data_4KW8 # _entry.id 4KW8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4KW8 pdb_00004kw8 10.2210/pdb4kw8/pdb RCSB RCSB079872 ? ? WWPDB D_1000079872 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4KW4 . unspecified PDB 4KW9 . unspecified # _pdbx_database_status.entry_id 4KW8 _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-05-23 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barnard, T.J.' 1 'Yu, X.' 2 'Noinaj, N.' 3 'Taraska, J.W.' 4 # _citation.id primary _citation.title 'Crystal Structure of Green Fluorescent Protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barnard, T.J.' 1 ? primary 'Yu, X.' 2 ? primary 'Noinaj, N.' 3 ? primary 'Taraska, J.W.' 4 ? # _cell.entry_id 4KW8 _cell.length_a 51.623 _cell.length_b 63.021 _cell.length_c 66.347 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4KW8 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Green fluorescent protein' 27227.764 1 ? 'S147H, S202H, Q204H, A206K' ? 'The protein in this structure is a version of GFP called Emerald GFP' 2 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 3 water nat water 18.015 83 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL(CRO)VQCFARYP DHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNHHKVYITAD KQKNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLHTHSKLSKDPNEKRDHMVLLEFVTAAGITLGMDE LYK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFARYPDH MKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNHHKVYITADKQ KNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLHTHSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELY K ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 VAL n 1 5 SER n 1 6 LYS n 1 7 GLY n 1 8 GLU n 1 9 GLU n 1 10 LEU n 1 11 PHE n 1 12 THR n 1 13 GLY n 1 14 VAL n 1 15 VAL n 1 16 PRO n 1 17 ILE n 1 18 LEU n 1 19 VAL n 1 20 GLU n 1 21 LEU n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 VAL n 1 26 ASN n 1 27 GLY n 1 28 HIS n 1 29 LYS n 1 30 PHE n 1 31 SER n 1 32 VAL n 1 33 SER n 1 34 GLY n 1 35 GLU n 1 36 GLY n 1 37 GLU n 1 38 GLY n 1 39 ASP n 1 40 ALA n 1 41 THR n 1 42 TYR n 1 43 GLY n 1 44 LYS n 1 45 LEU n 1 46 THR n 1 47 LEU n 1 48 LYS n 1 49 PHE n 1 50 ILE n 1 51 CYS n 1 52 THR n 1 53 THR n 1 54 GLY n 1 55 LYS n 1 56 LEU n 1 57 PRO n 1 58 VAL n 1 59 PRO n 1 60 TRP n 1 61 PRO n 1 62 THR n 1 63 LEU n 1 64 VAL n 1 65 THR n 1 66 THR n 1 67 LEU n 1 68 CRO n 1 69 VAL n 1 70 GLN n 1 71 CYS n 1 72 PHE n 1 73 ALA n 1 74 ARG n 1 75 TYR n 1 76 PRO n 1 77 ASP n 1 78 HIS n 1 79 MET n 1 80 LYS n 1 81 GLN n 1 82 HIS n 1 83 ASP n 1 84 PHE n 1 85 PHE n 1 86 LYS n 1 87 SER n 1 88 ALA n 1 89 MET n 1 90 PRO n 1 91 GLU n 1 92 GLY n 1 93 TYR n 1 94 VAL n 1 95 GLN n 1 96 GLU n 1 97 ARG n 1 98 THR n 1 99 ILE n 1 100 PHE n 1 101 PHE n 1 102 LYS n 1 103 ASP n 1 104 ASP n 1 105 GLY n 1 106 ASN n 1 107 TYR n 1 108 LYS n 1 109 THR n 1 110 ARG n 1 111 ALA n 1 112 GLU n 1 113 VAL n 1 114 LYS n 1 115 PHE n 1 116 GLU n 1 117 GLY n 1 118 ASP n 1 119 THR n 1 120 LEU n 1 121 VAL n 1 122 ASN n 1 123 ARG n 1 124 ILE n 1 125 GLU n 1 126 LEU n 1 127 LYS n 1 128 GLY n 1 129 ILE n 1 130 ASP n 1 131 PHE n 1 132 LYS n 1 133 GLU n 1 134 ASP n 1 135 GLY n 1 136 ASN n 1 137 ILE n 1 138 LEU n 1 139 GLY n 1 140 HIS n 1 141 LYS n 1 142 LEU n 1 143 GLU n 1 144 TYR n 1 145 ASN n 1 146 TYR n 1 147 ASN n 1 148 HIS n 1 149 HIS n 1 150 LYS n 1 151 VAL n 1 152 TYR n 1 153 ILE n 1 154 THR n 1 155 ALA n 1 156 ASP n 1 157 LYS n 1 158 GLN n 1 159 LYS n 1 160 ASN n 1 161 GLY n 1 162 ILE n 1 163 LYS n 1 164 VAL n 1 165 ASN n 1 166 PHE n 1 167 LYS n 1 168 THR n 1 169 ARG n 1 170 HIS n 1 171 ASN n 1 172 ILE n 1 173 GLU n 1 174 ASP n 1 175 GLY n 1 176 SER n 1 177 VAL n 1 178 GLN n 1 179 LEU n 1 180 ALA n 1 181 ASP n 1 182 HIS n 1 183 TYR n 1 184 GLN n 1 185 GLN n 1 186 ASN n 1 187 THR n 1 188 PRO n 1 189 ILE n 1 190 GLY n 1 191 ASP n 1 192 GLY n 1 193 PRO n 1 194 VAL n 1 195 LEU n 1 196 LEU n 1 197 PRO n 1 198 ASP n 1 199 ASN n 1 200 HIS n 1 201 TYR n 1 202 LEU n 1 203 HIS n 1 204 THR n 1 205 HIS n 1 206 SER n 1 207 LYS n 1 208 LEU n 1 209 SER n 1 210 LYS n 1 211 ASP n 1 212 PRO n 1 213 ASN n 1 214 GLU n 1 215 LYS n 1 216 ARG n 1 217 ASP n 1 218 HIS n 1 219 MET n 1 220 VAL n 1 221 LEU n 1 222 LEU n 1 223 GLU n 1 224 PHE n 1 225 VAL n 1 226 THR n 1 227 ALA n 1 228 ALA n 1 229 GLY n 1 230 ILE n 1 231 THR n 1 232 LEU n 1 233 GLY n 1 234 MET n 1 235 ASP n 1 236 GLU n 1 237 LEU n 1 238 TYR n 1 239 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Jellyfish _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene GFP _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aequorea victoria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6100 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GFP_AEQVI _struct_ref.pdbx_db_accession P42212 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQH DFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGI KVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4KW8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 239 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P42212 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 238 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 238 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4KW8 GLY A 1 ? UNP P42212 ? ? 'expression tag' -2 1 1 4KW8 SER A 2 ? UNP P42212 ? ? 'expression tag' -1 2 1 4KW8 MET A 3 ? UNP P42212 ? ? 'expression tag' 0 3 1 4KW8 VAL A 4 ? UNP P42212 ? ? 'expression tag' 1 4 1 4KW8 LEU A 67 ? UNP P42212 PHE 64 'SEE REMARK 999' 64 5 1 4KW8 CRO A 68 ? UNP P42212 SER 65 chromophore 66 6 1 4KW8 CRO A 68 ? UNP P42212 TYR 66 chromophore 66 7 1 4KW8 CRO A 68 ? UNP P42212 GLY 67 chromophore 66 8 1 4KW8 ALA A 73 ? UNP P42212 SER 72 'SEE REMARK 999' 72 9 1 4KW8 HIS A 148 ? UNP P42212 SER 147 'engineered mutation' 147 10 1 4KW8 LYS A 150 ? UNP P42212 ASN 149 'SEE REMARK 999' 149 11 1 4KW8 THR A 154 ? UNP P42212 MET 153 'SEE REMARK 999' 153 12 1 4KW8 THR A 168 ? UNP P42212 ILE 167 'SEE REMARK 999' 167 13 1 4KW8 HIS A 203 ? UNP P42212 SER 202 'engineered mutation' 202 14 1 4KW8 HIS A 205 ? UNP P42212 GLN 204 'engineered mutation' 204 15 1 4KW8 LYS A 207 ? UNP P42212 ALA 206 'engineered mutation' 206 16 1 4KW8 LEU A 232 ? UNP P42212 HIS 231 'SEE REMARK 999' 231 17 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CRO 'L-peptide linking' n '{2-[(1R,2R)-1-amino-2-hydroxypropyl]-4-(4-hydroxybenzylidene)-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 'PEPTIDE DERIVED CHROMOPHORE' 'C15 H17 N3 O5' 319.313 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4KW8 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 1.98 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 37.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'hanging drop' _exptl_crystal_grow.pH 8.2 _exptl_crystal_grow.temp 294 _exptl_crystal_grow.pdbx_details '50 mM HEPES pH 8.2, 50 mM MgCl2, 22% PEG4000, hanging drop, temperature 294K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date 2012-10-25 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Double crystal cryo-cooled Si(111)' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.37645 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.pdbx_wavelength_list 1.37645 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 23-ID-B # _reflns.entry_id 4KW8 _reflns.d_resolution_high 2.450 _reflns.d_resolution_low 50.000 _reflns.number_obs 8306 _reflns.pdbx_Rmerge_I_obs 0.174 _reflns.pdbx_netI_over_sigmaI 6.400 _reflns.pdbx_chi_squared 1.067 _reflns.pdbx_redundancy 6.900 _reflns.percent_possible_obs 100.000 _reflns.observed_criterion_sigma_F 1 _reflns.observed_criterion_sigma_I 1 _reflns.number_all 8310 _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.450 2.540 ? ? ? 0.889 ? ? 0.976 6.700 ? 811 100.000 1 1 2.540 2.640 ? ? ? 0.768 ? ? 0.989 7.000 ? 790 100.000 2 1 2.640 2.760 ? ? ? 0.598 ? ? 1.068 7.000 ? 823 100.000 3 1 2.760 2.900 ? ? ? 0.476 ? ? 1.087 7.000 ? 816 100.000 4 1 2.900 3.090 ? ? ? 0.318 ? ? 1.062 7.000 ? 817 100.000 5 1 3.090 3.320 ? ? ? 0.211 ? ? 1.040 6.900 ? 818 100.000 6 1 3.320 3.660 ? ? ? 0.154 ? ? 1.098 7.000 ? 830 100.000 7 1 3.660 4.190 ? ? ? 0.120 ? ? 1.135 6.900 ? 841 100.000 8 1 4.190 5.280 ? ? ? 0.099 ? ? 1.025 6.800 ? 843 100.000 9 1 5.280 50.000 ? ? ? 0.106 ? ? 1.177 6.300 ? 917 100.000 10 1 # _refine.entry_id 4KW8 _refine.ls_d_res_high 2.4590 _refine.ls_d_res_low 45.6930 _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.8000 _refine.ls_number_reflns_obs 7770 _refine.ls_number_reflns_all 7774 _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details Random _refine.details ? _refine.ls_R_factor_all 0.240 _refine.ls_R_factor_obs 0.1598 _refine.ls_R_factor_R_work 0.1524 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2250 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 10.0900 _refine.ls_number_reflns_R_free 770 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 28.8196 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8353 _refine.B_iso_max 78.810 _refine.B_iso_min 5.420 _refine.pdbx_overall_phase_error 23.3300 _refine.occupancy_max 1.000 _refine.occupancy_min 0.290 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1698 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 83 _refine_hist.number_atoms_total 1782 _refine_hist.d_res_high 2.4590 _refine_hist.d_res_low 45.6930 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 1750 0.013 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2380 1.514 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 264 0.072 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 305 0.006 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 608 14.792 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 2.4590 2.5379 11 98.0000 1210 . 0.2333 0.3079 . 138 . 1348 . . 'X-RAY DIFFRACTION' 2.5379 2.6286 11 100.0000 1263 . 0.2337 0.2788 . 134 . 1397 . . 'X-RAY DIFFRACTION' 2.6286 2.7338 11 100.0000 1216 . 0.2183 0.3211 . 144 . 1360 . . 'X-RAY DIFFRACTION' 2.7338 2.8582 11 100.0000 1257 . 0.2111 0.2997 . 139 . 1396 . . 'X-RAY DIFFRACTION' 2.8582 3.0089 11 100.0000 1244 . 0.1863 0.2798 . 145 . 1389 . . 'X-RAY DIFFRACTION' 3.0089 3.1974 11 100.0000 1225 . 0.1479 0.2510 . 134 . 1359 . . 'X-RAY DIFFRACTION' 3.1974 3.4441 11 100.0000 1250 . 0.1292 0.2020 . 139 . 1389 . . 'X-RAY DIFFRACTION' 3.4441 3.7906 11 100.0000 1236 . 0.1197 0.1864 . 135 . 1371 . . 'X-RAY DIFFRACTION' 3.7906 4.3387 11 100.0000 1248 . 0.1105 0.2020 . 145 . 1393 . . 'X-RAY DIFFRACTION' 4.3387 5.4649 11 100.0000 1240 . 0.1132 0.1518 . 141 . 1381 . . 'X-RAY DIFFRACTION' 5.4649 45.7010 11 100.0000 1249 . 0.1816 0.2568 . 137 . 1386 . . 'X-RAY DIFFRACTION' # _struct.entry_id 4KW8 _struct.title 'Crystal Structure of Green Fluorescent Protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4KW8 _struct_keywords.text 'beta barrel, fluorescent protein, chromophore' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 7 ? THR A 12 ? GLY A 4 THR A 9 5 ? 6 HELX_P HELX_P2 2 PRO A 59 ? VAL A 64 ? PRO A 56 VAL A 61 1 ? 6 HELX_P HELX_P3 3 VAL A 69 ? ALA A 73 ? VAL A 68 ALA A 72 5 ? 5 HELX_P HELX_P4 4 PRO A 76 ? HIS A 82 ? PRO A 75 HIS A 81 5 ? 7 HELX_P HELX_P5 5 ASP A 83 ? ALA A 88 ? ASP A 82 ALA A 87 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 67 C ? ? ? 1_555 A CRO 68 N1 ? ? A LEU 64 A CRO 66 1_555 ? ? ? ? ? ? ? 1.348 ? ? covale2 covale both ? A CRO 68 C3 ? ? ? 1_555 A VAL 69 N ? ? A CRO 66 A VAL 68 1_555 ? ? ? ? ? ? ? 1.295 ? ? metalc1 metalc ? ? A HIS 203 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 202 A NI 301 1_555 ? ? ? ? ? ? ? 2.082 ? ? metalc2 metalc ? ? A HIS 205 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 204 A NI 301 1_555 ? ? ? ? ? ? ? 2.040 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id MET _struct_mon_prot_cis.label_seq_id 89 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id MET _struct_mon_prot_cis.auth_seq_id 88 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 90 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 89 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.82 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 12 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel A 10 11 ? anti-parallel A 11 12 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 15 ? VAL A 25 ? VAL A 12 VAL A 22 A 2 HIS A 28 ? ASP A 39 ? HIS A 25 ASP A 36 A 3 LYS A 44 ? CYS A 51 ? LYS A 41 CYS A 48 A 4 HIS A 218 ? ALA A 228 ? HIS A 217 ALA A 227 A 5 HIS A 200 ? SER A 209 ? HIS A 199 SER A 208 A 6 HIS A 149 ? ASP A 156 ? HIS A 148 ASP A 155 A 7 GLY A 161 ? ASN A 171 ? GLY A 160 ASN A 170 A 8 VAL A 177 ? PRO A 188 ? VAL A 176 PRO A 187 A 9 TYR A 93 ? PHE A 101 ? TYR A 92 PHE A 100 A 10 ASN A 106 ? GLU A 116 ? ASN A 105 GLU A 115 A 11 THR A 119 ? ILE A 129 ? THR A 118 ILE A 128 A 12 VAL A 15 ? VAL A 25 ? VAL A 12 VAL A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 23 ? N GLY A 20 O PHE A 30 ? O PHE A 27 A 2 3 N ASP A 39 ? N ASP A 36 O LYS A 44 ? O LYS A 41 A 3 4 N PHE A 49 ? N PHE A 46 O MET A 219 ? O MET A 218 A 4 5 O THR A 226 ? O THR A 225 N HIS A 203 ? N HIS A 202 A 5 6 O HIS A 200 ? O HIS A 199 N ILE A 153 ? N ILE A 152 A 6 7 N THR A 154 ? N THR A 153 O LYS A 163 ? O LYS A 162 A 7 8 N VAL A 164 ? N VAL A 163 O GLN A 184 ? O GLN A 183 A 8 9 O THR A 187 ? O THR A 186 N VAL A 94 ? N VAL A 93 A 9 10 N ARG A 97 ? N ARG A 96 O THR A 109 ? O THR A 108 A 10 11 N LYS A 114 ? N LYS A 113 O VAL A 121 ? O VAL A 120 A 11 12 O ILE A 124 ? O ILE A 123 N GLU A 20 ? N GLU A 17 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NI _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE NI A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ASP A 118 ? ASP A 117 . ? 4_457 ? 2 AC1 3 HIS A 203 ? HIS A 202 . ? 1_555 ? 3 AC1 3 HIS A 205 ? HIS A 204 . ? 1_555 ? # _atom_sites.entry_id 4KW8 _atom_sites.fract_transf_matrix[1][1] 0.019371 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015868 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015072 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 MET 3 0 ? ? ? A . n A 1 4 VAL 4 1 ? ? ? A . n A 1 5 SER 5 2 ? ? ? A . n A 1 6 LYS 6 3 ? ? ? A . n A 1 7 GLY 7 4 4 GLY GLY A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 GLU 9 6 6 GLU GLU A . n A 1 10 LEU 10 7 7 LEU LEU A . n A 1 11 PHE 11 8 8 PHE PHE A . n A 1 12 THR 12 9 9 THR THR A . n A 1 13 GLY 13 10 10 GLY GLY A . n A 1 14 VAL 14 11 11 VAL VAL A . n A 1 15 VAL 15 12 12 VAL VAL A . n A 1 16 PRO 16 13 13 PRO PRO A . n A 1 17 ILE 17 14 14 ILE ILE A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 VAL 19 16 16 VAL VAL A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 LEU 21 18 18 LEU LEU A . n A 1 22 ASP 22 19 19 ASP ASP A . n A 1 23 GLY 23 20 20 GLY GLY A . n A 1 24 ASP 24 21 21 ASP ASP A . n A 1 25 VAL 25 22 22 VAL VAL A . n A 1 26 ASN 26 23 23 ASN ASN A . n A 1 27 GLY 27 24 24 GLY GLY A . n A 1 28 HIS 28 25 25 HIS HIS A . n A 1 29 LYS 29 26 26 LYS LYS A . n A 1 30 PHE 30 27 27 PHE PHE A . n A 1 31 SER 31 28 28 SER SER A . n A 1 32 VAL 32 29 29 VAL VAL A . n A 1 33 SER 33 30 30 SER SER A . n A 1 34 GLY 34 31 31 GLY GLY A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 GLY 36 33 33 GLY GLY A . n A 1 37 GLU 37 34 34 GLU GLU A . n A 1 38 GLY 38 35 35 GLY GLY A . n A 1 39 ASP 39 36 36 ASP ASP A . n A 1 40 ALA 40 37 37 ALA ALA A . n A 1 41 THR 41 38 38 THR THR A . n A 1 42 TYR 42 39 39 TYR TYR A . n A 1 43 GLY 43 40 40 GLY GLY A . n A 1 44 LYS 44 41 41 LYS LYS A . n A 1 45 LEU 45 42 42 LEU LEU A . n A 1 46 THR 46 43 43 THR THR A . n A 1 47 LEU 47 44 44 LEU LEU A . n A 1 48 LYS 48 45 45 LYS LYS A . n A 1 49 PHE 49 46 46 PHE PHE A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 CYS 51 48 48 CYS CYS A . n A 1 52 THR 52 49 49 THR THR A . n A 1 53 THR 53 50 50 THR THR A . n A 1 54 GLY 54 51 51 GLY GLY A . n A 1 55 LYS 55 52 52 LYS LYS A . n A 1 56 LEU 56 53 53 LEU LEU A . n A 1 57 PRO 57 54 54 PRO PRO A . n A 1 58 VAL 58 55 55 VAL VAL A . n A 1 59 PRO 59 56 56 PRO PRO A . n A 1 60 TRP 60 57 57 TRP TRP A . n A 1 61 PRO 61 58 58 PRO PRO A . n A 1 62 THR 62 59 59 THR THR A . n A 1 63 LEU 63 60 60 LEU LEU A . n A 1 64 VAL 64 61 61 VAL VAL A . n A 1 65 THR 65 62 62 THR THR A . n A 1 66 THR 66 63 63 THR THR A . n A 1 67 LEU 67 64 64 LEU LEU A . n A 1 68 CRO 68 66 66 CRO CRO A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 GLN 70 69 69 GLN GLN A . n A 1 71 CYS 71 70 70 CYS CYS A . n A 1 72 PHE 72 71 71 PHE PHE A . n A 1 73 ALA 73 72 72 ALA ALA A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 TYR 75 74 74 TYR TYR A . n A 1 76 PRO 76 75 75 PRO PRO A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 HIS 78 77 77 HIS HIS A . n A 1 79 MET 79 78 78 MET MET A . n A 1 80 LYS 80 79 79 LYS LYS A . n A 1 81 GLN 81 80 80 GLN GLN A . n A 1 82 HIS 82 81 81 HIS HIS A . n A 1 83 ASP 83 82 82 ASP ASP A . n A 1 84 PHE 84 83 83 PHE PHE A . n A 1 85 PHE 85 84 84 PHE PHE A . n A 1 86 LYS 86 85 85 LYS LYS A . n A 1 87 SER 87 86 86 SER SER A . n A 1 88 ALA 88 87 87 ALA ALA A . n A 1 89 MET 89 88 88 MET MET A . n A 1 90 PRO 90 89 89 PRO PRO A . n A 1 91 GLU 91 90 90 GLU GLU A . n A 1 92 GLY 92 91 91 GLY GLY A . n A 1 93 TYR 93 92 92 TYR TYR A . n A 1 94 VAL 94 93 93 VAL VAL A . n A 1 95 GLN 95 94 94 GLN GLN A . n A 1 96 GLU 96 95 95 GLU GLU A . n A 1 97 ARG 97 96 96 ARG ARG A . n A 1 98 THR 98 97 97 THR THR A . n A 1 99 ILE 99 98 98 ILE ILE A . n A 1 100 PHE 100 99 99 PHE PHE A . n A 1 101 PHE 101 100 100 PHE PHE A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 ASP 103 102 102 ASP ASP A . n A 1 104 ASP 104 103 103 ASP ASP A . n A 1 105 GLY 105 104 104 GLY GLY A . n A 1 106 ASN 106 105 105 ASN ASN A . n A 1 107 TYR 107 106 106 TYR TYR A . n A 1 108 LYS 108 107 107 LYS LYS A . n A 1 109 THR 109 108 108 THR THR A . n A 1 110 ARG 110 109 109 ARG ARG A . n A 1 111 ALA 111 110 110 ALA ALA A . n A 1 112 GLU 112 111 111 GLU GLU A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 LYS 114 113 113 LYS LYS A . n A 1 115 PHE 115 114 114 PHE PHE A . n A 1 116 GLU 116 115 115 GLU GLU A . n A 1 117 GLY 117 116 116 GLY GLY A . n A 1 118 ASP 118 117 117 ASP ASP A . n A 1 119 THR 119 118 118 THR THR A . n A 1 120 LEU 120 119 119 LEU LEU A . n A 1 121 VAL 121 120 120 VAL VAL A . n A 1 122 ASN 122 121 121 ASN ASN A . n A 1 123 ARG 123 122 122 ARG ARG A . n A 1 124 ILE 124 123 123 ILE ILE A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 LYS 127 126 126 LYS LYS A . n A 1 128 GLY 128 127 127 GLY GLY A . n A 1 129 ILE 129 128 128 ILE ILE A . n A 1 130 ASP 130 129 129 ASP ASP A . n A 1 131 PHE 131 130 130 PHE PHE A . n A 1 132 LYS 132 131 131 LYS LYS A . n A 1 133 GLU 133 132 132 GLU GLU A . n A 1 134 ASP 134 133 133 ASP ASP A . n A 1 135 GLY 135 134 134 GLY GLY A . n A 1 136 ASN 136 135 135 ASN ASN A . n A 1 137 ILE 137 136 136 ILE ILE A . n A 1 138 LEU 138 137 137 LEU LEU A . n A 1 139 GLY 139 138 138 GLY GLY A . n A 1 140 HIS 140 139 139 HIS HIS A . n A 1 141 LYS 141 140 140 LYS LYS A . n A 1 142 LEU 142 141 141 LEU LEU A . n A 1 143 GLU 143 142 142 GLU GLU A . n A 1 144 TYR 144 143 143 TYR TYR A . n A 1 145 ASN 145 144 144 ASN ASN A . n A 1 146 TYR 146 145 145 TYR TYR A . n A 1 147 ASN 147 146 146 ASN ASN A . n A 1 148 HIS 148 147 147 HIS HIS A . n A 1 149 HIS 149 148 148 HIS HIS A . n A 1 150 LYS 150 149 149 LYS LYS A . n A 1 151 VAL 151 150 150 VAL VAL A . n A 1 152 TYR 152 151 151 TYR TYR A . n A 1 153 ILE 153 152 152 ILE ILE A . n A 1 154 THR 154 153 153 THR THR A . n A 1 155 ALA 155 154 154 ALA ALA A . n A 1 156 ASP 156 155 155 ASP ASP A . n A 1 157 LYS 157 156 156 LYS LYS A . n A 1 158 GLN 158 157 157 GLN GLN A . n A 1 159 LYS 159 158 158 LYS LYS A . n A 1 160 ASN 160 159 159 ASN ASN A . n A 1 161 GLY 161 160 160 GLY GLY A . n A 1 162 ILE 162 161 161 ILE ILE A . n A 1 163 LYS 163 162 162 LYS LYS A . n A 1 164 VAL 164 163 163 VAL VAL A . n A 1 165 ASN 165 164 164 ASN ASN A . n A 1 166 PHE 166 165 165 PHE PHE A . n A 1 167 LYS 167 166 166 LYS LYS A . n A 1 168 THR 168 167 167 THR THR A . n A 1 169 ARG 169 168 168 ARG ARG A . n A 1 170 HIS 170 169 169 HIS HIS A . n A 1 171 ASN 171 170 170 ASN ASN A . n A 1 172 ILE 172 171 171 ILE ILE A . n A 1 173 GLU 173 172 172 GLU GLU A . n A 1 174 ASP 174 173 173 ASP ASP A . n A 1 175 GLY 175 174 174 GLY GLY A . n A 1 176 SER 176 175 175 SER SER A . n A 1 177 VAL 177 176 176 VAL VAL A . n A 1 178 GLN 178 177 177 GLN GLN A . n A 1 179 LEU 179 178 178 LEU LEU A . n A 1 180 ALA 180 179 179 ALA ALA A . n A 1 181 ASP 181 180 180 ASP ASP A . n A 1 182 HIS 182 181 181 HIS HIS A . n A 1 183 TYR 183 182 182 TYR TYR A . n A 1 184 GLN 184 183 183 GLN GLN A . n A 1 185 GLN 185 184 184 GLN GLN A . n A 1 186 ASN 186 185 185 ASN ASN A . n A 1 187 THR 187 186 186 THR THR A . n A 1 188 PRO 188 187 187 PRO PRO A . n A 1 189 ILE 189 188 188 ILE ILE A . n A 1 190 GLY 190 189 189 GLY GLY A . n A 1 191 ASP 191 190 190 ASP ASP A . n A 1 192 GLY 192 191 191 GLY GLY A . n A 1 193 PRO 193 192 192 PRO PRO A . n A 1 194 VAL 194 193 193 VAL VAL A . n A 1 195 LEU 195 194 194 LEU LEU A . n A 1 196 LEU 196 195 195 LEU LEU A . n A 1 197 PRO 197 196 196 PRO PRO A . n A 1 198 ASP 198 197 197 ASP ASP A . n A 1 199 ASN 199 198 198 ASN ASN A . n A 1 200 HIS 200 199 199 HIS HIS A . n A 1 201 TYR 201 200 200 TYR TYR A . n A 1 202 LEU 202 201 201 LEU LEU A . n A 1 203 HIS 203 202 202 HIS HIS A . n A 1 204 THR 204 203 203 THR THR A . n A 1 205 HIS 205 204 204 HIS HIS A . n A 1 206 SER 206 205 205 SER SER A . n A 1 207 LYS 207 206 206 LYS LYS A . n A 1 208 LEU 208 207 207 LEU LEU A . n A 1 209 SER 209 208 208 SER SER A . n A 1 210 LYS 210 209 209 LYS LYS A . n A 1 211 ASP 211 210 210 ASP ASP A . n A 1 212 PRO 212 211 211 PRO PRO A . n A 1 213 ASN 213 212 212 ASN ASN A . n A 1 214 GLU 214 213 213 GLU GLU A . n A 1 215 LYS 215 214 214 LYS LYS A . n A 1 216 ARG 216 215 215 ARG ARG A . n A 1 217 ASP 217 216 216 ASP ASP A . n A 1 218 HIS 218 217 217 HIS HIS A . n A 1 219 MET 219 218 218 MET MET A . n A 1 220 VAL 220 219 219 VAL VAL A . n A 1 221 LEU 221 220 220 LEU LEU A . n A 1 222 LEU 222 221 221 LEU LEU A . n A 1 223 GLU 223 222 222 GLU GLU A . n A 1 224 PHE 224 223 223 PHE PHE A . n A 1 225 VAL 225 224 224 VAL VAL A . n A 1 226 THR 226 225 225 THR THR A . n A 1 227 ALA 227 226 226 ALA ALA A . n A 1 228 ALA 228 227 227 ALA ALA A . n A 1 229 GLY 229 228 228 GLY GLY A . n A 1 230 ILE 230 229 ? ? ? A . n A 1 231 THR 231 230 ? ? ? A . n A 1 232 LEU 232 231 ? ? ? A . n A 1 233 GLY 233 232 ? ? ? A . n A 1 234 MET 234 233 ? ? ? A . n A 1 235 ASP 235 234 ? ? ? A . n A 1 236 GLU 236 235 ? ? ? A . n A 1 237 LEU 237 236 ? ? ? A . n A 1 238 TYR 238 237 ? ? ? A . n A 1 239 LYS 239 238 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NI 1 301 1 NI NI A . C 3 HOH 1 401 1 HOH HOH A . C 3 HOH 2 402 2 HOH HOH A . C 3 HOH 3 403 3 HOH HOH A . C 3 HOH 4 404 4 HOH HOH A . C 3 HOH 5 405 5 HOH HOH A . C 3 HOH 6 406 6 HOH HOH A . C 3 HOH 7 407 7 HOH HOH A . C 3 HOH 8 408 8 HOH HOH A . C 3 HOH 9 409 9 HOH HOH A . C 3 HOH 10 410 10 HOH HOH A . C 3 HOH 11 411 11 HOH HOH A . C 3 HOH 12 412 12 HOH HOH A . C 3 HOH 13 413 13 HOH HOH A . C 3 HOH 14 414 14 HOH HOH A . C 3 HOH 15 415 15 HOH HOH A . C 3 HOH 16 416 16 HOH HOH A . C 3 HOH 17 417 17 HOH HOH A . C 3 HOH 18 418 18 HOH HOH A . C 3 HOH 19 419 19 HOH HOH A . C 3 HOH 20 420 20 HOH HOH A . C 3 HOH 21 421 21 HOH HOH A . C 3 HOH 22 422 22 HOH HOH A . C 3 HOH 23 423 23 HOH HOH A . C 3 HOH 24 424 24 HOH HOH A . C 3 HOH 25 425 25 HOH HOH A . C 3 HOH 26 426 26 HOH HOH A . C 3 HOH 27 427 27 HOH HOH A . C 3 HOH 28 428 28 HOH HOH A . C 3 HOH 29 429 29 HOH HOH A . C 3 HOH 30 430 30 HOH HOH A . C 3 HOH 31 431 31 HOH HOH A . C 3 HOH 32 432 32 HOH HOH A . C 3 HOH 33 433 33 HOH HOH A . C 3 HOH 34 434 34 HOH HOH A . C 3 HOH 35 435 35 HOH HOH A . C 3 HOH 36 436 36 HOH HOH A . C 3 HOH 37 437 37 HOH HOH A . C 3 HOH 38 438 38 HOH HOH A . C 3 HOH 39 439 39 HOH HOH A . C 3 HOH 40 440 40 HOH HOH A . C 3 HOH 41 441 41 HOH HOH A . C 3 HOH 42 442 42 HOH HOH A . C 3 HOH 43 443 43 HOH HOH A . C 3 HOH 44 444 44 HOH HOH A . C 3 HOH 45 445 45 HOH HOH A . C 3 HOH 46 446 46 HOH HOH A . C 3 HOH 47 447 47 HOH HOH A . C 3 HOH 48 448 48 HOH HOH A . C 3 HOH 49 449 49 HOH HOH A . C 3 HOH 50 450 50 HOH HOH A . C 3 HOH 51 451 51 HOH HOH A . C 3 HOH 52 452 52 HOH HOH A . C 3 HOH 53 453 53 HOH HOH A . C 3 HOH 54 454 54 HOH HOH A . C 3 HOH 55 455 55 HOH HOH A . C 3 HOH 56 456 56 HOH HOH A . C 3 HOH 57 457 57 HOH HOH A . C 3 HOH 58 458 58 HOH HOH A . C 3 HOH 59 459 59 HOH HOH A . C 3 HOH 60 460 60 HOH HOH A . C 3 HOH 61 461 61 HOH HOH A . C 3 HOH 62 462 62 HOH HOH A . C 3 HOH 63 463 63 HOH HOH A . C 3 HOH 64 464 64 HOH HOH A . C 3 HOH 65 465 65 HOH HOH A . C 3 HOH 66 466 66 HOH HOH A . C 3 HOH 67 467 67 HOH HOH A . C 3 HOH 68 468 68 HOH HOH A . C 3 HOH 69 469 69 HOH HOH A . C 3 HOH 70 470 70 HOH HOH A . C 3 HOH 71 471 71 HOH HOH A . C 3 HOH 72 472 72 HOH HOH A . C 3 HOH 73 473 73 HOH HOH A . C 3 HOH 74 474 74 HOH HOH A . C 3 HOH 75 475 75 HOH HOH A . C 3 HOH 76 476 76 HOH HOH A . C 3 HOH 77 477 77 HOH HOH A . C 3 HOH 78 478 78 HOH HOH A . C 3 HOH 79 479 79 HOH HOH A . C 3 HOH 80 480 80 HOH HOH A . C 3 HOH 81 481 81 HOH HOH A . C 3 HOH 82 482 82 HOH HOH A . C 3 HOH 83 483 84 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CRO 68 A CRO 66 ? GLY ? 2 A CRO 68 A CRO 66 ? TYR ? 3 A CRO 68 A CRO 66 ? GLY ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id NE2 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id HIS _pdbx_struct_conn_angle.ptnr1_label_seq_id 203 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id HIS _pdbx_struct_conn_angle.ptnr1_auth_seq_id 202 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id NI _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id NI _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id NI _pdbx_struct_conn_angle.ptnr2_auth_seq_id 301 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id NE2 _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id HIS _pdbx_struct_conn_angle.ptnr3_label_seq_id 205 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HIS _pdbx_struct_conn_angle.ptnr3_auth_seq_id 204 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 85.3 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-09 2 'Structure model' 1 1 2017-11-15 3 'Structure model' 1 2 2022-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' database_2 3 3 'Structure model' pdbx_struct_conn_angle 4 3 'Structure model' struct_conn 5 3 'Structure model' struct_ref_seq_dif 6 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.name' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 8 3 'Structure model' '_struct_conn.pdbx_dist_value' 9 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 10 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 11 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 12 3 'Structure model' '_struct_ref_seq_dif.details' 13 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 14 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 15 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 108.8285 9.2862 67.7359 0.1182 0.2180 0.1505 0.0299 -0.0238 0.0573 1.5773 3.9086 2.0102 1.7359 -0.0343 0.7124 -0.1395 0.3506 -0.1471 -0.3099 0.1724 -0.2218 0.0180 0.0277 0.2640 'X-RAY DIFFRACTION' 2 ? refined 106.3811 3.7761 61.7420 0.0915 0.2363 0.1568 -0.0283 -0.0110 -0.0117 1.4199 4.4857 2.4963 -0.1198 -0.9616 0.2413 -0.0735 0.0264 0.0537 -0.1874 -0.1316 -0.0820 -0.1684 0.1176 0.1087 'X-RAY DIFFRACTION' 3 ? refined 93.6829 13.9058 77.0817 0.2366 0.3189 0.2719 -0.0327 0.0212 -0.0037 8.6117 7.2123 3.6157 0.6074 -2.0642 -1.8143 0.3258 0.1855 -0.5006 -0.5590 0.2362 0.7399 0.4547 -0.3148 0.1795 'X-RAY DIFFRACTION' 4 ? refined 108.2214 3.2570 73.6411 0.1797 0.1959 0.1249 0.0137 -0.0284 0.0208 2.9257 2.9335 1.8155 -0.1423 -0.2011 0.3853 0.0854 -0.0260 -0.0230 -0.4549 0.0324 -0.2373 0.3718 0.2149 0.1519 'X-RAY DIFFRACTION' 5 ? refined 100.0810 -5.9672 68.4240 0.2482 0.2014 0.2601 -0.0274 -0.0558 0.0318 1.8008 4.5414 4.1886 -0.3467 -1.7943 2.6350 -0.1620 0.1037 0.0326 0.0006 -0.2347 0.1775 0.1864 0.4243 -0.0001 'X-RAY DIFFRACTION' 6 ? refined 99.3446 -1.2148 75.4521 0.2075 0.2107 0.2391 0.0483 -0.0268 0.0465 2.1528 1.3515 2.7164 0.3909 0.1947 0.2075 0.0514 0.0731 -0.1270 -0.3733 -0.1494 0.1376 0.1832 0.3282 -0.2263 'X-RAY DIFFRACTION' 7 ? refined 98.4809 5.3055 60.5668 0.1989 0.1850 0.2191 -0.0498 -0.0333 -0.0351 2.0749 0.8900 3.3141 -0.6381 -0.3118 0.3739 -0.1925 -0.0612 0.2454 0.2930 -0.1501 0.2051 -0.1512 0.4327 -0.7392 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 0 A 0 ;chain 'A' and (resid 4 through 24 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 0 A 0 ;chain 'A' and (resid 25 through 68 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 0 A 0 ;chain 'A' and (resid 69 through 81 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 0 A 0 ;chain 'A' and (resid 82 through 128 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 0 A 0 ;chain 'A' and (resid 129 through 159 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 0 A 0 ;chain 'A' and (resid 160 through 198 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 0 A 0 ;chain 'A' and (resid 199 through 228 ) ; ? ? ? ? ? # _pdbx_phasing_MR.entry_id 4KW8 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.560 _pdbx_phasing_MR.d_res_low_rotation 45.690 _pdbx_phasing_MR.d_res_high_translation 5.560 _pdbx_phasing_MR.d_res_low_translation 45.690 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 DENZO . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data reduction' http://www.hkl-xray.com/ ? ? 2 SCALEPACK . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 3 PHASER 2.5.2 'Thu Sep 27 05:35:48 2012 (svn )' program 'Randy J. Read' cimr-phaser@lists.cam.ac.uk phasing http://www-structmed.cimr.cam.ac.uk/phaser/ ? ? 4 PHENIX 1.8.1_1168 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 5 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 SERGUI . ? ? ? ? 'data collection' ? ? ? # _pdbx_entry_details.entry_id 4KW8 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;EMERALD GFP HAS LEU AT POSITION 64, THR AT 65, ALA AT 72, LYS AT 149, THR AT 153, 167, LEU AT 231. RESIDUES THR 65, TYR 66, GLY 67 FORM A CHROMOPHORE CRO 66 ; _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 103 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -150.25 _pdbx_validate_torsion.psi -158.93 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 5 ? CD ? A GLU 8 CD 2 1 Y 1 A GLU 5 ? OE1 ? A GLU 8 OE1 3 1 Y 1 A GLU 5 ? OE2 ? A GLU 8 OE2 4 1 Y 1 A GLU 6 ? CG ? A GLU 9 CG 5 1 Y 1 A GLU 6 ? CD ? A GLU 9 CD 6 1 Y 1 A GLU 6 ? OE1 ? A GLU 9 OE1 7 1 Y 1 A GLU 6 ? OE2 ? A GLU 9 OE2 8 1 Y 1 A ASP 19 ? OD1 ? A ASP 22 OD1 9 1 Y 1 A ASP 19 ? OD2 ? A ASP 22 OD2 10 1 Y 1 A LYS 26 ? CD ? A LYS 29 CD 11 1 Y 1 A LYS 26 ? CE ? A LYS 29 CE 12 1 Y 1 A LYS 26 ? NZ ? A LYS 29 NZ 13 1 Y 1 A GLU 32 ? OE1 ? A GLU 35 OE1 14 1 Y 1 A GLU 32 ? OE2 ? A GLU 35 OE2 15 1 Y 1 A LYS 52 ? CD ? A LYS 55 CD 16 1 Y 1 A LYS 52 ? CE ? A LYS 55 CE 17 1 Y 1 A LYS 52 ? NZ ? A LYS 55 NZ 18 1 Y 1 A LYS 79 ? CD ? A LYS 80 CD 19 1 Y 1 A LYS 79 ? CE ? A LYS 80 CE 20 1 Y 1 A LYS 79 ? NZ ? A LYS 80 NZ 21 1 Y 1 A GLN 80 ? CD ? A GLN 81 CD 22 1 Y 1 A GLN 80 ? OE1 ? A GLN 81 OE1 23 1 Y 1 A GLN 80 ? NE2 ? A GLN 81 NE2 24 1 Y 1 A GLU 95 ? OE1 ? A GLU 96 OE1 25 1 Y 1 A GLU 95 ? OE2 ? A GLU 96 OE2 26 1 Y 1 A LYS 101 ? CE ? A LYS 102 CE 27 1 Y 1 A LYS 101 ? NZ ? A LYS 102 NZ 28 1 Y 1 A ASP 102 ? CG ? A ASP 103 CG 29 1 Y 1 A ASP 102 ? OD1 ? A ASP 103 OD1 30 1 Y 1 A ASP 102 ? OD2 ? A ASP 103 OD2 31 1 Y 1 A GLU 111 ? CD ? A GLU 112 CD 32 1 Y 1 A GLU 111 ? OE1 ? A GLU 112 OE1 33 1 Y 1 A GLU 111 ? OE2 ? A GLU 112 OE2 34 1 Y 1 A LYS 113 ? CE ? A LYS 114 CE 35 1 Y 1 A LYS 113 ? NZ ? A LYS 114 NZ 36 1 Y 1 A ARG 122 ? CD ? A ARG 123 CD 37 1 Y 1 A ARG 122 ? NE ? A ARG 123 NE 38 1 Y 1 A ARG 122 ? CZ ? A ARG 123 CZ 39 1 Y 1 A ARG 122 ? NH1 ? A ARG 123 NH1 40 1 Y 1 A ARG 122 ? NH2 ? A ARG 123 NH2 41 1 Y 1 A GLU 124 ? CD ? A GLU 125 CD 42 1 Y 1 A GLU 124 ? OE1 ? A GLU 125 OE1 43 1 Y 1 A GLU 124 ? OE2 ? A GLU 125 OE2 44 1 Y 1 A LYS 126 ? CD ? A LYS 127 CD 45 1 Y 1 A LYS 126 ? CE ? A LYS 127 CE 46 1 Y 1 A LYS 126 ? NZ ? A LYS 127 NZ 47 1 Y 1 A LYS 131 ? NZ ? A LYS 132 NZ 48 1 Y 1 A GLU 132 ? CG ? A GLU 133 CG 49 1 Y 1 A GLU 132 ? CD ? A GLU 133 CD 50 1 Y 1 A GLU 132 ? OE1 ? A GLU 133 OE1 51 1 Y 1 A GLU 132 ? OE2 ? A GLU 133 OE2 52 1 Y 1 A ASP 133 ? CG ? A ASP 134 CG 53 1 Y 1 A ASP 133 ? OD1 ? A ASP 134 OD1 54 1 Y 1 A ASP 133 ? OD2 ? A ASP 134 OD2 55 1 Y 1 A LYS 140 ? CE ? A LYS 141 CE 56 1 Y 1 A LYS 140 ? NZ ? A LYS 141 NZ 57 1 Y 1 A LYS 149 ? CE ? A LYS 150 CE 58 1 Y 1 A LYS 149 ? NZ ? A LYS 150 NZ 59 1 Y 1 A LYS 156 ? CG ? A LYS 157 CG 60 1 Y 1 A LYS 156 ? CD ? A LYS 157 CD 61 1 Y 1 A LYS 156 ? CE ? A LYS 157 CE 62 1 Y 1 A LYS 156 ? NZ ? A LYS 157 NZ 63 1 Y 1 A GLN 157 ? CG ? A GLN 158 CG 64 1 Y 1 A GLN 157 ? CD ? A GLN 158 CD 65 1 Y 1 A GLN 157 ? OE1 ? A GLN 158 OE1 66 1 Y 1 A GLN 157 ? NE2 ? A GLN 158 NE2 67 1 Y 1 A LYS 158 ? NZ ? A LYS 159 NZ 68 1 Y 1 A LYS 162 ? CD ? A LYS 163 CD 69 1 Y 1 A LYS 162 ? CE ? A LYS 163 CE 70 1 Y 1 A LYS 162 ? NZ ? A LYS 163 NZ 71 1 Y 1 A LYS 166 ? CD ? A LYS 167 CD 72 1 Y 1 A LYS 166 ? CE ? A LYS 167 CE 73 1 Y 1 A LYS 166 ? NZ ? A LYS 167 NZ 74 1 Y 1 A ARG 168 ? NE ? A ARG 169 NE 75 1 Y 1 A ARG 168 ? CZ ? A ARG 169 CZ 76 1 Y 1 A ARG 168 ? NH1 ? A ARG 169 NH1 77 1 Y 1 A ARG 168 ? NH2 ? A ARG 169 NH2 78 1 Y 1 A GLU 172 ? CG ? A GLU 173 CG 79 1 Y 1 A GLU 172 ? CD ? A GLU 173 CD 80 1 Y 1 A GLU 172 ? OE1 ? A GLU 173 OE1 81 1 Y 1 A GLU 172 ? OE2 ? A GLU 173 OE2 82 1 Y 1 A LEU 178 ? CG ? A LEU 179 CG 83 1 Y 1 A LEU 178 ? CD1 ? A LEU 179 CD1 84 1 Y 1 A LEU 178 ? CD2 ? A LEU 179 CD2 85 1 Y 1 A ASP 180 ? OD1 ? A ASP 181 OD1 86 1 Y 1 A ASP 180 ? OD2 ? A ASP 181 OD2 87 1 Y 1 A GLN 184 ? CD ? A GLN 185 CD 88 1 Y 1 A GLN 184 ? OE1 ? A GLN 185 OE1 89 1 Y 1 A GLN 184 ? NE2 ? A GLN 185 NE2 90 1 Y 1 A ASP 190 ? CG ? A ASP 191 CG 91 1 Y 1 A ASP 190 ? OD1 ? A ASP 191 OD1 92 1 Y 1 A ASP 190 ? OD2 ? A ASP 191 OD2 93 1 Y 1 A LYS 206 ? CE ? A LYS 207 CE 94 1 Y 1 A LYS 206 ? NZ ? A LYS 207 NZ 95 1 Y 1 A LYS 214 ? CD ? A LYS 215 CD 96 1 Y 1 A LYS 214 ? CE ? A LYS 215 CE 97 1 Y 1 A LYS 214 ? NZ ? A LYS 215 NZ 98 1 Y 1 A GLU 222 ? OE1 ? A GLU 223 OE1 99 1 Y 1 A GLU 222 ? OE2 ? A GLU 223 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A MET 0 ? A MET 3 4 1 Y 1 A VAL 1 ? A VAL 4 5 1 Y 1 A SER 2 ? A SER 5 6 1 Y 1 A LYS 3 ? A LYS 6 7 1 Y 1 A ILE 229 ? A ILE 230 8 1 Y 1 A THR 230 ? A THR 231 9 1 Y 1 A LEU 231 ? A LEU 232 10 1 Y 1 A GLY 232 ? A GLY 233 11 1 Y 1 A MET 233 ? A MET 234 12 1 Y 1 A ASP 234 ? A ASP 235 13 1 Y 1 A GLU 235 ? A GLU 236 14 1 Y 1 A LEU 236 ? A LEU 237 15 1 Y 1 A TYR 237 ? A TYR 238 16 1 Y 1 A LYS 238 ? A LYS 239 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NICKEL (II) ION' NI 3 water HOH #