data_4K55 # _entry.id 4K55 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4K55 RCSB RCSB078903 WWPDB D_1000078903 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4jkw _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4K55 _pdbx_database_status.recvd_initial_deposition_date 2013-04-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kumar, A.' 1 'Mori, L.' 2 'De Libero, G.' 3 # _citation.id primary _citation.title 'Butyrophilin 3A1 binds phosphorylated antigens and stimulates human gamma delta T cells.' _citation.journal_abbrev Nat.Immunol. _citation.journal_volume 14 _citation.page_first 908 _citation.page_last 916 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1529-2908 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23872678 _citation.pdbx_database_id_DOI 10.1038/ni.2665 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vavassori, S.' 1 primary 'Kumar, A.' 2 primary 'Wan, G.S.' 3 primary 'Ramanjaneyulu, G.S.' 4 primary 'Cavallari, M.' 5 primary 'El Daker, S.' 6 primary 'Beddoe, T.' 7 primary 'Theodossis, A.' 8 primary 'Williams, N.K.' 9 primary 'Gostick, E.' 10 primary 'Price, D.A.' 11 primary 'Soudamini, D.U.' 12 primary 'Voon, K.K.' 13 primary 'Olivo, M.' 14 primary 'Rossjohn, J.' 15 primary 'Mori, L.' 16 primary 'De Libero, G.' 17 # _cell.entry_id 4K55 _cell.length_a 35.766 _cell.length_b 107.744 _cell.length_c 32.716 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4K55 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Butyrophilin subfamily 3 member A1' 13772.517 1 ? ? 'unp residues 28-143' ? 2 non-polymer syn '(2E)-4-hydroxy-3-methylbut-2-en-1-yl trihydrogen diphosphate' 262.092 1 ? ? ? ? 3 water nat water 18.015 84 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAG KAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;SAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAG KAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 GLN n 1 4 PHE n 1 5 SER n 1 6 VAL n 1 7 LEU n 1 8 GLY n 1 9 PRO n 1 10 SER n 1 11 GLY n 1 12 PRO n 1 13 ILE n 1 14 LEU n 1 15 ALA n 1 16 MET n 1 17 VAL n 1 18 GLY n 1 19 GLU n 1 20 ASP n 1 21 ALA n 1 22 ASP n 1 23 LEU n 1 24 PRO n 1 25 CYS n 1 26 HIS n 1 27 LEU n 1 28 PHE n 1 29 PRO n 1 30 THR n 1 31 MET n 1 32 SER n 1 33 ALA n 1 34 GLU n 1 35 THR n 1 36 MET n 1 37 GLU n 1 38 LEU n 1 39 LYS n 1 40 TRP n 1 41 VAL n 1 42 SER n 1 43 SER n 1 44 SER n 1 45 LEU n 1 46 ARG n 1 47 GLN n 1 48 VAL n 1 49 VAL n 1 50 ASN n 1 51 VAL n 1 52 TYR n 1 53 ALA n 1 54 ASP n 1 55 GLY n 1 56 LYS n 1 57 GLU n 1 58 VAL n 1 59 GLU n 1 60 ASP n 1 61 ARG n 1 62 GLN n 1 63 SER n 1 64 ALA n 1 65 PRO n 1 66 TYR n 1 67 ARG n 1 68 GLY n 1 69 ARG n 1 70 THR n 1 71 SER n 1 72 ILE n 1 73 LEU n 1 74 ARG n 1 75 ASP n 1 76 GLY n 1 77 ILE n 1 78 THR n 1 79 ALA n 1 80 GLY n 1 81 LYS n 1 82 ALA n 1 83 ALA n 1 84 LEU n 1 85 ARG n 1 86 ILE n 1 87 HIS n 1 88 ASN n 1 89 VAL n 1 90 THR n 1 91 ALA n 1 92 SER n 1 93 ASP n 1 94 SER n 1 95 GLY n 1 96 LYS n 1 97 TYR n 1 98 LEU n 1 99 CYS n 1 100 TYR n 1 101 PHE n 1 102 GLN n 1 103 ASP n 1 104 GLY n 1 105 ASP n 1 106 PHE n 1 107 TYR n 1 108 GLU n 1 109 LYS n 1 110 ALA n 1 111 LEU n 1 112 VAL n 1 113 GLU n 1 114 LEU n 1 115 LYS n 1 116 VAL n 1 117 LEU n 1 118 GLU n 1 119 HIS n 1 120 HIS n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BT3.2, BTF3, BTF4, BTF5, BTN3A1, BTN3A2, Butyrophilin subfamily 3 member A1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET22b(+)-His6' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BT3A1_HUMAN _struct_ref.pdbx_db_accession O00481 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAG KAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKV ; _struct_ref.pdbx_align_begin 28 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4K55 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00481 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 143 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 116 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4K55 LEU A 117 ? UNP O00481 ? ? 'EXPRESSION TAG' 117 1 1 4K55 GLU A 118 ? UNP O00481 ? ? 'EXPRESSION TAG' 118 2 1 4K55 HIS A 119 ? UNP O00481 ? ? 'EXPRESSION TAG' 119 3 1 4K55 HIS A 120 ? UNP O00481 ? ? 'EXPRESSION TAG' 120 4 1 4K55 HIS A 121 ? UNP O00481 ? ? 'EXPRESSION TAG' 121 5 1 4K55 HIS A 122 ? UNP O00481 ? ? 'EXPRESSION TAG' 122 6 1 4K55 HIS A 123 ? UNP O00481 ? ? 'EXPRESSION TAG' 123 7 1 4K55 HIS A 124 ? UNP O00481 ? ? 'EXPRESSION TAG' 124 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 H6P non-polymer . '(2E)-4-hydroxy-3-methylbut-2-en-1-yl trihydrogen diphosphate' ? 'C5 H12 O8 P2' 262.092 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4K55 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.29 _exptl_crystal.density_percent_sol 46.25 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details ;0.12 M ethylene glycols, 0.1 M buffer system 1, 30% PEG 550 MME and PEG 20,000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2012-04-21 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.pdbx_synchrotron_site NSRRC _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0 # _reflns.entry_id 4K55 _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 21.52 _reflns.d_resolution_high 1.91 _reflns.number_obs 10398 _reflns.number_all 18761 _reflns.percent_possible_obs 99.1 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 30 _reflns.B_iso_Wilson_estimate 14.9 _reflns.pdbx_redundancy 4.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.91 _reflns_shell.d_res_low 1.98 _reflns_shell.percent_possible_all 97.2 _reflns_shell.Rmerge_I_obs 0.074 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 19 _reflns_shell.pdbx_redundancy 4.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 971 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4K55 _refine.ls_number_reflns_obs 9761 _refine.ls_number_reflns_all 10398 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 21.52 _refine.ls_d_res_high 1.91 _refine.ls_percent_reflns_obs 99.24 _refine.ls_R_factor_obs 0.19446 _refine.ls_R_factor_all 0.19446 _refine.ls_R_factor_R_work 0.19153 _refine.ls_R_factor_R_free 0.25641 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 495 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.894 _refine.B_iso_mean 23.064 _refine.aniso_B[1][1] 0.02 _refine.aniso_B[2][2] -0.02 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.158 _refine.pdbx_overall_ESU_R_Free 0.161 _refine.overall_SU_ML 0.093 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 3.083 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 916 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 84 _refine_hist.number_atoms_total 1015 _refine_hist.d_res_high 1.91 _refine_hist.d_res_low 21.52 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.021 0.020 ? 954 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2.508 1.977 ? 1294 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.773 5.000 ? 119 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 32.570 23.810 ? 42 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 16.249 15.000 ? 159 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 17.850 15.000 ? 6 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.191 0.200 ? 143 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.010 0.021 ? 717 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.912 _refine_ls_shell.d_res_low 1.961 _refine_ls_shell.number_reflns_R_work 613 _refine_ls_shell.R_factor_R_work 0.179 _refine_ls_shell.percent_reflns_obs 97.70 _refine_ls_shell.R_factor_R_free 0.259 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 25 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4K55 _struct.title ;Structure of the extracellular domain of butyrophilin BTN3A1 in complex with (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate (HMBPP) ; _struct.pdbx_descriptor 'Butyrophilin (BTN3A1) or [CD277]' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4K55 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'immunoglobulin superfamily, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'One molecule in the asymmetric unit' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 59 ? GLN A 62 ? GLU A 59 GLN A 62 5 ? 4 HELX_P HELX_P2 2 SER A 63 ? ARG A 67 ? SER A 63 ARG A 67 5 ? 5 HELX_P HELX_P3 3 GLY A 76 ? ALA A 79 ? GLY A 76 ALA A 79 5 ? 4 HELX_P HELX_P4 4 THR A 90 ? SER A 94 ? THR A 90 SER A 94 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 25 SG A ? ? 1_555 A CYS 99 SG A ? A CYS 25 A CYS 99 1_555 ? ? ? ? ? ? ? 2.074 ? disulf2 disulf ? ? A CYS 25 SG B ? ? 1_555 A CYS 99 SG B ? A CYS 25 A CYS 99 1_555 ? ? ? ? ? ? ? 2.039 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 28 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 28 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 29 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 29 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.40 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 5 ? LEU A 7 ? SER A 5 LEU A 7 A 2 ALA A 21 ? PHE A 28 ? ALA A 21 PHE A 28 A 3 LYS A 81 ? ILE A 86 ? LYS A 81 ILE A 86 A 4 THR A 70 ? LEU A 73 ? THR A 70 LEU A 73 B 1 ILE A 13 ? MET A 16 ? ILE A 13 MET A 16 B 2 PHE A 106 ? LEU A 117 ? PHE A 106 LEU A 117 B 3 GLY A 95 ? ASP A 103 ? GLY A 95 ASP A 103 B 4 GLU A 37 ? SER A 42 ? GLU A 37 SER A 42 B 5 GLN A 47 ? ALA A 53 ? GLN A 47 ALA A 53 B 6 LYS A 56 ? GLU A 57 ? LYS A 56 GLU A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 7 ? N LEU A 7 O HIS A 26 ? O HIS A 26 A 2 3 N CYS A 25 ? N CYS A 25 O ALA A 82 ? O ALA A 82 A 3 4 O ALA A 83 ? O ALA A 83 N LEU A 73 ? N LEU A 73 B 1 2 N ILE A 13 ? N ILE A 13 O LYS A 115 ? O LYS A 115 B 2 3 O VAL A 112 ? O VAL A 112 N TYR A 97 ? N TYR A 97 B 3 4 O LEU A 98 ? O LEU A 98 N VAL A 41 ? N VAL A 41 B 4 5 N SER A 42 ? N SER A 42 O GLN A 47 ? O GLN A 47 B 5 6 N ALA A 53 ? N ALA A 53 O LYS A 56 ? O LYS A 56 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE H6P A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 LYS A 39 ? LYS A 39 . ? 1_555 ? 2 AC1 4 TYR A 100 ? TYR A 100 . ? 1_555 ? 3 AC1 4 GLN A 102 ? GLN A 102 . ? 1_555 ? 4 AC1 4 TYR A 107 ? TYR A 107 . ? 1_555 ? # _database_PDB_matrix.entry_id 4K55 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4K55 _atom_sites.fract_transf_matrix[1][1] 0.027960 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009281 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030566 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 CYS 99 99 99 CYS CYS A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 TYR 107 107 107 TYR TYR A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 HIS 121 121 ? ? ? A . n A 1 122 HIS 122 122 ? ? ? A . n A 1 123 HIS 123 123 ? ? ? A . n A 1 124 HIS 124 124 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-07-24 2 'Structure model' 1 1 2013-07-31 3 'Structure model' 1 2 2013-08-28 4 'Structure model' 1 3 2013-09-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 366 ? ? O A HOH 381 ? ? 2.09 2 1 O A HOH 324 ? ? O A HOH 381 ? ? 2.16 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 26 ? ? CD2 A HIS 26 ? ? 1.415 1.354 0.061 0.009 N 2 1 CG A HIS 119 ? ? CD2 A HIS 119 ? ? 1.414 1.354 0.060 0.009 N 3 1 CG A HIS 120 ? ? CD2 A HIS 120 ? ? 1.418 1.354 0.064 0.009 N 4 1 C A HIS 120 ? ? O A HIS 120 ? ? 1.445 1.229 0.216 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 74 ? ? CZ A ARG 74 ? ? NH1 A ARG 74 ? ? 116.65 120.30 -3.65 0.50 N 2 1 NE A ARG 74 ? ? CZ A ARG 74 ? ? NH2 A ARG 74 ? ? 124.04 120.30 3.74 0.50 N 3 1 CA A HIS 120 ? ? C A HIS 120 ? ? O A HIS 120 ? ? 98.59 120.10 -21.51 2.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 45 ? ? 167.93 -16.96 2 1 GLU A 118 ? ? -152.10 -138.38 3 1 HIS A 119 ? ? 55.90 82.81 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A CYS 25 ? N A A CYS 25 N 2 1 Y 0 A CYS 25 ? CA A A CYS 25 CA 3 1 Y 0 A CYS 25 ? C A A CYS 25 C 4 1 Y 0 A CYS 25 ? O A A CYS 25 O 5 1 Y 0 A CYS 25 ? CB A A CYS 25 CB 6 1 Y 0 A CYS 25 ? SG A A CYS 25 SG 7 1 Y 0 A CYS 99 ? N A A CYS 99 N 8 1 Y 0 A CYS 99 ? CA A A CYS 99 CA 9 1 Y 0 A CYS 99 ? C A A CYS 99 C 10 1 Y 0 A CYS 99 ? O A A CYS 99 O 11 1 Y 0 A CYS 99 ? CB A A CYS 99 CB 12 1 Y 0 A CYS 99 ? SG A A CYS 99 SG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A HIS 121 ? A HIS 121 4 1 Y 1 A HIS 122 ? A HIS 122 5 1 Y 1 A HIS 123 ? A HIS 123 6 1 Y 1 A HIS 124 ? A HIS 124 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2E)-4-hydroxy-3-methylbut-2-en-1-yl trihydrogen diphosphate' H6P 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 H6P 1 201 1 H6P 215 A . C 3 HOH 1 301 1 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 3 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 5 HOH HOH A . C 3 HOH 6 306 6 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 8 HOH HOH A . C 3 HOH 9 309 9 HOH HOH A . C 3 HOH 10 310 10 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 12 HOH HOH A . C 3 HOH 13 313 13 HOH HOH A . C 3 HOH 14 314 14 HOH HOH A . C 3 HOH 15 315 15 HOH HOH A . C 3 HOH 16 316 16 HOH HOH A . C 3 HOH 17 317 17 HOH HOH A . C 3 HOH 18 318 18 HOH HOH A . C 3 HOH 19 319 19 HOH HOH A . C 3 HOH 20 320 20 HOH HOH A . C 3 HOH 21 321 21 HOH HOH A . C 3 HOH 22 322 22 HOH HOH A . C 3 HOH 23 323 23 HOH HOH A . C 3 HOH 24 324 24 HOH HOH A . C 3 HOH 25 325 25 HOH HOH A . C 3 HOH 26 326 26 HOH HOH A . C 3 HOH 27 327 27 HOH HOH A . C 3 HOH 28 328 28 HOH HOH A . C 3 HOH 29 329 29 HOH HOH A . C 3 HOH 30 330 30 HOH HOH A . C 3 HOH 31 331 31 HOH HOH A . C 3 HOH 32 332 32 HOH HOH A . C 3 HOH 33 333 33 HOH HOH A . C 3 HOH 34 334 34 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 36 HOH HOH A . C 3 HOH 37 337 37 HOH HOH A . C 3 HOH 38 338 38 HOH HOH A . C 3 HOH 39 339 39 HOH HOH A . C 3 HOH 40 340 40 HOH HOH A . C 3 HOH 41 341 41 HOH HOH A . C 3 HOH 42 342 42 HOH HOH A . C 3 HOH 43 343 43 HOH HOH A . C 3 HOH 44 344 44 HOH HOH A . C 3 HOH 45 345 45 HOH HOH A . C 3 HOH 46 346 46 HOH HOH A . C 3 HOH 47 347 47 HOH HOH A . C 3 HOH 48 348 48 HOH HOH A . C 3 HOH 49 349 49 HOH HOH A . C 3 HOH 50 350 50 HOH HOH A . C 3 HOH 51 351 51 HOH HOH A . C 3 HOH 52 352 52 HOH HOH A . C 3 HOH 53 353 53 HOH HOH A . C 3 HOH 54 354 54 HOH HOH A . C 3 HOH 55 355 55 HOH HOH A . C 3 HOH 56 356 56 HOH HOH A . C 3 HOH 57 357 57 HOH HOH A . C 3 HOH 58 358 58 HOH HOH A . C 3 HOH 59 359 59 HOH HOH A . C 3 HOH 60 360 60 HOH HOH A . C 3 HOH 61 361 61 HOH HOH A . C 3 HOH 62 362 62 HOH HOH A . C 3 HOH 63 363 63 HOH HOH A . C 3 HOH 64 364 64 HOH HOH A . C 3 HOH 65 365 65 HOH HOH A . C 3 HOH 66 366 66 HOH HOH A . C 3 HOH 67 367 67 HOH HOH A . C 3 HOH 68 368 68 HOH HOH A . C 3 HOH 69 369 69 HOH HOH A . C 3 HOH 70 370 70 HOH HOH A . C 3 HOH 71 371 71 HOH HOH A . C 3 HOH 72 372 72 HOH HOH A . C 3 HOH 73 373 73 HOH HOH A . C 3 HOH 74 374 74 HOH HOH A . C 3 HOH 75 375 75 HOH HOH A . C 3 HOH 76 376 76 HOH HOH A . C 3 HOH 77 377 77 HOH HOH A . C 3 HOH 78 378 78 HOH HOH A . C 3 HOH 79 379 79 HOH HOH A . C 3 HOH 80 380 80 HOH HOH A . C 3 HOH 81 381 81 HOH HOH A . C 3 HOH 82 382 82 HOH HOH A . C 3 HOH 83 383 83 HOH HOH A . C 3 HOH 84 384 84 HOH HOH A . #