 ? A LEU 64 112 7 Y 1 A GLN 65 ? A GLN 65 113 8 Y 1 A SER 50 ? A SER 50 114 8 Y 1 A HIS 51 ? A HIS 51 115 8 Y 1 A ASN 52 ? A ASN 52 116 8 Y 1 A ASP 53 ? A ASP 53 117 8 Y 1 A GLY 54 ? A GLY 54 118 8 Y 1 A ASP 55 ? A ASP 55 119 8 Y 1 A PHE 56 ? A PHE 56 120 8 Y 1 A GLU 57 ? A GLU 57 121 8 Y 1 A GLU 58 ? A GLU 58 122 8 Y 1 A ILE 59 ? A ILE 59 123 8 Y 1 A PRO 60 ? A PRO 60 124 8 Y 1 A GLU 61 ? A GLU 61 125 8 Y 1 A GLU 62 ? A GLU 62 126 8 Y 1 A TYR 63 ? A TYR 63 127 8 Y 1 A LEU 64 ? A LEU 64 128 8 Y 1 A GLN 65 ? A GLN 65 129 9 Y 1 A SER 50 ? A SER 50 130 9 Y 1 A HIS 51 ? A HIS 51 131 9 Y 1 A ASN 52 ? A ASN 52 132 9 Y 1 A ASP 53 ? A ASP 53 133 9 Y 1 A GLY 54 ? A GLY 54 134 9 Y 1 A ASP 55 ? A ASP 55 135 9 Y 1 A PHE 56 ? A PHE 56 136 9 Y 1 A GLU 57 ? A GLU 57 137 9 Y 1 A GLU 58 ? A GLU 58 138 9 Y 1 A ILE 59 ? A ILE 59 139 9 Y 1 A PRO 60 ? A PRO 60 140 9 Y 1 A GLU 61 ? A GLU 61 141 9 Y 1 A GLU 62 ? A GLU 62 142 9 Y 1 A TYR 63 ? A TYR 63 143 9 Y 1 A LEU 64 ? A LEU 64 144 9 Y 1 A GLN 65 ? A GLN 65 145 10 Y 1 A SER 50 ? A SER 50 146 10 Y 1 A HIS 51 ? A HIS 51 147 10 Y 1 A ASN 52 ? A ASN 52 148 10 Y 1 A ASP 53 ? A ASP 53 149 10 Y 1 A GLY 54 ? A GLY 54 150 10 Y 1 A ASP 55 ? A ASP 55 151 10 Y 1 A PHE 56 ? A PHE 56 152 10 Y 1 A GLU 57 ? A GLU 57 153 10 Y 1 A GLU 58 ? A GLU 58 154 10 Y 1 A ILE 59 ? A ILE 59 155 10 Y 1 A PRO 60 ? A PRO 60 156 10 Y 1 A GLU 61 ? A GLU 61 157 10 Y 1 A GLU 62 ? A GLU 62 158 10 Y 1 A TYR 63 ? A TYR 63 159 10 Y 1 A LEU 64 ? A LEU 64 160 10 Y 1 A GLN 65 ? A GLN 65 161 11 Y 1 A SER 50 ? A SER 50 162 11 Y 1 A HIS 51 ? A HIS 51 163 11 Y 1 A ASN 52 ? A ASN 52 164 11 Y 1 A ASP 53 ? A ASP 53 165 11 Y 1 A GLY 54 ? A GLY 54 166 11 Y 1 A ASP 55 ? A ASP 55 167 11 Y 1 A PHE 56 ? A PHE 56 168 11 Y 1 A GLU 57 ? A GLU 57 169 11 Y 1 A GLU 58 ? A GLU 58 170 11 Y 1 A ILE 59 ? A ILE 59 171 11 Y 1 A PRO 60 ? A PRO 60 172 11 Y 1 A GLU 61 ? A GLU 61 173 11 Y 1 A GLU 62 ? A GLU 62 174 11 Y 1 A TYR 63 ? A TYR 63 175 11 Y 1 A LEU 64 ? A LEU 64 176 11 Y 1 A GLN 65 ? A GLN 65 177 12 Y 1 A SER 50 ? A SER 50 178 12 Y 1 A HIS 51 ? A HIS 51 179 12 Y 1 A ASN 52 ? A ASN 52 180 12 Y 1 A ASP 53 ? A ASP 53 181 12 Y 1 A GLY 54 ? A GLY 54 182 12 Y 1 A ASP 55 ? A ASP 55 183 12 Y 1 A PHE 56 ? A PHE 56 184 12 Y 1 A GLU 57 ? A GLU 57 185 12 Y 1 A GLU 58 ? A GLU 58 186 12 Y 1 A ILE 59 ? A ILE 59 187 12 Y 1 A PRO 60 ? A PRO 60 188 12 Y 1 A GLU 61 ? A GLU 61 189 12 Y 1 A GLU 62 ? A GLU 62 190 12 Y 1 A TYR 63 ? A TYR 63 191 12 Y 1 A LEU 64 ? A LEU 64 192 12 Y 1 A GLN 65 ? A GLN 65 193 13 Y 1 A SER 50 ? A SER 50 194 13 Y 1 A HIS 51 ? A HIS 51 195 13 Y 1 A ASN 52 ? A ASN 52 196 13 Y 1 A ASP 53 ? A ASP 53 197 13 Y 1 A GLY 54 ? A GLY 54 198 13 Y 1 A ASP 55 ? A ASP 55 199 13 Y 1 A PHE 56 ? A PHE 56 200 13 Y 1 A GLU 57 ? A GLU 57 201 13 Y 1 A GLU 58 ? A GLU 58 202 13 Y 1 A ILE 59 ? A ILE 59 203 13 Y 1 A PRO 60 ? A PRO 60 204 13 Y 1 A GLU 61 ? A GLU 61 205 13 Y 1 A GLU 62 ? A GLU 62 206 13 Y 1 A TYR 63 ? A TYR 63 207 13 Y 1 A LEU 64 ? A LEU 64 208 13 Y 1 A GLN 65 ? A GLN 65 209 14 Y 1 A SER 50 ? A SER 50 210 14 Y 1 A HIS 51 ? A HIS 51 211 14 Y 1 A ASN 52 ? A ASN 52 212 14 Y 1 A ASP 53 ? A ASP 53 213 14 Y 1 A GLY 54 ? A GLY 54 214 14 Y 1 A ASP 55 ? A ASP 55 215 14 Y 1 A PHE 56 ? A PHE 56 216 14 Y 1 A GLU 57 ? A GLU 57 217 14 Y 1 A GLU 58 ? A GLU 58 218 14 Y 1 A ILE 59 ? A ILE 59 219 14 Y 1 A PRO 60 ? A PRO 60 220 14 Y 1 A GLU 61 ? A GLU 61 221 14 Y 1 A GLU 62 ? A GLU 62 222 14 Y 1 A TYR 63 ? A TYR 63 223 14 Y 1 A LEU 64 ? A LEU 64 224 14 Y 1 A GLN 65 ? A GLN 65 225 15 Y 1 A SER 50 ? A SER 50 226 15 Y 1 A HIS 51 ? A HIS 51 227 15 Y 1 A ASN 52 ? A ASN 52 228 15 Y 1 A ASP 53 ? A ASP 53 229 15 Y 1 A GLY 54 ? A GLY 54 230 15 Y 1 A ASP 55 ? A ASP 55 231 15 Y 1 A PHE 56 ? A PHE 56 232 15 Y 1 A GLU 57 ? A GLU 57 233 15 Y 1 A GLU 58 ? A GLU 58 234 15 Y 1 A ILE 59 ? A ILE 59 235 15 Y 1 A PRO 60 ? A PRO 60 236 15 Y 1 A GLU 61 ? A GLU 61 237 15 Y 1 A GLU 62 ? A GLU 62 238 15 Y 1 A TYR 63 ? A TYR 63 239 15 Y 1 A LEU 64 ? A LEU 64 240 15 Y 1 A GLN 65 ? A GLN 65 241 16 Y 1 A SER 50 ? A SER 50 242 16 Y 1 A HIS 51 ? A HIS 51 243 16 Y 1 A ASN 52 ? A ASN 52 244 16 Y 1 A ASP 53 ? A ASP 53 245 16 Y 1 A GLY 54 ? A GLY 54 246 16 Y 1 A ASP 55 ? A ASP 55 247 16 Y 1 A PHE 56 ? A PHE 56 248 16 Y 1 A GLU 57 ? A GLU 57 249 16 Y 1 A GLU 58 ? A GLU 58 250 16 Y 1 A ILE 59 ? A ILE 59 251 16 Y 1 A PRO 60 ? A PRO 60 252 16 Y 1 A GLU 61 ? A GLU 61 253 16 Y 1 A GLU 62 ? A GLU 62 254 16 Y 1 A TYR 63 ? A TYR 63 255 16 Y 1 A LEU 64 ? A LEU 64 256 16 Y 1 A GLN 65 ? A GLN 65 257 17 Y 1 A SER 50 ? A SER 50 258 17 Y 1 A HIS 51 ? A HIS 51 259 17 Y 1 A ASN 52 ? A ASN 52 260 17 Y 1 A ASP 53 ? A ASP 53 261 17 Y 1 A GLY 54 ? A GLY 54 262 17 Y 1 A ASP 55 ? A ASP 55 263 17 Y 1 A PHE 56 ? A PHE 56 264 17 Y 1 A GLU 57 ? A GLU 57 265 17 Y 1 A GLU 58 ? A GLU 58 266 17 Y 1 A ILE 59 ? A ILE 59 267 17 Y 1 A PRO 60 ? A PRO 60 268 17 Y 1 A GLU 61 ? A GLU 61 269 17 Y 1 A GLU 62 ? A GLU 62 270 17 Y 1 A TYR 63 ? A TYR 63 271 17 Y 1 A LEU 64 ? A LEU 64 272 17 Y 1 A GLN 65 ? A GLN 65 273 18 Y 1 A SER 50 ? A SER 50 274 18 Y 1 A HIS 51 ? A HIS 51 275 18 Y 1 A ASN 52 ? A ASN 52 276 18 Y 1 A ASP 53 ? A ASP 53 277 18 Y 1 A GLY 54 ? A GLY 54 278 18 Y 1 A ASP 55 ? A ASP 55 279 18 Y 1 A PHE 56 ? A PHE 56 280 18 Y 1 A GLU 57 ? A GLU 57 281 18 Y 1 A GLU 58 ? A GLU 58 282 18 Y 1 A ILE 59 ? A ILE 59 283 18 Y 1 A PRO 60 ? A PRO 60 284 18 Y 1 A GLU 61 ? A GLU 61 285 18 Y 1 A GLU 62 ? A GLU 62 286 18 Y 1 A TYR 63 ? A TYR 63 287 18 Y 1 A LEU 64 ? A LEU 64 288 18 Y 1 A GLN 65 ? A GLN 65 289 19 Y 1 A SER 50 ? A SER 50 290 19 Y 1 A HIS 51 ? A HIS 51 291 19 Y 1 A ASN 52 ? A ASN 52 292 19 Y 1 A ASP 53 ? A ASP 53 293 19 Y 1 A GLY 54 ? A GLY 54 294 19 Y 1 A ASP 55 ? A ASP 55 295 19 Y 1 A PHE 56 ? A PHE 56 296 19 Y 1 A GLU 57 ? A GLU 57 297 19 Y 1 A GLU 58 ? A GLU 58 298 19 Y 1 A ILE 59 ? A ILE 59 299 19 Y 1 A PRO 60 ? A PRO 60 300 19 Y 1 A GLU 61 ? A GLU 61 301 19 Y 1 A GLU 62 ? A GLU 62 302 19 Y 1 A TYR 63 ? A TYR 63 303 19 Y 1 A LEU 64 ? A LEU 64 304 19 Y 1 A GLN 65 ? A GLN 65 305 20 Y 1 A SER 50 ? A SER 50 306 20 Y 1 A HIS 51 ? A HIS 51 307 20 Y 1 A ASN 52 ? A ASN 52 308 20 Y 1 A ASP 53 ? A ASP 53 309 20 Y 1 A GLY 54 ? A GLY 54 310 20 Y 1 A ASP 55 ? A ASP 55 311 20 Y 1 A PHE 56 ? A PHE 56 312 20 Y 1 A GLU 57 ? A GLU 57 313 20 Y 1 A GLU 58 ? A GLU 58 314 20 Y 1 A ILE 59 ? A ILE 59 315 20 Y 1 A PRO 60 ? A PRO 60 316 20 Y 1 A GLU 61 ? A GLU 61 317 20 Y 1 A GLU 62 ? A GLU 62 318 20 Y 1 A TYR 63 ? A TYR 63 319 20 Y 1 A LEU 64 ? A LEU 64 320 20 Y 1 A GLN 65 ? A GLN 65 321 21 Y 1 A SER 50 ? A SER 50 322 21 Y 1 A HIS 51 ? A HIS 51 323 21 Y 1 A ASN 52 ? A ASN 52 324 21 Y 1 A ASP 53 ? A ASP 53 325 21 Y 1 A GLY 54 ? A GLY 54 326 21 Y 1 A ASP 55 ? A ASP 55 327 21 Y 1 A PHE 56 ? A PHE 56 328 21 Y 1 A GLU 57 ? A GLU 57 329 21 Y 1 A GLU 58 ? A GLU 58 330 21 Y 1 A ILE 59 ? A ILE 59 331 21 Y 1 A PRO 60 ? A PRO 60 332 21 Y 1 A GLU 61 ? A GLU 61 333 21 Y 1 A GLU 62 ? A GLU 62 334 21 Y 1 A TYR 63 ? A TYR 63 335 21 Y 1 A LEU 64 ? A LEU 64 336 21 Y 1 A GLN 65 ? A GLN 65 337 22 Y 1 A SER 50 ? A SER 50 338 22 Y 1 A HIS 51 ? A HIS 51 339 22 Y 1 A ASN 52 ? A ASN 52 340 22 Y 1 A ASP 53 ? A ASP 53 341 22 Y 1 A GLY 54 ? A GLY 54 342 22 Y 1 A ASP 55 ? A ASP 55 343 22 Y 1 A PHE 56 ? A PHE 56 344 22 Y 1 A GLU 57 ? A GLU 57 345 22 Y 1 A GLU 58 ? A GLU 58 346 22 Y 1 A ILE 59 ? A ILE 59 347 22 Y 1 A PRO 60 ? A PRO 60 348 22 Y 1 A GLU 61 ? A GLU 61 349 22 Y 1 A GLU 62 ? A GLU 62 350 22 Y 1 A TYR 63 ? A TYR 63 351 22 Y 1 A LEU 64 ? A LEU 64 352 22 Y 1 A GLN 65 ? A GLN 65 353 23 Y 1 A SER 50 ? A SER 50 354 23 Y 1 A HIS 51 ? A HIS 51 355 23 Y 1 A ASN 52 ? A ASN 52 356 23 Y 1 A ASP 53 ? A ASP 53 357 23 Y 1 A GLY 54 ? A GLY 54 358 23 Y 1 A ASP 55 ? A ASP 55 359 23 Y 1 A PHE 56 ? A PHE 56 360 23 Y 1 A GLU 57 ? A GLU 57 361 23 Y 1 A GLU 58 ? A GLU 58 362 23 Y 1 A ILE 59 ? A ILE 59 363 23 Y 1 A PRO 60 ? A PRO 60 364 23 Y 1 A GLU 61 ? A GLU 61 365 23 Y 1 A GLU 62 ? A GLU 62 366 23 Y 1 A TYR 63 ? A TYR 63 367 23 Y 1 A LEU 64 ? A LEU 64 368 23 Y 1 A GLN 65 ? A GLN 65 369 24 Y 1 A SER 50 ? A SER 50 370 24 Y 1 A HIS 51 ? A HIS 51 371 24 Y 1 A ASN 52 ? A ASN 52 372 24 Y 1 A ASP 53 ? A ASP 53 373 24 Y 1 A GLY 54 ? A GLY 54 374 24 Y 1 A ASP 55 ? A ASP 55 375 24 Y 1 A PHE 56 ? A PHE 56 376 24 Y 1 A GLU 57 ? A GLU 57 377 24 Y 1 A GLU 58 ? A GLU 58 378 24 Y 1 A ILE 59 ? A ILE 59 379 24 Y 1 A PRO 60 ? A PRO 60 380 24 Y 1 A GLU 61 ? A GLU 61 381 24 Y 1 A GLU 62 ? A GLU 62 382 24 Y 1 A TYR 63 ? A TYR 63 383 24 Y 1 A LEU 64 ? A LEU 64 384 24 Y 1 A GLN 65 ? A GLN 65 385 25 Y 1 A SER 50 ? A SER 50 386 25 Y 1 A HIS 51 ? A HIS 51 387 25 Y 1 A ASN 52 ? A ASN 52 388 25 Y 1 A ASP 53 ? A ASP 53 389 25 Y 1 A GLY 54 ? A GLY 54 390 25 Y 1 A ASP 55 ? A ASP 55 391 25 Y 1 A PHE 56 ? A PHE 56 392 25 Y 1 A GLU 57 ? A GLU 57 393 25 Y 1 A GLU 58 ? A GLU 58 394 25 Y 1 A ILE 59 ? A ILE 59 395 25 Y 1 A PRO 60 ? A PRO 60 396 25 Y 1 A GLU 61 ? A GLU 61 397 25 Y 1 A GLU 62 ? A GLU 62 398 25 Y 1 A TYR 63 ? A TYR 63 399 25 Y 1 A LEU 64 ? A LEU 64 400 25 Y 1 A GLN 65 ? A GLN 65 401 26 Y 1 A SER 50 ? A SER 50 402 26 Y 1 A HIS 51 ? A HIS 51 403 26 Y 1 A ASN 52 ? A ASN 52 404 26 Y 1 A ASP 53 ? A ASP 53 405 26 Y 1 A GLY 54 ? A GLY 54 406 26 Y 1 A ASP 55 ? A ASP 55 407 26 Y 1 A PHE 56 ? A PHE 56 408 26 Y 1 A GLU 57 ? A GLU 57 409 26 Y 1 A GLU 58 ? A GLU 58 410 26 Y 1 A ILE 59 ? A ILE 59 411 26 Y 1 A PRO 60 ? A PRO 60 412 26 Y 1 A GLU 61 ? A GLU 61 413 26 Y 1 A GLU 62 ? A GLU 62 414 26 Y 1 A TYR 63 ? A TYR 63 415 26 Y 1 A LEU 64 ? A LEU 64 416 26 Y 1 A GLN 65 ? A GLN 65 417 27 Y 1 A SER 50 ? A SER 50 418 27 Y 1 A HIS 51 ? A HIS 51 419 27 Y 1 A ASN 52 ? A ASN 52 420 27 Y 1 A ASP 53 ? A ASP 53 421 27 Y 1 A GLY 54 ? A GLY 54 422 27 Y 1 A ASP 55 ? A ASP 55 423 27 Y 1 A PHE 56 ? A PHE 56 424 27 Y 1 A GLU 57 ? A GLU 57 425 27 Y 1 A GLU 58 ? A GLU 58 426 27 Y 1 A ILE 59 ? A ILE 59 427 27 Y 1 A PRO 60 ? A PRO 60 428 27 Y 1 A GLU 61 ? A GLU 61 429 27 Y 1 A GLU 62 ? A GLU 62 430 27 Y 1 A TYR 63 ? A TYR 63 431 27 Y 1 A LEU 64 ? A LEU 64 432 27 Y 1 A GLN 65 ? A GLN 65 433 28 Y 1 A SER 50 ? A SER 50 434 28 Y 1 A HIS 51 ? A HIS 51 435 28 Y 1 A ASN 52 ? A ASN 52 436 28 Y 1 A ASP 53 ? A ASP 53 437 28 Y 1 A GLY 54 ? A GLY 54 438 28 Y 1 A ASP 55 ? A ASP 55 439 28 Y 1 A PHE 56 ? A PHE 56 440 28 Y 1 A GLU 57 ? A GLU 57 441 28 Y 1 A GLU 58 ? A GLU 58 442 28 Y 1 A ILE 59 ? A ILE 59 443 28 Y 1 A PRO 60 ? A PRO 60 444 28 Y 1 A GLU 61 ? A GLU 61 445 28 Y 1 A GLU 62 ? A GLU 62 446 28 Y 1 A TYR 63 ? A TYR 63 447 28 Y 1 A LEU 64 ? A LEU 64 448 28 Y 1 A GLN 65 ? A GLN 65 449 29 Y 1 A SER 50 ? A SER 50 450 29 Y 1 A HIS 51 ? A HIS 51 451 29 Y 1 A ASN 52 ? A ASN 52 452 29 Y 1 A ASP 53 ? A ASP 53 453 29 Y 1 A GLY 54 ? A GLY 54 454 29 Y 1 A ASP 55 ? A ASP 55 455 29 Y 1 A PHE 56 ? A PHE 56 456 29 Y 1 A GLU 57 ? A GLU 57 457 29 Y 1 A GLU 58 ? A GLU 58 458 29 Y 1 A ILE 59 ? A ILE 59 459 29 Y 1 A PRO 60 ? A PRO 60 460 29 Y 1 A GLU 61 ? A GLU 61 461 29 Y 1 A GLU 62 ? A GLU 62 462 29 Y 1 A TYR 63 ? A TYR 63 463 29 Y 1 A LEU 64 ? A LEU 64 464 29 Y 1 A GLN 65 ? A GLN 65 465 30 Y 1 A SER 50 ? A SER 50 466 30 Y 1 A HIS 51 ? A HIS 51 467 30 Y 1 A ASN 52 ? A ASN 52 468 30 Y 1 A ASP 53 ? A ASP 53 469 30 Y 1 A GLY 54 ? A GLY 54 470 30 Y 1 A ASP 55 ? A ASP 55 471 30 Y 1 A PHE 56 ? A PHE 56 472 30 Y 1 A GLU 57 ? A GLU 57 473 30 Y 1 A GLU 58 ? A GLU 58 474 30 Y 1 A ILE 59 ? A ILE 59 475 30 Y 1 A PRO 60 ? A PRO 60 476 30 Y 1 A GLU 61 ? A GLU 61 477 30 Y 1 A GLU 62 ? A GLU 62 478 30 Y 1 A TYR 63 ? A TYR 63 479 30 Y 1 A LEU 64 ? A LEU 64 480 30 Y 1 A GLN 65 ? A GLN 65 481 31 Y 1 A SER 50 ? A SER 50 482 31 Y 1 A HIS 51 ? A HIS 51 483 31 Y 1 A ASN 52 ? A ASN 52 484 31 Y 1 A ASP 53 ? A ASP 53 485 31 Y 1 A GLY 54 ? A GLY 54 486 31 Y 1 A ASP 55 ? A ASP 55 487 31 Y 1 A PHE 56 ? A PHE 56 488 31 Y 1 A GLU 57 ? A GLU 57 489 31 Y 1 A GLU 58 ? A GLU 58 490 31 Y 1 A ILE 59 ? A ILE 59 491 31 Y 1 A PRO 60 ? A PRO 60 492 31 Y 1 A GLU 61 ? A GLU 61 493 31 Y 1 A GLU 62 ? A GLU 62 494 31 Y 1 A TYR 63 ? A TYR 63 495 31 Y 1 A LEU 64 ? A LEU 64 496 31 Y 1 A GLN 65 ? A GLN 65 497 32 Y 1 A SER 50 ? A SER 50 498 32 Y 1 A HIS 51 ? A HIS 51 499 32 Y 1 A ASN 52 ? A ASN 52 500 32 Y 1 A ASP 53 ? A ASP 53 501 32 Y 1 A GLY 54 ? A GLY 54 502 32 Y 1 A ASP 55 ? A ASP 55 503 32 Y 1 A PHE 56 ? A PHE 56 504 32 Y 1 A GLU 57 ? A GLU 57 505 32 Y 1 A GLU 58 ? A GLU 58 506 32 Y 1 A ILE 59 ? A ILE 59 507 32 Y 1 A PRO 60 ? A PRO 60 508 32 Y 1 A GLU 61 ? A GLU 61 509 32 Y 1 A GLU 62 ? A GLU 62 510 32 Y 1 A TYR 63 ? A TYR 63 511 32 Y 1 A LEU 64 ? A LEU 64 512 32 Y 1 A GLN 65 ? A GLN 65 #