data_4J7F # _entry.id 4J7F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4J7F RCSB RCSB077690 WWPDB D_1000077690 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3M53 . unspecified PDB 4J7I . unspecified PDB 4J83 . unspecified PDB 4J8O . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4J7F _pdbx_database_status.recvd_initial_deposition_date 2013-02-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Horowitz, S.' 1 'Del Rizzo, P.A.' 2 'Trievel, R.C.' 3 # _citation.id primary _citation.title 'Methyl CH O Hydrogen Bonds Orchestrate AdoMet-Dependent Methylation' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Horowitz, S.' 1 primary 'Dirk, L.M.A.' 2 primary 'Yesselman, J.D.' 3 primary 'Nimtz, J.S.' 4 primary 'Del Rizzo, P.A.' 5 primary 'Vander Meulen, K.A.' 6 primary 'Butcher, S.E.' 7 primary 'Mehl, R.A.' 8 primary 'Houtz, R.L.' 9 primary 'Al-Hashimi, H.M.' 10 primary 'Trievel, R.C.' 11 # _cell.entry_id 4J7F _cell.length_a 83.046 _cell.length_b 83.046 _cell.length_c 95.524 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4J7F _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone-lysine N-methyltransferase SETD7' 29042.346 1 2.1.1.43 Y335pAF ? ? 2 polymer syn 'Transcription initiation factor TFIID subunit 10' 1255.465 1 ? ? ? ? 3 non-polymer syn S-ADENOSYL-L-HOMOCYSTEINE 384.411 1 ? ? ? ? 4 water nat water 18.015 171 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Histone H3-K4 methyltransferase SETD7, H3-K4-HMTase SETD7, Lysine N-methyltransferase 7, SET domain-containing protein 7, SET7/9' 2 'STAF28, Transcription initiation factor TFIID 30 kDa subunit, TAF(II)30, TAFII-30, TAFII30' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GAMGYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELM PGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGN TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVA(HOX)GYDHSP PGKSGPEAPEWYQVELKAFQATQQK ; ;GAMGYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELM PGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGN TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAXGYDHSPPGKS GPEAPEWYQVELKAFQATQQK ; A ? 2 'polypeptide(L)' no yes '(ACE)SKSKDRKYTL' XSKSKDRKYTL B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 TYR n 1 6 LYS n 1 7 ASP n 1 8 ASN n 1 9 ILE n 1 10 ARG n 1 11 HIS n 1 12 GLY n 1 13 VAL n 1 14 CYS n 1 15 TRP n 1 16 ILE n 1 17 TYR n 1 18 TYR n 1 19 PRO n 1 20 ASP n 1 21 GLY n 1 22 GLY n 1 23 SER n 1 24 LEU n 1 25 VAL n 1 26 GLY n 1 27 GLU n 1 28 VAL n 1 29 ASN n 1 30 GLU n 1 31 ASP n 1 32 GLY n 1 33 GLU n 1 34 MET n 1 35 THR n 1 36 GLY n 1 37 GLU n 1 38 LYS n 1 39 ILE n 1 40 ALA n 1 41 TYR n 1 42 VAL n 1 43 TYR n 1 44 PRO n 1 45 ASP n 1 46 GLU n 1 47 ARG n 1 48 THR n 1 49 ALA n 1 50 LEU n 1 51 TYR n 1 52 GLY n 1 53 LYS n 1 54 PHE n 1 55 ILE n 1 56 ASP n 1 57 GLY n 1 58 GLU n 1 59 MET n 1 60 ILE n 1 61 GLU n 1 62 GLY n 1 63 LYS n 1 64 LEU n 1 65 ALA n 1 66 THR n 1 67 LEU n 1 68 MET n 1 69 SER n 1 70 THR n 1 71 GLU n 1 72 GLU n 1 73 GLY n 1 74 ARG n 1 75 PRO n 1 76 HIS n 1 77 PHE n 1 78 GLU n 1 79 LEU n 1 80 MET n 1 81 PRO n 1 82 GLY n 1 83 ASN n 1 84 SER n 1 85 VAL n 1 86 TYR n 1 87 HIS n 1 88 PHE n 1 89 ASP n 1 90 LYS n 1 91 SER n 1 92 THR n 1 93 SER n 1 94 SER n 1 95 CYS n 1 96 ILE n 1 97 SER n 1 98 THR n 1 99 ASN n 1 100 ALA n 1 101 LEU n 1 102 LEU n 1 103 PRO n 1 104 ASP n 1 105 PRO n 1 106 TYR n 1 107 GLU n 1 108 SER n 1 109 GLU n 1 110 ARG n 1 111 VAL n 1 112 TYR n 1 113 VAL n 1 114 ALA n 1 115 GLU n 1 116 SER n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 SER n 1 121 ALA n 1 122 GLY n 1 123 GLU n 1 124 GLY n 1 125 LEU n 1 126 PHE n 1 127 SER n 1 128 LYS n 1 129 VAL n 1 130 ALA n 1 131 VAL n 1 132 GLY n 1 133 PRO n 1 134 ASN n 1 135 THR n 1 136 VAL n 1 137 MET n 1 138 SER n 1 139 PHE n 1 140 TYR n 1 141 ASN n 1 142 GLY n 1 143 VAL n 1 144 ARG n 1 145 ILE n 1 146 THR n 1 147 HIS n 1 148 GLN n 1 149 GLU n 1 150 VAL n 1 151 ASP n 1 152 SER n 1 153 ARG n 1 154 ASP n 1 155 TRP n 1 156 ALA n 1 157 LEU n 1 158 ASN n 1 159 GLY n 1 160 ASN n 1 161 THR n 1 162 LEU n 1 163 SER n 1 164 LEU n 1 165 ASP n 1 166 GLU n 1 167 GLU n 1 168 THR n 1 169 VAL n 1 170 ILE n 1 171 ASP n 1 172 VAL n 1 173 PRO n 1 174 GLU n 1 175 PRO n 1 176 TYR n 1 177 ASN n 1 178 HIS n 1 179 VAL n 1 180 SER n 1 181 LYS n 1 182 TYR n 1 183 CYS n 1 184 ALA n 1 185 SER n 1 186 LEU n 1 187 GLY n 1 188 HIS n 1 189 LYS n 1 190 ALA n 1 191 ASN n 1 192 HIS n 1 193 SER n 1 194 PHE n 1 195 THR n 1 196 PRO n 1 197 ASN n 1 198 CYS n 1 199 ILE n 1 200 TYR n 1 201 ASP n 1 202 MET n 1 203 PHE n 1 204 VAL n 1 205 HIS n 1 206 PRO n 1 207 ARG n 1 208 PHE n 1 209 GLY n 1 210 PRO n 1 211 ILE n 1 212 LYS n 1 213 CYS n 1 214 ILE n 1 215 ARG n 1 216 THR n 1 217 LEU n 1 218 ARG n 1 219 ALA n 1 220 VAL n 1 221 GLU n 1 222 ALA n 1 223 ASP n 1 224 GLU n 1 225 GLU n 1 226 LEU n 1 227 THR n 1 228 VAL n 1 229 ALA n 1 230 HOX n 1 231 GLY n 1 232 TYR n 1 233 ASP n 1 234 HIS n 1 235 SER n 1 236 PRO n 1 237 PRO n 1 238 GLY n 1 239 LYS n 1 240 SER n 1 241 GLY n 1 242 PRO n 1 243 GLU n 1 244 ALA n 1 245 PRO n 1 246 GLU n 1 247 TRP n 1 248 TYR n 1 249 GLN n 1 250 VAL n 1 251 GLU n 1 252 LEU n 1 253 LYS n 1 254 ALA n 1 255 PHE n 1 256 GLN n 1 257 ALA n 1 258 THR n 1 259 GLN n 1 260 GLN n 1 261 LYS n 2 1 ACE n 2 2 SER n 2 3 LYS n 2 4 SER n 2 5 LYS n 2 6 ASP n 2 7 ARG n 2 8 LYS n 2 9 TYR n 2 10 THR n 2 11 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SETD7, KIAA1717, KMT7, SET7, SET9' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details 'Synthetically produced peptide' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP SETD7_HUMAN Q8WTS6 1 ;YKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNS VYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALNGNTLSL DEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEA PEWYQVELKAFQATQQK ; 110 ? 2 UNP TAF10_HUMAN Q12962 2 SKSKDRKYTL 186 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4J7F A 5 ? 261 ? Q8WTS6 110 ? 366 ? 110 366 2 2 4J7F B 2 ? 11 ? Q12962 186 ? 195 ? 186 195 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4J7F GLY A 1 ? UNP Q8WTS6 ? ? 'EXPRESSION TAG' 106 1 1 4J7F ALA A 2 ? UNP Q8WTS6 ? ? 'EXPRESSION TAG' 107 2 1 4J7F MET A 3 ? UNP Q8WTS6 ? ? 'EXPRESSION TAG' 108 3 1 4J7F GLY A 4 ? UNP Q8WTS6 ? ? 'EXPRESSION TAG' 109 4 1 4J7F HOX A 230 ? UNP Q8WTS6 TYR 335 'ENGINEERED MUTATION' 335 5 2 4J7F ACE B 1 ? UNP Q12962 ? ? 'EXPRESSION TAG' 185 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 HOX 'L-peptide linking' n 4-amino-L-phenylalanine ? 'C9 H12 N2 O2' 180.204 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAH 'L-peptide linking' n S-ADENOSYL-L-HOMOCYSTEINE ? 'C14 H20 N6 O5 S' 384.411 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4J7F _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_percent_sol 60.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details 'Sodium citrate, imidazole, nickel chloride, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date 2010-12-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9786 # _reflns.entry_id 4J7F _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 71.92 _reflns.d_resolution_high 1.59 _reflns.number_obs 48193 _reflns.number_all 51202 _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.64 _reflns_shell.percent_possible_all 94.9 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4J7F _refine.ls_number_reflns_obs 48193 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 71.92 _refine.ls_d_res_high 1.59 _refine.ls_percent_reflns_obs 99.15 _refine.ls_R_factor_obs 0.20215 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20144 _refine.ls_R_factor_R_free 0.21540 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 2574 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.952 _refine.B_iso_mean 23.915 _refine.aniso_B[1][1] 0.50 _refine.aniso_B[2][2] 0.50 _refine.aniso_B[3][3] -0.76 _refine.aniso_B[1][2] 0.25 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.076 _refine.pdbx_overall_ESU_R_Free 0.074 _refine.overall_SU_ML 0.050 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.434 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1889 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 171 _refine_hist.number_atoms_total 2086 _refine_hist.d_res_high 1.59 _refine_hist.d_res_low 71.92 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.014 0.022 ? 2025 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.506 1.971 ? 2769 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.113 5.000 ? 259 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 33.486 24.000 ? 85 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 11.330 15.000 ? 296 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 8.081 15.000 ? 8 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.101 0.200 ? 306 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.007 0.021 ? 1562 ? 'X-RAY DIFFRACTION' r_mcbond_it 1.094 1.500 ? 1269 ? 'X-RAY DIFFRACTION' r_mcangle_it 2.003 2.000 ? 2041 ? 'X-RAY DIFFRACTION' r_scbond_it 2.770 3.000 ? 756 ? 'X-RAY DIFFRACTION' r_scangle_it 4.571 4.500 ? 722 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.595 _refine_ls_shell.d_res_low 1.636 _refine_ls_shell.number_reflns_R_work 3356 _refine_ls_shell.R_factor_R_work 0.359 _refine_ls_shell.percent_reflns_obs 94.94 _refine_ls_shell.R_factor_R_free 0.413 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 170 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4J7F _struct.title 'SET7/9Y335pAF in complex with TAF10 peptide and AdoHcy' _struct.pdbx_descriptor 'Histone-lysine N-methyltransferase SETD7 (E.C.2.1.1.43), Transcription initiation factor TFIID subunit 10' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4J7F _struct_keywords.pdbx_keywords TRANSFERASE/PEPTIDE _struct_keywords.text 'SET domain, lysine methyltransferase, Y335pAF mutation, TRANSFERASE-PEPTIDE complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 104 ? GLU A 109 ? ASP A 209 GLU A 214 1 ? 6 HELX_P HELX_P2 2 THR A 146 ? SER A 152 ? THR A 251 SER A 257 1 ? 7 HELX_P HELX_P3 3 ASP A 154 ? ASN A 158 ? ASP A 259 ASN A 263 5 ? 5 HELX_P HELX_P4 4 LEU A 186 ? ALA A 190 ? LEU A 291 ALA A 295 5 ? 5 HELX_P HELX_P5 5 PRO A 245 ? ALA A 257 ? PRO A 350 ALA A 362 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ALA 229 C ? ? ? 1_555 A HOX 230 N ? ? A ALA 334 A HOX 335 1_555 ? ? ? ? ? ? ? 1.338 ? covale2 covale ? ? A HOX 230 C ? ? ? 1_555 A GLY 231 N ? ? A HOX 335 A GLY 336 1_555 ? ? ? ? ? ? ? 1.342 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 174 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 279 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 175 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 280 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.49 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 6 ? C ? 4 ? D ? 3 ? E ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel E 1 2 ? anti-parallel E 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 13 ? TYR A 17 ? VAL A 118 TYR A 122 A 2 SER A 23 ? GLU A 27 ? SER A 128 GLU A 132 A 3 GLY A 36 ? VAL A 42 ? GLY A 141 VAL A 147 A 4 THR A 48 ? ILE A 55 ? THR A 153 ILE A 160 A 5 GLU A 58 ? GLU A 71 ? GLU A 163 GLU A 176 A 6 ARG A 74 ? LEU A 79 ? ARG A 179 LEU A 184 B 1 VAL A 13 ? TYR A 17 ? VAL A 118 TYR A 122 B 2 SER A 23 ? GLU A 27 ? SER A 128 GLU A 132 B 3 GLY A 36 ? VAL A 42 ? GLY A 141 VAL A 147 B 4 THR A 48 ? ILE A 55 ? THR A 153 ILE A 160 B 5 GLU A 58 ? GLU A 71 ? GLU A 163 GLU A 176 B 6 VAL A 85 ? TYR A 86 ? VAL A 190 TYR A 191 C 1 VAL A 111 ? GLU A 115 ? VAL A 216 GLU A 220 C 2 GLU A 123 ? SER A 127 ? GLU A 228 SER A 232 C 3 GLU A 225 ? VAL A 228 ? GLU A 330 VAL A 333 C 4 ASN A 191 ? HIS A 192 ? ASN A 296 HIS A 297 D 1 VAL A 136 ? TYR A 140 ? VAL A 241 TYR A 245 D 2 GLY A 209 ? THR A 216 ? GLY A 314 THR A 321 D 3 CYS A 198 ? HIS A 205 ? CYS A 303 HIS A 310 E 1 VAL A 143 ? ILE A 145 ? VAL A 248 ILE A 250 E 2 VAL A 169 ? ASP A 171 ? VAL A 274 ASP A 276 E 3 LEU A 162 ? SER A 163 ? LEU A 267 SER A 268 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 16 ? N ILE A 121 O LEU A 24 ? O LEU A 129 A 2 3 N SER A 23 ? N SER A 128 O VAL A 42 ? O VAL A 147 A 3 4 N ILE A 39 ? N ILE A 144 O GLY A 52 ? O GLY A 157 A 4 5 N TYR A 51 ? N TYR A 156 O LYS A 63 ? O LYS A 168 A 5 6 N MET A 68 ? N MET A 173 O HIS A 76 ? O HIS A 181 B 1 2 N ILE A 16 ? N ILE A 121 O LEU A 24 ? O LEU A 129 B 2 3 N SER A 23 ? N SER A 128 O VAL A 42 ? O VAL A 147 B 3 4 N ILE A 39 ? N ILE A 144 O GLY A 52 ? O GLY A 157 B 4 5 N TYR A 51 ? N TYR A 156 O LYS A 63 ? O LYS A 168 B 5 6 N GLY A 62 ? N GLY A 167 O TYR A 86 ? O TYR A 191 C 1 2 N ALA A 114 ? N ALA A 219 O GLY A 124 ? O GLY A 229 C 2 3 N LEU A 125 ? N LEU A 230 O LEU A 226 ? O LEU A 331 C 3 4 O VAL A 228 ? O VAL A 333 N ASN A 191 ? N ASN A 296 D 1 2 N MET A 137 ? N MET A 242 O ILE A 214 ? O ILE A 319 D 2 3 O ILE A 211 ? O ILE A 316 N PHE A 203 ? N PHE A 308 E 1 2 N ILE A 145 ? N ILE A 250 O VAL A 169 ? O VAL A 274 E 2 3 O ILE A 170 ? O ILE A 275 N LEU A 162 ? N LEU A 267 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'BINDING SITE FOR RESIDUE SAH A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 ALA A 121 ? ALA A 226 . ? 1_555 ? 2 AC1 13 GLU A 123 ? GLU A 228 . ? 1_555 ? 3 AC1 13 GLY A 159 ? GLY A 264 . ? 1_555 ? 4 AC1 13 ASN A 160 ? ASN A 265 . ? 1_555 ? 5 AC1 13 HIS A 188 ? HIS A 293 . ? 1_555 ? 6 AC1 13 LYS A 189 ? LYS A 294 . ? 1_555 ? 7 AC1 13 ASN A 191 ? ASN A 296 . ? 1_555 ? 8 AC1 13 HIS A 192 ? HIS A 297 . ? 1_555 ? 9 AC1 13 HOX A 230 ? HOX A 335 . ? 1_555 ? 10 AC1 13 TRP A 247 ? TRP A 352 . ? 1_555 ? 11 AC1 13 HOH D . ? HOH A 573 . ? 1_555 ? 12 AC1 13 HOH D . ? HOH A 575 . ? 1_555 ? 13 AC1 13 HOH E . ? HOH B 205 . ? 1_555 ? # _database_PDB_matrix.entry_id 4J7F _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4J7F _atom_sites.fract_transf_matrix[1][1] 0.012042 _atom_sites.fract_transf_matrix[1][2] 0.006952 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013904 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010469 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 106 ? ? ? A . n A 1 2 ALA 2 107 ? ? ? A . n A 1 3 MET 3 108 ? ? ? A . n A 1 4 GLY 4 109 ? ? ? A . n A 1 5 TYR 5 110 ? ? ? A . n A 1 6 LYS 6 111 ? ? ? A . n A 1 7 ASP 7 112 ? ? ? A . n A 1 8 ASN 8 113 ? ? ? A . n A 1 9 ILE 9 114 ? ? ? A . n A 1 10 ARG 10 115 ? ? ? A . n A 1 11 HIS 11 116 ? ? ? A . n A 1 12 GLY 12 117 117 GLY GLY A . n A 1 13 VAL 13 118 118 VAL VAL A . n A 1 14 CYS 14 119 119 CYS CYS A . n A 1 15 TRP 15 120 120 TRP TRP A . n A 1 16 ILE 16 121 121 ILE ILE A . n A 1 17 TYR 17 122 122 TYR TYR A . n A 1 18 TYR 18 123 123 TYR TYR A . n A 1 19 PRO 19 124 124 PRO PRO A . n A 1 20 ASP 20 125 125 ASP ASP A . n A 1 21 GLY 21 126 126 GLY GLY A . n A 1 22 GLY 22 127 127 GLY GLY A . n A 1 23 SER 23 128 128 SER SER A . n A 1 24 LEU 24 129 129 LEU LEU A . n A 1 25 VAL 25 130 130 VAL VAL A . n A 1 26 GLY 26 131 131 GLY GLY A . n A 1 27 GLU 27 132 132 GLU GLU A . n A 1 28 VAL 28 133 133 VAL VAL A . n A 1 29 ASN 29 134 134 ASN ASN A . n A 1 30 GLU 30 135 135 GLU GLU A . n A 1 31 ASP 31 136 136 ASP ASP A . n A 1 32 GLY 32 137 137 GLY GLY A . n A 1 33 GLU 33 138 138 GLU GLU A . n A 1 34 MET 34 139 139 MET MET A . n A 1 35 THR 35 140 140 THR THR A . n A 1 36 GLY 36 141 141 GLY GLY A . n A 1 37 GLU 37 142 142 GLU GLU A . n A 1 38 LYS 38 143 143 LYS LYS A . n A 1 39 ILE 39 144 144 ILE ILE A . n A 1 40 ALA 40 145 145 ALA ALA A . n A 1 41 TYR 41 146 146 TYR TYR A . n A 1 42 VAL 42 147 147 VAL VAL A . n A 1 43 TYR 43 148 148 TYR TYR A . n A 1 44 PRO 44 149 149 PRO PRO A . n A 1 45 ASP 45 150 150 ASP ASP A . n A 1 46 GLU 46 151 151 GLU GLU A . n A 1 47 ARG 47 152 152 ARG ARG A . n A 1 48 THR 48 153 153 THR THR A . n A 1 49 ALA 49 154 154 ALA ALA A . n A 1 50 LEU 50 155 155 LEU LEU A . n A 1 51 TYR 51 156 156 TYR TYR A . n A 1 52 GLY 52 157 157 GLY GLY A . n A 1 53 LYS 53 158 158 LYS LYS A . n A 1 54 PHE 54 159 159 PHE PHE A . n A 1 55 ILE 55 160 160 ILE ILE A . n A 1 56 ASP 56 161 161 ASP ASP A . n A 1 57 GLY 57 162 162 GLY GLY A . n A 1 58 GLU 58 163 163 GLU GLU A . n A 1 59 MET 59 164 164 MET MET A . n A 1 60 ILE 60 165 165 ILE ILE A . n A 1 61 GLU 61 166 166 GLU GLU A . n A 1 62 GLY 62 167 167 GLY GLY A . n A 1 63 LYS 63 168 168 LYS LYS A . n A 1 64 LEU 64 169 169 LEU LEU A . n A 1 65 ALA 65 170 170 ALA ALA A . n A 1 66 THR 66 171 171 THR THR A . n A 1 67 LEU 67 172 172 LEU LEU A . n A 1 68 MET 68 173 173 MET MET A . n A 1 69 SER 69 174 174 SER SER A . n A 1 70 THR 70 175 175 THR THR A . n A 1 71 GLU 71 176 176 GLU GLU A . n A 1 72 GLU 72 177 177 GLU GLU A . n A 1 73 GLY 73 178 178 GLY GLY A . n A 1 74 ARG 74 179 179 ARG ARG A . n A 1 75 PRO 75 180 180 PRO PRO A . n A 1 76 HIS 76 181 181 HIS HIS A . n A 1 77 PHE 77 182 182 PHE PHE A . n A 1 78 GLU 78 183 183 GLU GLU A . n A 1 79 LEU 79 184 184 LEU LEU A . n A 1 80 MET 80 185 185 MET MET A . n A 1 81 PRO 81 186 186 PRO PRO A . n A 1 82 GLY 82 187 187 GLY GLY A . n A 1 83 ASN 83 188 188 ASN ASN A . n A 1 84 SER 84 189 189 SER SER A . n A 1 85 VAL 85 190 190 VAL VAL A . n A 1 86 TYR 86 191 191 TYR TYR A . n A 1 87 HIS 87 192 192 HIS HIS A . n A 1 88 PHE 88 193 193 PHE PHE A . n A 1 89 ASP 89 194 194 ASP ASP A . n A 1 90 LYS 90 195 195 LYS LYS A . n A 1 91 SER 91 196 196 SER SER A . n A 1 92 THR 92 197 197 THR THR A . n A 1 93 SER 93 198 198 SER SER A . n A 1 94 SER 94 199 199 SER SER A . n A 1 95 CYS 95 200 200 CYS CYS A . n A 1 96 ILE 96 201 201 ILE ILE A . n A 1 97 SER 97 202 202 SER SER A . n A 1 98 THR 98 203 203 THR THR A . n A 1 99 ASN 99 204 204 ASN ASN A . n A 1 100 ALA 100 205 205 ALA ALA A . n A 1 101 LEU 101 206 206 LEU LEU A . n A 1 102 LEU 102 207 207 LEU LEU A . n A 1 103 PRO 103 208 208 PRO PRO A . n A 1 104 ASP 104 209 209 ASP ASP A . n A 1 105 PRO 105 210 210 PRO PRO A . n A 1 106 TYR 106 211 211 TYR TYR A . n A 1 107 GLU 107 212 212 GLU GLU A . n A 1 108 SER 108 213 213 SER SER A . n A 1 109 GLU 109 214 214 GLU GLU A . n A 1 110 ARG 110 215 215 ARG ARG A . n A 1 111 VAL 111 216 216 VAL VAL A . n A 1 112 TYR 112 217 217 TYR TYR A . n A 1 113 VAL 113 218 218 VAL VAL A . n A 1 114 ALA 114 219 219 ALA ALA A . n A 1 115 GLU 115 220 220 GLU GLU A . n A 1 116 SER 116 221 221 SER SER A . n A 1 117 LEU 117 222 222 LEU LEU A . n A 1 118 ILE 118 223 223 ILE ILE A . n A 1 119 SER 119 224 224 SER SER A . n A 1 120 SER 120 225 225 SER SER A . n A 1 121 ALA 121 226 226 ALA ALA A . n A 1 122 GLY 122 227 227 GLY GLY A . n A 1 123 GLU 123 228 228 GLU GLU A . n A 1 124 GLY 124 229 229 GLY GLY A . n A 1 125 LEU 125 230 230 LEU LEU A . n A 1 126 PHE 126 231 231 PHE PHE A . n A 1 127 SER 127 232 232 SER SER A . n A 1 128 LYS 128 233 233 LYS LYS A . n A 1 129 VAL 129 234 234 VAL VAL A . n A 1 130 ALA 130 235 235 ALA ALA A . n A 1 131 VAL 131 236 236 VAL VAL A . n A 1 132 GLY 132 237 237 GLY GLY A . n A 1 133 PRO 133 238 238 PRO PRO A . n A 1 134 ASN 134 239 239 ASN ASN A . n A 1 135 THR 135 240 240 THR THR A . n A 1 136 VAL 136 241 241 VAL VAL A . n A 1 137 MET 137 242 242 MET MET A . n A 1 138 SER 138 243 243 SER SER A . n A 1 139 PHE 139 244 244 PHE PHE A . n A 1 140 TYR 140 245 245 TYR TYR A . n A 1 141 ASN 141 246 246 ASN ASN A . n A 1 142 GLY 142 247 247 GLY GLY A . n A 1 143 VAL 143 248 248 VAL VAL A . n A 1 144 ARG 144 249 249 ARG ARG A . n A 1 145 ILE 145 250 250 ILE ILE A . n A 1 146 THR 146 251 251 THR THR A . n A 1 147 HIS 147 252 252 HIS HIS A . n A 1 148 GLN 148 253 253 GLN GLN A . n A 1 149 GLU 149 254 254 GLU GLU A . n A 1 150 VAL 150 255 255 VAL VAL A . n A 1 151 ASP 151 256 256 ASP ASP A . n A 1 152 SER 152 257 257 SER SER A . n A 1 153 ARG 153 258 258 ARG ARG A . n A 1 154 ASP 154 259 259 ASP ASP A . n A 1 155 TRP 155 260 260 TRP TRP A . n A 1 156 ALA 156 261 261 ALA ALA A . n A 1 157 LEU 157 262 262 LEU LEU A . n A 1 158 ASN 158 263 263 ASN ASN A . n A 1 159 GLY 159 264 264 GLY GLY A . n A 1 160 ASN 160 265 265 ASN ASN A . n A 1 161 THR 161 266 266 THR THR A . n A 1 162 LEU 162 267 267 LEU LEU A . n A 1 163 SER 163 268 268 SER SER A . n A 1 164 LEU 164 269 269 LEU LEU A . n A 1 165 ASP 165 270 270 ASP ASP A . n A 1 166 GLU 166 271 271 GLU GLU A . n A 1 167 GLU 167 272 272 GLU GLU A . n A 1 168 THR 168 273 273 THR THR A . n A 1 169 VAL 169 274 274 VAL VAL A . n A 1 170 ILE 170 275 275 ILE ILE A . n A 1 171 ASP 171 276 276 ASP ASP A . n A 1 172 VAL 172 277 277 VAL VAL A . n A 1 173 PRO 173 278 278 PRO PRO A . n A 1 174 GLU 174 279 279 GLU GLU A . n A 1 175 PRO 175 280 280 PRO PRO A . n A 1 176 TYR 176 281 281 TYR TYR A . n A 1 177 ASN 177 282 282 ASN ASN A . n A 1 178 HIS 178 283 283 HIS HIS A . n A 1 179 VAL 179 284 284 VAL VAL A . n A 1 180 SER 180 285 285 SER SER A . n A 1 181 LYS 181 286 286 LYS LYS A . n A 1 182 TYR 182 287 287 TYR TYR A . n A 1 183 CYS 183 288 288 CYS CYS A . n A 1 184 ALA 184 289 289 ALA ALA A . n A 1 185 SER 185 290 290 SER SER A . n A 1 186 LEU 186 291 291 LEU LEU A . n A 1 187 GLY 187 292 292 GLY GLY A . n A 1 188 HIS 188 293 293 HIS HIS A . n A 1 189 LYS 189 294 294 LYS LYS A . n A 1 190 ALA 190 295 295 ALA ALA A . n A 1 191 ASN 191 296 296 ASN ASN A . n A 1 192 HIS 192 297 297 HIS HIS A . n A 1 193 SER 193 298 298 SER SER A . n A 1 194 PHE 194 299 299 PHE PHE A . n A 1 195 THR 195 300 300 THR THR A . n A 1 196 PRO 196 301 301 PRO PRO A . n A 1 197 ASN 197 302 302 ASN ASN A . n A 1 198 CYS 198 303 303 CYS CYS A . n A 1 199 ILE 199 304 304 ILE ILE A . n A 1 200 TYR 200 305 305 TYR TYR A . n A 1 201 ASP 201 306 306 ASP ASP A . n A 1 202 MET 202 307 307 MET MET A . n A 1 203 PHE 203 308 308 PHE PHE A . n A 1 204 VAL 204 309 309 VAL VAL A . n A 1 205 HIS 205 310 310 HIS HIS A . n A 1 206 PRO 206 311 311 PRO PRO A . n A 1 207 ARG 207 312 312 ARG ARG A . n A 1 208 PHE 208 313 313 PHE PHE A . n A 1 209 GLY 209 314 314 GLY GLY A . n A 1 210 PRO 210 315 315 PRO PRO A . n A 1 211 ILE 211 316 316 ILE ILE A . n A 1 212 LYS 212 317 317 LYS LYS A . n A 1 213 CYS 213 318 318 CYS CYS A . n A 1 214 ILE 214 319 319 ILE ILE A . n A 1 215 ARG 215 320 320 ARG ARG A . n A 1 216 THR 216 321 321 THR THR A . n A 1 217 LEU 217 322 322 LEU LEU A . n A 1 218 ARG 218 323 323 ARG ARG A . n A 1 219 ALA 219 324 324 ALA ALA A . n A 1 220 VAL 220 325 325 VAL VAL A . n A 1 221 GLU 221 326 326 GLU GLU A . n A 1 222 ALA 222 327 327 ALA ALA A . n A 1 223 ASP 223 328 328 ASP ASP A . n A 1 224 GLU 224 329 329 GLU GLU A . n A 1 225 GLU 225 330 330 GLU GLU A . n A 1 226 LEU 226 331 331 LEU LEU A . n A 1 227 THR 227 332 332 THR THR A . n A 1 228 VAL 228 333 333 VAL VAL A . n A 1 229 ALA 229 334 334 ALA ALA A . n A 1 230 HOX 230 335 335 HOX HOX A . n A 1 231 GLY 231 336 336 GLY GLY A . n A 1 232 TYR 232 337 337 TYR TYR A . n A 1 233 ASP 233 338 338 ASP ASP A . n A 1 234 HIS 234 339 339 HIS HIS A . n A 1 235 SER 235 340 340 SER SER A . n A 1 236 PRO 236 341 341 PRO PRO A . n A 1 237 PRO 237 342 ? ? ? A . n A 1 238 GLY 238 343 ? ? ? A . n A 1 239 LYS 239 344 ? ? ? A . n A 1 240 SER 240 345 ? ? ? A . n A 1 241 GLY 241 346 ? ? ? A . n A 1 242 PRO 242 347 347 PRO PRO A . n A 1 243 GLU 243 348 348 GLU GLU A . n A 1 244 ALA 244 349 349 ALA ALA A . n A 1 245 PRO 245 350 350 PRO PRO A . n A 1 246 GLU 246 351 351 GLU GLU A . n A 1 247 TRP 247 352 352 TRP TRP A . n A 1 248 TYR 248 353 353 TYR TYR A . n A 1 249 GLN 249 354 354 GLN GLN A . n A 1 250 VAL 250 355 355 VAL VAL A . n A 1 251 GLU 251 356 356 GLU GLU A . n A 1 252 LEU 252 357 357 LEU LEU A . n A 1 253 LYS 253 358 358 LYS LYS A . n A 1 254 ALA 254 359 359 ALA ALA A . n A 1 255 PHE 255 360 360 PHE PHE A . n A 1 256 GLN 256 361 361 GLN GLN A . n A 1 257 ALA 257 362 362 ALA ALA A . n A 1 258 THR 258 363 ? ? ? A . n A 1 259 GLN 259 364 ? ? ? A . n A 1 260 GLN 260 365 ? ? ? A . n A 1 261 LYS 261 366 ? ? ? A . n B 2 1 ACE 1 185 ? ? ? B . n B 2 2 SER 2 186 186 SER SER B . n B 2 3 LYS 3 187 187 LYS LYS B . n B 2 4 SER 4 188 188 SER SER B . n B 2 5 LYS 5 189 189 LYS LYS B . n B 2 6 ASP 6 190 190 ASP ASP B . n B 2 7 ARG 7 191 191 ARG ARG B . n B 2 8 LYS 8 192 ? ? ? B . n B 2 9 TYR 9 193 ? ? ? B . n B 2 10 THR 10 194 ? ? ? B . n B 2 11 LEU 11 195 ? ? ? B . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id HOX _pdbx_struct_mod_residue.label_seq_id 230 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id HOX _pdbx_struct_mod_residue.auth_seq_id 335 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id PHE _pdbx_struct_mod_residue.details 4-AMINO-L-PHENYLALANINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E 2 1,2 A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1220 ? 1 MORE -1 ? 1 'SSA (A^2)' 11430 ? 2 'ABSA (A^2)' 3470 ? 2 MORE -7 ? 2 'SSA (A^2)' 21830 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 31.8413333333 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2014-03-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing . ? 2 REFMAC refinement 5.5.0109 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 306 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 646 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 152 ? ? -141.31 -43.07 2 1 ASN A 188 ? ? -103.91 56.64 3 1 ASP A 194 ? ? -153.16 58.34 4 1 THR A 197 ? ? -120.01 -166.31 5 1 SER A 202 ? ? -173.31 144.10 6 1 CYS A 288 ? ? -141.83 18.95 7 1 LYS B 187 ? ? -92.17 50.32 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 135 ? CG ? A GLU 30 CG 2 1 Y 1 A GLU 135 ? CD ? A GLU 30 CD 3 1 Y 1 A GLU 135 ? OE1 ? A GLU 30 OE1 4 1 Y 1 A GLU 135 ? OE2 ? A GLU 30 OE2 5 1 Y 1 A ASP 136 ? CG ? A ASP 31 CG 6 1 Y 1 A ASP 136 ? OD1 ? A ASP 31 OD1 7 1 Y 1 A ASP 136 ? OD2 ? A ASP 31 OD2 8 1 Y 1 A ARG 152 ? CG ? A ARG 47 CG 9 1 Y 1 A ARG 152 ? CD ? A ARG 47 CD 10 1 Y 1 A ARG 152 ? NE ? A ARG 47 NE 11 1 Y 1 A ARG 152 ? CZ ? A ARG 47 CZ 12 1 Y 1 A ARG 152 ? NH1 ? A ARG 47 NH1 13 1 Y 1 A ARG 152 ? NH2 ? A ARG 47 NH2 14 1 Y 1 A ASN 188 ? CG ? A ASN 83 CG 15 1 Y 1 A ASN 188 ? OD1 ? A ASN 83 OD1 16 1 Y 1 A ASN 188 ? ND2 ? A ASN 83 ND2 17 1 Y 1 A SER 224 ? OG ? A SER 119 OG 18 1 Y 1 A SER 225 ? OG ? A SER 120 OG 19 1 Y 1 A GLN 253 ? CG ? A GLN 148 CG 20 1 Y 1 A GLN 253 ? CD ? A GLN 148 CD 21 1 Y 1 A GLN 253 ? OE1 ? A GLN 148 OE1 22 1 Y 1 A GLN 253 ? NE2 ? A GLN 148 NE2 23 1 Y 1 A ASP 259 ? CG ? A ASP 154 CG 24 1 Y 1 A ASP 259 ? OD1 ? A ASP 154 OD1 25 1 Y 1 A ASP 259 ? OD2 ? A ASP 154 OD2 26 1 Y 1 A GLU 271 ? CG ? A GLU 166 CG 27 1 Y 1 A GLU 271 ? CD ? A GLU 166 CD 28 1 Y 1 A GLU 271 ? OE1 ? A GLU 166 OE1 29 1 Y 1 A GLU 271 ? OE2 ? A GLU 166 OE2 30 1 Y 1 A GLU 272 ? CG ? A GLU 167 CG 31 1 Y 1 A GLU 272 ? CD ? A GLU 167 CD 32 1 Y 1 A GLU 272 ? OE1 ? A GLU 167 OE1 33 1 Y 1 A GLU 272 ? OE2 ? A GLU 167 OE2 34 1 Y 1 A SER 340 ? OG ? A SER 235 OG 35 1 Y 1 A GLU 351 ? CG ? A GLU 246 CG 36 1 Y 1 A GLU 351 ? CD ? A GLU 246 CD 37 1 Y 1 A GLU 351 ? OE1 ? A GLU 246 OE1 38 1 Y 1 A GLU 351 ? OE2 ? A GLU 246 OE2 39 1 Y 1 A GLU 356 ? CG ? A GLU 251 CG 40 1 Y 1 A GLU 356 ? CD ? A GLU 251 CD 41 1 Y 1 A GLU 356 ? OE1 ? A GLU 251 OE1 42 1 Y 1 A GLU 356 ? OE2 ? A GLU 251 OE2 43 1 Y 1 A LYS 358 ? CG ? A LYS 253 CG 44 1 Y 1 A LYS 358 ? CD ? A LYS 253 CD 45 1 Y 1 A LYS 358 ? CE ? A LYS 253 CE 46 1 Y 1 A LYS 358 ? NZ ? A LYS 253 NZ 47 1 Y 1 A GLN 361 ? CG ? A GLN 256 CG 48 1 Y 1 A GLN 361 ? CD ? A GLN 256 CD 49 1 Y 1 A GLN 361 ? OE1 ? A GLN 256 OE1 50 1 Y 1 A GLN 361 ? NE2 ? A GLN 256 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 106 ? A GLY 1 2 1 Y 1 A ALA 107 ? A ALA 2 3 1 Y 1 A MET 108 ? A MET 3 4 1 Y 1 A GLY 109 ? A GLY 4 5 1 Y 1 A TYR 110 ? A TYR 5 6 1 Y 1 A LYS 111 ? A LYS 6 7 1 Y 1 A ASP 112 ? A ASP 7 8 1 Y 1 A ASN 113 ? A ASN 8 9 1 Y 1 A ILE 114 ? A ILE 9 10 1 Y 1 A ARG 115 ? A ARG 10 11 1 Y 1 A HIS 116 ? A HIS 11 12 1 Y 1 A PRO 342 ? A PRO 237 13 1 Y 1 A GLY 343 ? A GLY 238 14 1 Y 1 A LYS 344 ? A LYS 239 15 1 Y 1 A SER 345 ? A SER 240 16 1 Y 1 A GLY 346 ? A GLY 241 17 1 Y 1 A THR 363 ? A THR 258 18 1 Y 1 A GLN 364 ? A GLN 259 19 1 Y 1 A GLN 365 ? A GLN 260 20 1 Y 1 A LYS 366 ? A LYS 261 21 1 Y 1 B ACE 185 ? B ACE 1 22 1 Y 1 B LYS 192 ? B LYS 8 23 1 Y 1 B TYR 193 ? B TYR 9 24 1 Y 1 B THR 194 ? B THR 10 25 1 Y 1 B LEU 195 ? B LEU 11 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 S-ADENOSYL-L-HOMOCYSTEINE SAH 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SAH 1 401 1 SAH SAH A . D 4 HOH 1 501 1 HOH HOH A . D 4 HOH 2 502 3 HOH HOH A . D 4 HOH 3 503 4 HOH HOH A . D 4 HOH 4 504 5 HOH HOH A . D 4 HOH 5 505 6 HOH HOH A . D 4 HOH 6 506 7 HOH HOH A . D 4 HOH 7 507 8 HOH HOH A . D 4 HOH 8 508 9 HOH HOH A . D 4 HOH 9 509 10 HOH HOH A . D 4 HOH 10 510 11 HOH HOH A . D 4 HOH 11 511 12 HOH HOH A . D 4 HOH 12 512 13 HOH HOH A . D 4 HOH 13 513 14 HOH HOH A . D 4 HOH 14 514 15 HOH HOH A . D 4 HOH 15 515 16 HOH HOH A . D 4 HOH 16 516 17 HOH HOH A . D 4 HOH 17 517 18 HOH HOH A . D 4 HOH 18 518 19 HOH HOH A . D 4 HOH 19 519 20 HOH HOH A . D 4 HOH 20 520 22 HOH HOH A . D 4 HOH 21 521 23 HOH HOH A . D 4 HOH 22 522 24 HOH HOH A . D 4 HOH 23 523 25 HOH HOH A . D 4 HOH 24 524 26 HOH HOH A . D 4 HOH 25 525 27 HOH HOH A . D 4 HOH 26 526 28 HOH HOH A . D 4 HOH 27 527 29 HOH HOH A . D 4 HOH 28 528 30 HOH HOH A . D 4 HOH 29 529 32 HOH HOH A . D 4 HOH 30 530 33 HOH HOH A . D 4 HOH 31 531 34 HOH HOH A . D 4 HOH 32 532 35 HOH HOH A . D 4 HOH 33 533 36 HOH HOH A . D 4 HOH 34 534 37 HOH HOH A . D 4 HOH 35 535 38 HOH HOH A . D 4 HOH 36 536 39 HOH HOH A . D 4 HOH 37 537 40 HOH HOH A . D 4 HOH 38 538 41 HOH HOH A . D 4 HOH 39 539 43 HOH HOH A . D 4 HOH 40 540 45 HOH HOH A . D 4 HOH 41 541 46 HOH HOH A . D 4 HOH 42 542 47 HOH HOH A . D 4 HOH 43 543 48 HOH HOH A . D 4 HOH 44 544 49 HOH HOH A . D 4 HOH 45 545 50 HOH HOH A . D 4 HOH 46 546 51 HOH HOH A . D 4 HOH 47 547 52 HOH HOH A . D 4 HOH 48 548 53 HOH HOH A . D 4 HOH 49 549 56 HOH HOH A . D 4 HOH 50 550 57 HOH HOH A . D 4 HOH 51 551 59 HOH HOH A . D 4 HOH 52 552 60 HOH HOH A . D 4 HOH 53 553 62 HOH HOH A . D 4 HOH 54 554 63 HOH HOH A . D 4 HOH 55 555 64 HOH HOH A . D 4 HOH 56 556 65 HOH HOH A . D 4 HOH 57 557 66 HOH HOH A . D 4 HOH 58 558 67 HOH HOH A . D 4 HOH 59 559 68 HOH HOH A . D 4 HOH 60 560 69 HOH HOH A . D 4 HOH 61 561 70 HOH HOH A . D 4 HOH 62 562 72 HOH HOH A . D 4 HOH 63 563 73 HOH HOH A . D 4 HOH 64 564 74 HOH HOH A . D 4 HOH 65 565 75 HOH HOH A . D 4 HOH 66 566 76 HOH HOH A . D 4 HOH 67 567 80 HOH HOH A . D 4 HOH 68 568 81 HOH HOH A . D 4 HOH 69 569 82 HOH HOH A . D 4 HOH 70 570 83 HOH HOH A . D 4 HOH 71 571 84 HOH HOH A . D 4 HOH 72 572 85 HOH HOH A . D 4 HOH 73 573 87 HOH HOH A . D 4 HOH 74 574 88 HOH HOH A . D 4 HOH 75 575 90 HOH HOH A . D 4 HOH 76 576 91 HOH HOH A . D 4 HOH 77 577 92 HOH HOH A . D 4 HOH 78 578 93 HOH HOH A . D 4 HOH 79 579 94 HOH HOH A . D 4 HOH 80 580 95 HOH HOH A . D 4 HOH 81 581 96 HOH HOH A . D 4 HOH 82 582 97 HOH HOH A . D 4 HOH 83 583 98 HOH HOH A . D 4 HOH 84 584 102 HOH HOH A . D 4 HOH 85 585 103 HOH HOH A . D 4 HOH 86 586 104 HOH HOH A . D 4 HOH 87 587 367 HOH HOH A . D 4 HOH 88 588 368 HOH HOH A . D 4 HOH 89 589 369 HOH HOH A . D 4 HOH 90 590 372 HOH HOH A . D 4 HOH 91 591 373 HOH HOH A . D 4 HOH 92 592 374 HOH HOH A . D 4 HOH 93 593 377 HOH HOH A . D 4 HOH 94 594 379 HOH HOH A . D 4 HOH 95 595 381 HOH HOH A . D 4 HOH 96 596 382 HOH HOH A . D 4 HOH 97 597 384 HOH HOH A . D 4 HOH 98 598 386 HOH HOH A . D 4 HOH 99 599 388 HOH HOH A . D 4 HOH 100 600 390 HOH HOH A . D 4 HOH 101 601 391 HOH HOH A . D 4 HOH 102 602 392 HOH HOH A . D 4 HOH 103 603 393 HOH HOH A . D 4 HOH 104 604 394 HOH HOH A . D 4 HOH 105 605 395 HOH HOH A . D 4 HOH 106 606 396 HOH HOH A . D 4 HOH 107 607 398 HOH HOH A . D 4 HOH 108 608 399 HOH HOH A . D 4 HOH 109 609 400 HOH HOH A . D 4 HOH 110 610 408 HOH HOH A . D 4 HOH 111 611 409 HOH HOH A . D 4 HOH 112 612 411 HOH HOH A . D 4 HOH 113 613 413 HOH HOH A . D 4 HOH 114 614 414 HOH HOH A . D 4 HOH 115 615 415 HOH HOH A . D 4 HOH 116 616 419 HOH HOH A . D 4 HOH 117 617 425 HOH HOH A . D 4 HOH 118 618 427 HOH HOH A . D 4 HOH 119 619 428 HOH HOH A . D 4 HOH 120 620 432 HOH HOH A . D 4 HOH 121 621 433 HOH HOH A . D 4 HOH 122 622 434 HOH HOH A . D 4 HOH 123 623 435 HOH HOH A . D 4 HOH 124 624 436 HOH HOH A . D 4 HOH 125 625 437 HOH HOH A . D 4 HOH 126 626 439 HOH HOH A . D 4 HOH 127 627 441 HOH HOH A . D 4 HOH 128 628 445 HOH HOH A . D 4 HOH 129 629 446 HOH HOH A . D 4 HOH 130 630 450 HOH HOH A . D 4 HOH 131 631 452 HOH HOH A . D 4 HOH 132 632 453 HOH HOH A . D 4 HOH 133 633 456 HOH HOH A . D 4 HOH 134 634 460 HOH HOH A . D 4 HOH 135 635 467 HOH HOH A . D 4 HOH 136 636 469 HOH HOH A . D 4 HOH 137 637 470 HOH HOH A . D 4 HOH 138 638 201 HOH HOH A . D 4 HOH 139 639 1 HOH HOH A . D 4 HOH 140 640 3 HOH HOH A . D 4 HOH 141 641 6 HOH HOH A . D 4 HOH 142 642 7 HOH HOH A . D 4 HOH 143 643 13 HOH HOH A . D 4 HOH 144 644 14 HOH HOH A . D 4 HOH 145 645 15 HOH HOH A . D 4 HOH 146 646 17 HOH HOH A . D 4 HOH 147 647 19 HOH HOH A . D 4 HOH 148 648 20 HOH HOH A . D 4 HOH 149 649 22 HOH HOH A . D 4 HOH 150 650 24 HOH HOH A . D 4 HOH 151 651 32 HOH HOH A . D 4 HOH 152 652 33 HOH HOH A . D 4 HOH 153 653 35 HOH HOH A . D 4 HOH 154 654 48 HOH HOH A . D 4 HOH 155 655 57 HOH HOH A . D 4 HOH 156 656 68 HOH HOH A . D 4 HOH 157 657 69 HOH HOH A . D 4 HOH 158 658 70 HOH HOH A . D 4 HOH 159 659 84 HOH HOH A . D 4 HOH 160 660 100 HOH HOH A . D 4 HOH 161 661 118 HOH HOH A . D 4 HOH 162 662 204 HOH HOH A . D 4 HOH 163 663 210 HOH HOH A . D 4 HOH 164 664 225 HOH HOH A . D 4 HOH 165 665 226 HOH HOH A . D 4 HOH 166 666 227 HOH HOH A . E 4 HOH 1 201 402 HOH HOH B . E 4 HOH 2 202 44 HOH HOH B . E 4 HOH 3 203 108 HOH HOH B . E 4 HOH 4 204 110 HOH HOH B . E 4 HOH 5 205 1 HOH HOH B . #