data_4L52 # _entry.id 4L52 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4L52 RCSB RCSB080190 WWPDB D_1000080190 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4L3P 'Crystal Structure of 2-(1-benzothiophen-7-yl)-4-[1-(piperidin-4-yl)-1h-pyrazol-4-yl]furo[2,3-c]pyridin-7-amine bound to TAK1-TAB1' unspecified PDB 4L53 ;Crystal Structure of (1R,4R)-4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)-3-chlorofuro[2,3-c]pyridin-4-yl]-1H-pyrazol-1-yl}cyclohexan-1-ol bound to TAK1-TAB1 ; unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4L52 _pdbx_database_status.recvd_initial_deposition_date 2013-06-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, J.' 1 'Hornberger, K.R.' 2 'Crew, A.P.' 3 'Jestel, A.' 4 'Maskos, K.' 5 'Moertl, M.' 6 # _citation.id primary _citation.title 'Discovery and optimization of 7-aminofuro[2,3-c]pyridine inhibitors of TAK1.' _citation.journal_abbrev Bioorg.Med.Chem.Lett. _citation.journal_volume 23 _citation.page_first 4517 _citation.page_last 4522 _citation.year 2013 _citation.journal_id_ASTM BMCLE8 _citation.country UK _citation.journal_id_ISSN 0960-894X _citation.journal_id_CSD 1127 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23850198 _citation.pdbx_database_id_DOI 10.1016/j.bmcl.2013.06.053 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hornberger, K.R.' 1 primary 'Berger, D.M.' 2 primary 'Crew, A.P.' 3 primary 'Dong, H.' 4 primary 'Kleinberg, A.' 5 primary 'Li, A.H.' 6 primary 'Medeiros, M.R.' 7 primary 'Mulvihill, M.J.' 8 primary 'Siu, K.' 9 primary 'Tarrant, J.' 10 primary 'Wang, J.' 11 primary 'Weng, F.' 12 primary 'Wilde, V.L.' 13 primary 'Albertella, M.' 14 primary 'Bittner, M.' 15 primary 'Cooke, A.' 16 primary 'Gray, M.J.' 17 primary 'Maresca, P.' 18 primary 'May, E.' 19 primary 'Meyn, P.' 20 primary 'Peick, W.' 21 primary 'Romashko, D.' 22 primary 'Tanowitz, M.' 23 primary 'Tokar, B.' 24 # _cell.entry_id 4L52 _cell.length_a 58.160 _cell.length_b 133.784 _cell.length_c 142.237 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4L52 _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase kinase kinase 7, TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 chimera' 34709.043 1 2.7.11.25 ? 'SEE REMARK 999' ? 2 non-polymer syn '1-(4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)furo[2,3-c]pyridin-4-yl]-1H-pyrazol-1-yl}piperidin-1-yl)ethanone' 459.524 1 ? ? ? ? 3 water nat water 18.015 35 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Tak1-Tab1 fusion protein, Transforming growth factor-beta-activated kinase 1, TGF-beta-activated kinase 1, Mitogen-activated protein kinase kinase kinase 7-interacting protein 1, TGF-beta-activated kinase 1-binding protein 1, TAK1-binding protein 1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVME YAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTH MTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTR CWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVME YAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTH MTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTR CWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LEU n 1 4 HIS n 1 5 MET n 1 6 ILE n 1 7 ASP n 1 8 TYR n 1 9 LYS n 1 10 GLU n 1 11 ILE n 1 12 GLU n 1 13 VAL n 1 14 GLU n 1 15 GLU n 1 16 VAL n 1 17 VAL n 1 18 GLY n 1 19 ARG n 1 20 GLY n 1 21 ALA n 1 22 PHE n 1 23 GLY n 1 24 VAL n 1 25 VAL n 1 26 CYS n 1 27 LYS n 1 28 ALA n 1 29 LYS n 1 30 TRP n 1 31 ARG n 1 32 ALA n 1 33 LYS n 1 34 ASP n 1 35 VAL n 1 36 ALA n 1 37 ILE n 1 38 LYS n 1 39 GLN n 1 40 ILE n 1 41 GLU n 1 42 SER n 1 43 GLU n 1 44 SER n 1 45 GLU n 1 46 ARG n 1 47 LYS n 1 48 ALA n 1 49 PHE n 1 50 ILE n 1 51 VAL n 1 52 GLU n 1 53 LEU n 1 54 ARG n 1 55 GLN n 1 56 LEU n 1 57 SER n 1 58 ARG n 1 59 VAL n 1 60 ASN n 1 61 HIS n 1 62 PRO n 1 63 ASN n 1 64 ILE n 1 65 VAL n 1 66 LYS n 1 67 LEU n 1 68 TYR n 1 69 GLY n 1 70 ALA n 1 71 CYS n 1 72 LEU n 1 73 ASN n 1 74 PRO n 1 75 VAL n 1 76 CYS n 1 77 LEU n 1 78 VAL n 1 79 MET n 1 80 GLU n 1 81 TYR n 1 82 ALA n 1 83 GLU n 1 84 GLY n 1 85 GLY n 1 86 SER n 1 87 LEU n 1 88 TYR n 1 89 ASN n 1 90 VAL n 1 91 LEU n 1 92 HIS n 1 93 GLY n 1 94 ALA n 1 95 GLU n 1 96 PRO n 1 97 LEU n 1 98 PRO n 1 99 TYR n 1 100 TYR n 1 101 THR n 1 102 ALA n 1 103 ALA n 1 104 HIS n 1 105 ALA n 1 106 MET n 1 107 SER n 1 108 TRP n 1 109 CYS n 1 110 LEU n 1 111 GLN n 1 112 CYS n 1 113 SER n 1 114 GLN n 1 115 GLY n 1 116 VAL n 1 117 ALA n 1 118 TYR n 1 119 LEU n 1 120 HIS n 1 121 SER n 1 122 MET n 1 123 GLN n 1 124 PRO n 1 125 LYS n 1 126 ALA n 1 127 LEU n 1 128 ILE n 1 129 HIS n 1 130 ARG n 1 131 ASP n 1 132 LEU n 1 133 LYS n 1 134 PRO n 1 135 PRO n 1 136 ASN n 1 137 LEU n 1 138 LEU n 1 139 LEU n 1 140 VAL n 1 141 ALA n 1 142 GLY n 1 143 GLY n 1 144 THR n 1 145 VAL n 1 146 LEU n 1 147 LYS n 1 148 ILE n 1 149 CYS n 1 150 ASP n 1 151 PHE n 1 152 GLY n 1 153 THR n 1 154 ALA n 1 155 CYS n 1 156 ASP n 1 157 ILE n 1 158 GLN n 1 159 THR n 1 160 HIS n 1 161 MET n 1 162 THR n 1 163 ASN n 1 164 ASN n 1 165 LYS n 1 166 GLY n 1 167 SER n 1 168 ALA n 1 169 ALA n 1 170 TRP n 1 171 MET n 1 172 ALA n 1 173 PRO n 1 174 GLU n 1 175 VAL n 1 176 PHE n 1 177 GLU n 1 178 GLY n 1 179 SER n 1 180 ASN n 1 181 TYR n 1 182 SER n 1 183 GLU n 1 184 LYS n 1 185 CYS n 1 186 ASP n 1 187 VAL n 1 188 PHE n 1 189 SER n 1 190 TRP n 1 191 GLY n 1 192 ILE n 1 193 ILE n 1 194 LEU n 1 195 TRP n 1 196 GLU n 1 197 VAL n 1 198 ILE n 1 199 THR n 1 200 ARG n 1 201 ARG n 1 202 LYS n 1 203 PRO n 1 204 PHE n 1 205 ASP n 1 206 GLU n 1 207 ILE n 1 208 GLY n 1 209 GLY n 1 210 PRO n 1 211 ALA n 1 212 PHE n 1 213 ARG n 1 214 ILE n 1 215 MET n 1 216 TRP n 1 217 ALA n 1 218 VAL n 1 219 HIS n 1 220 ASN n 1 221 GLY n 1 222 THR n 1 223 ARG n 1 224 PRO n 1 225 PRO n 1 226 LEU n 1 227 ILE n 1 228 LYS n 1 229 ASN n 1 230 LEU n 1 231 PRO n 1 232 LYS n 1 233 PRO n 1 234 ILE n 1 235 GLU n 1 236 SER n 1 237 LEU n 1 238 MET n 1 239 THR n 1 240 ARG n 1 241 CYS n 1 242 TRP n 1 243 SER n 1 244 LYS n 1 245 ASP n 1 246 PRO n 1 247 SER n 1 248 GLN n 1 249 ARG n 1 250 PRO n 1 251 SER n 1 252 MET n 1 253 GLU n 1 254 GLU n 1 255 ILE n 1 256 VAL n 1 257 LYS n 1 258 ILE n 1 259 MET n 1 260 THR n 1 261 HIS n 1 262 LEU n 1 263 MET n 1 264 ARG n 1 265 TYR n 1 266 PHE n 1 267 PRO n 1 268 GLY n 1 269 ALA n 1 270 ASP n 1 271 GLU n 1 272 PRO n 1 273 LEU n 1 274 GLN n 1 275 TYR n 1 276 PRO n 1 277 CYS n 1 278 GLN n 1 279 HIS n 1 280 SER n 1 281 LEU n 1 282 PRO n 1 283 PRO n 1 284 GLY n 1 285 GLU n 1 286 ASP n 1 287 GLY n 1 288 ARG n 1 289 VAL n 1 290 GLU n 1 291 PRO n 1 292 TYR n 1 293 VAL n 1 294 ASP n 1 295 PHE n 1 296 ALA n 1 297 GLU n 1 298 PHE n 1 299 TYR n 1 300 ARG n 1 301 LEU n 1 302 TRP n 1 303 SER n 1 304 VAL n 1 305 ASP n 1 306 HIS n 1 307 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 6 278 human ? 'MAP3K7, TAK1, MAP3K7IP1, TAB1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 1 2 sample ? 279 307 human ? 'MAP3K7, TAK1, MAP3K7IP1, TAB1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP M3K7_HUMAN O43318 1 ;IDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGG SLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNK GSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKD PSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQ ; 31 ? 2 UNP TAB1_HUMAN Q15750 1 HSLPPGEDGRVEPYVDFAEFYRLWSVDHG 468 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4L52 A 6 ? 278 ? O43318 31 ? 303 ? 31 303 2 2 4L52 A 279 ? 307 ? Q15750 468 ? 496 ? 468 496 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4L52 GLY A 1 ? UNP O43318 ? ? 'EXPRESSION TAG' 26 1 1 4L52 SER A 2 ? UNP O43318 ? ? 'EXPRESSION TAG' 27 2 1 4L52 LEU A 3 ? UNP O43318 ? ? 'EXPRESSION TAG' 28 3 1 4L52 HIS A 4 ? UNP O43318 ? ? 'EXPRESSION TAG' 29 4 1 4L52 MET A 5 ? UNP O43318 ? ? 'EXPRESSION TAG' 30 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1UL non-polymer . '1-(4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)furo[2,3-c]pyridin-4-yl]-1H-pyrazol-1-yl}piperidin-1-yl)ethanone' ? 'C23 H21 N7 O2 S' 459.524 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4L52 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.99 _exptl_crystal.density_percent_sol 69.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_details '0.75 M sodium citrate, 0.2 M sodium chloride, 0.1 M TRIS, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2010-09-29 _diffrn_detector.details 'dynamically bendable mirror' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'LN2 cooled fixed-exit Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_wavelength 1.0000 _diffrn_source.pdbx_wavelength_list 1.0000 # _reflns.entry_id 4L52 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F 0.0 _reflns.d_resolution_low 97.51 _reflns.d_resolution_high 2.54 _reflns.number_obs 18760 _reflns.number_all 18760 _reflns.percent_possible_obs 93.9 _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.54 _reflns_shell.d_res_low 2.76 _reflns_shell.percent_possible_all 95.9 _reflns_shell.Rmerge_I_obs 0.449 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 3.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4L52 _refine.ls_number_reflns_obs 16952 _refine.ls_number_reflns_all 16952 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 97.51 _refine.ls_d_res_high 2.54 _refine.ls_percent_reflns_obs 93.93 _refine.ls_R_factor_obs 0.19584 _refine.ls_R_factor_all 0.19584 _refine.ls_R_factor_R_work 0.19455 _refine.ls_R_factor_R_free 0.22953 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 3.8 _refine.ls_number_reflns_R_free 666 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.952 _refine.correlation_coeff_Fo_to_Fc_free 0.940 _refine.B_iso_mean 66.686 _refine.aniso_B[1][1] -5.32 _refine.aniso_B[2][2] -2.52 _refine.aniso_B[3][3] 7.84 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.284 _refine.pdbx_overall_ESU_R_Free 0.224 _refine.overall_SU_ML 0.168 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 16.314 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2341 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 35 _refine_hist.number_atoms_total 2409 _refine_hist.d_res_high 2.54 _refine_hist.d_res_low 97.51 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.011 0.021 ? 2380 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.001 0.020 ? 2101 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.422 1.964 ? 3250 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.797 3.000 ? 4857 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.544 5.000 ? 295 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 34.630 23.061 ? 98 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 16.546 15.000 ? 349 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 18.913 15.000 ? 14 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.069 0.200 ? 341 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.004 0.020 ? 2674 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.001 0.020 ? 494 ? 'X-RAY DIFFRACTION' r_nbd_refined 0.218 0.200 ? 524 ? 'X-RAY DIFFRACTION' r_nbd_other 0.185 0.200 ? 2090 ? 'X-RAY DIFFRACTION' r_nbtor_refined 0.188 0.200 ? 1194 ? 'X-RAY DIFFRACTION' r_nbtor_other 0.089 0.200 ? 1232 ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined 0.150 0.200 ? 49 ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined 0.089 0.200 ? 11 ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other 0.166 0.200 ? 40 ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined 0.015 0.200 ? 3 ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it 2.438 2.000 ? 1884 ? 'X-RAY DIFFRACTION' r_mcbond_other 0.434 2.000 ? 594 ? 'X-RAY DIFFRACTION' r_mcangle_it 2.994 3.000 ? 2378 ? 'X-RAY DIFFRACTION' r_scbond_it 4.461 4.000 ? 1103 ? 'X-RAY DIFFRACTION' r_scangle_it 6.204 6.000 ? 872 ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.540 _refine_ls_shell.d_res_low 2.606 _refine_ls_shell.number_reflns_R_work 1250 _refine_ls_shell.R_factor_R_work 0.310 _refine_ls_shell.percent_reflns_obs 96.01 _refine_ls_shell.R_factor_R_free 0.415 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4L52 _struct.title ;Crystal Structure of 1-(4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)furo[2,3-c]pyridin-4-yl]-1H-pyrazol-1-yl}piperidin-1-yl)ethan-1-one bound to TAK1-TAB1 ; _struct.pdbx_descriptor 'Mitogen-activated protein kinase kinase kinase 7, TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 chimera (E.C.2.7.11.25)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4L52 _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' _struct_keywords.text 'TAK1 kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 7 ? LYS A 9 ? ASP A 32 LYS A 34 5 ? 3 HELX_P HELX_P2 2 SER A 42 ? SER A 44 ? SER A 67 SER A 69 5 ? 3 HELX_P HELX_P3 3 GLU A 45 ? SER A 57 ? GLU A 70 SER A 82 1 ? 13 HELX_P HELX_P4 4 LEU A 87 ? GLY A 93 ? LEU A 112 GLY A 118 1 ? 7 HELX_P HELX_P5 5 THR A 101 ? MET A 122 ? THR A 126 MET A 147 1 ? 22 HELX_P HELX_P6 6 LYS A 133 ? PRO A 135 ? LYS A 158 PRO A 160 5 ? 3 HELX_P HELX_P7 7 SER A 167 ? MET A 171 ? SER A 192 MET A 196 5 ? 5 HELX_P HELX_P8 8 ALA A 172 ? GLU A 177 ? ALA A 197 GLU A 202 1 ? 6 HELX_P HELX_P9 9 GLU A 183 ? ARG A 200 ? GLU A 208 ARG A 225 1 ? 18 HELX_P HELX_P10 10 PRO A 210 ? ASN A 220 ? PRO A 235 ASN A 245 1 ? 11 HELX_P HELX_P11 11 PRO A 231 ? TRP A 242 ? PRO A 256 TRP A 267 1 ? 12 HELX_P HELX_P12 12 ASP A 245 ? ARG A 249 ? ASP A 270 ARG A 274 5 ? 5 HELX_P HELX_P13 13 SER A 251 ? MET A 263 ? SER A 276 MET A 288 1 ? 13 HELX_P HELX_P14 14 ARG A 264 ? PHE A 266 ? ARG A 289 PHE A 291 5 ? 3 HELX_P HELX_P15 15 PHE A 295 ? HIS A 306 ? PHE A 484 HIS A 495 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 71 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 76 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 96 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.712 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 95 A . ? GLU 120 A PRO 96 A ? PRO 121 A 1 5.10 2 GLN 123 A . ? GLN 148 A PRO 124 A ? PRO 149 A 1 -4.62 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 3 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 11 ? GLY A 18 ? ILE A 36 GLY A 43 A 2 VAL A 24 ? TRP A 30 ? VAL A 49 TRP A 55 A 3 LYS A 33 ? GLN A 39 ? LYS A 58 GLN A 64 A 4 CYS A 76 ? GLU A 80 ? CYS A 101 GLU A 105 A 5 LEU A 67 ? CYS A 71 ? LEU A 92 CYS A 96 B 1 GLY A 85 ? SER A 86 ? GLY A 110 SER A 111 B 2 LEU A 137 ? VAL A 140 ? LEU A 162 VAL A 165 B 3 VAL A 145 ? ILE A 148 ? VAL A 170 ILE A 173 C 1 LEU A 97 ? PRO A 98 ? LEU A 122 PRO A 123 C 2 PRO A 276 ? CYS A 277 ? PRO A 301 CYS A 302 D 1 LEU A 226 ? ILE A 227 ? LEU A 251 ILE A 252 D 2 ARG A 288 ? VAL A 289 ? ARG A 477 VAL A 478 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 18 ? N GLY A 43 O VAL A 25 ? O VAL A 50 A 2 3 N CYS A 26 ? N CYS A 51 O ILE A 37 ? O ILE A 62 A 3 4 N ALA A 36 ? N ALA A 61 O MET A 79 ? O MET A 104 A 4 5 O VAL A 78 ? O VAL A 103 N GLY A 69 ? N GLY A 94 B 1 2 N GLY A 85 ? N GLY A 110 O LEU A 139 ? O LEU A 164 B 2 3 N LEU A 138 ? N LEU A 163 O LYS A 147 ? O LYS A 172 C 1 2 N LEU A 97 ? N LEU A 122 O CYS A 277 ? O CYS A 302 D 1 2 N LEU A 226 ? N LEU A 251 O VAL A 289 ? O VAL A 478 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'BINDING SITE FOR RESIDUE 1UL A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 VAL A 17 ? VAL A 42 . ? 1_555 ? 2 AC1 10 ALA A 36 ? ALA A 61 . ? 1_555 ? 3 AC1 10 MET A 79 ? MET A 104 . ? 1_555 ? 4 AC1 10 GLU A 80 ? GLU A 105 . ? 1_555 ? 5 AC1 10 TYR A 81 ? TYR A 106 . ? 1_555 ? 6 AC1 10 ALA A 82 ? ALA A 107 . ? 1_555 ? 7 AC1 10 GLU A 83 ? GLU A 108 . ? 1_555 ? 8 AC1 10 LEU A 138 ? LEU A 163 . ? 1_555 ? 9 AC1 10 CYS A 149 ? CYS A 174 . ? 1_555 ? 10 AC1 10 ASP A 150 ? ASP A 175 . ? 1_555 ? # _database_PDB_matrix.entry_id 4L52 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4L52 _atom_sites.fract_transf_matrix[1][1] 0.017194 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007475 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007031 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 26 26 GLY GLY A . n A 1 2 SER 2 27 27 SER SER A . n A 1 3 LEU 3 28 28 LEU LEU A . n A 1 4 HIS 4 29 29 HIS HIS A . n A 1 5 MET 5 30 30 MET MET A . n A 1 6 ILE 6 31 31 ILE ILE A . n A 1 7 ASP 7 32 32 ASP ASP A . n A 1 8 TYR 8 33 33 TYR TYR A . n A 1 9 LYS 9 34 34 LYS LYS A . n A 1 10 GLU 10 35 35 GLU GLU A . n A 1 11 ILE 11 36 36 ILE ILE A . n A 1 12 GLU 12 37 37 GLU GLU A . n A 1 13 VAL 13 38 38 VAL VAL A . n A 1 14 GLU 14 39 39 GLU GLU A . n A 1 15 GLU 15 40 40 GLU GLU A . n A 1 16 VAL 16 41 41 VAL VAL A . n A 1 17 VAL 17 42 42 VAL VAL A . n A 1 18 GLY 18 43 43 GLY GLY A . n A 1 19 ARG 19 44 44 ARG ARG A . n A 1 20 GLY 20 45 45 GLY GLY A . n A 1 21 ALA 21 46 46 ALA ALA A . n A 1 22 PHE 22 47 47 PHE PHE A . n A 1 23 GLY 23 48 48 GLY GLY A . n A 1 24 VAL 24 49 49 VAL VAL A . n A 1 25 VAL 25 50 50 VAL VAL A . n A 1 26 CYS 26 51 51 CYS CYS A . n A 1 27 LYS 27 52 52 LYS LYS A . n A 1 28 ALA 28 53 53 ALA ALA A . n A 1 29 LYS 29 54 54 LYS LYS A . n A 1 30 TRP 30 55 55 TRP TRP A . n A 1 31 ARG 31 56 56 ARG ARG A . n A 1 32 ALA 32 57 57 ALA ALA A . n A 1 33 LYS 33 58 58 LYS LYS A . n A 1 34 ASP 34 59 59 ASP ASP A . n A 1 35 VAL 35 60 60 VAL VAL A . n A 1 36 ALA 36 61 61 ALA ALA A . n A 1 37 ILE 37 62 62 ILE ILE A . n A 1 38 LYS 38 63 63 LYS LYS A . n A 1 39 GLN 39 64 64 GLN GLN A . n A 1 40 ILE 40 65 65 ILE ILE A . n A 1 41 GLU 41 66 66 GLU GLU A . n A 1 42 SER 42 67 67 SER SER A . n A 1 43 GLU 43 68 68 GLU GLU A . n A 1 44 SER 44 69 69 SER SER A . n A 1 45 GLU 45 70 70 GLU GLU A . n A 1 46 ARG 46 71 71 ARG ARG A . n A 1 47 LYS 47 72 72 LYS LYS A . n A 1 48 ALA 48 73 73 ALA ALA A . n A 1 49 PHE 49 74 74 PHE PHE A . n A 1 50 ILE 50 75 75 ILE ILE A . n A 1 51 VAL 51 76 76 VAL VAL A . n A 1 52 GLU 52 77 77 GLU GLU A . n A 1 53 LEU 53 78 78 LEU LEU A . n A 1 54 ARG 54 79 79 ARG ARG A . n A 1 55 GLN 55 80 80 GLN GLN A . n A 1 56 LEU 56 81 81 LEU LEU A . n A 1 57 SER 57 82 82 SER SER A . n A 1 58 ARG 58 83 83 ARG ARG A . n A 1 59 VAL 59 84 84 VAL VAL A . n A 1 60 ASN 60 85 85 ASN ASN A . n A 1 61 HIS 61 86 86 HIS HIS A . n A 1 62 PRO 62 87 87 PRO PRO A . n A 1 63 ASN 63 88 88 ASN ASN A . n A 1 64 ILE 64 89 89 ILE ILE A . n A 1 65 VAL 65 90 90 VAL VAL A . n A 1 66 LYS 66 91 91 LYS LYS A . n A 1 67 LEU 67 92 92 LEU LEU A . n A 1 68 TYR 68 93 93 TYR TYR A . n A 1 69 GLY 69 94 94 GLY GLY A . n A 1 70 ALA 70 95 95 ALA ALA A . n A 1 71 CYS 71 96 96 CYS CYS A . n A 1 72 LEU 72 97 97 LEU LEU A . n A 1 73 ASN 73 98 98 ASN ASN A . n A 1 74 PRO 74 99 99 PRO PRO A . n A 1 75 VAL 75 100 100 VAL VAL A . n A 1 76 CYS 76 101 101 CYS CYS A . n A 1 77 LEU 77 102 102 LEU LEU A . n A 1 78 VAL 78 103 103 VAL VAL A . n A 1 79 MET 79 104 104 MET MET A . n A 1 80 GLU 80 105 105 GLU GLU A . n A 1 81 TYR 81 106 106 TYR TYR A . n A 1 82 ALA 82 107 107 ALA ALA A . n A 1 83 GLU 83 108 108 GLU GLU A . n A 1 84 GLY 84 109 109 GLY GLY A . n A 1 85 GLY 85 110 110 GLY GLY A . n A 1 86 SER 86 111 111 SER SER A . n A 1 87 LEU 87 112 112 LEU LEU A . n A 1 88 TYR 88 113 113 TYR TYR A . n A 1 89 ASN 89 114 114 ASN ASN A . n A 1 90 VAL 90 115 115 VAL VAL A . n A 1 91 LEU 91 116 116 LEU LEU A . n A 1 92 HIS 92 117 117 HIS HIS A . n A 1 93 GLY 93 118 118 GLY GLY A . n A 1 94 ALA 94 119 119 ALA ALA A . n A 1 95 GLU 95 120 120 GLU GLU A . n A 1 96 PRO 96 121 121 PRO PRO A . n A 1 97 LEU 97 122 122 LEU LEU A . n A 1 98 PRO 98 123 123 PRO PRO A . n A 1 99 TYR 99 124 124 TYR TYR A . n A 1 100 TYR 100 125 125 TYR TYR A . n A 1 101 THR 101 126 126 THR THR A . n A 1 102 ALA 102 127 127 ALA ALA A . n A 1 103 ALA 103 128 128 ALA ALA A . n A 1 104 HIS 104 129 129 HIS HIS A . n A 1 105 ALA 105 130 130 ALA ALA A . n A 1 106 MET 106 131 131 MET MET A . n A 1 107 SER 107 132 132 SER SER A . n A 1 108 TRP 108 133 133 TRP TRP A . n A 1 109 CYS 109 134 134 CYS CYS A . n A 1 110 LEU 110 135 135 LEU LEU A . n A 1 111 GLN 111 136 136 GLN GLN A . n A 1 112 CYS 112 137 137 CYS CYS A . n A 1 113 SER 113 138 138 SER SER A . n A 1 114 GLN 114 139 139 GLN GLN A . n A 1 115 GLY 115 140 140 GLY GLY A . n A 1 116 VAL 116 141 141 VAL VAL A . n A 1 117 ALA 117 142 142 ALA ALA A . n A 1 118 TYR 118 143 143 TYR TYR A . n A 1 119 LEU 119 144 144 LEU LEU A . n A 1 120 HIS 120 145 145 HIS HIS A . n A 1 121 SER 121 146 146 SER SER A . n A 1 122 MET 122 147 147 MET MET A . n A 1 123 GLN 123 148 148 GLN GLN A . n A 1 124 PRO 124 149 149 PRO PRO A . n A 1 125 LYS 125 150 150 LYS LYS A . n A 1 126 ALA 126 151 151 ALA ALA A . n A 1 127 LEU 127 152 152 LEU LEU A . n A 1 128 ILE 128 153 153 ILE ILE A . n A 1 129 HIS 129 154 154 HIS HIS A . n A 1 130 ARG 130 155 155 ARG ARG A . n A 1 131 ASP 131 156 156 ASP ASP A . n A 1 132 LEU 132 157 157 LEU LEU A . n A 1 133 LYS 133 158 158 LYS LYS A . n A 1 134 PRO 134 159 159 PRO PRO A . n A 1 135 PRO 135 160 160 PRO PRO A . n A 1 136 ASN 136 161 161 ASN ASN A . n A 1 137 LEU 137 162 162 LEU LEU A . n A 1 138 LEU 138 163 163 LEU LEU A . n A 1 139 LEU 139 164 164 LEU LEU A . n A 1 140 VAL 140 165 165 VAL VAL A . n A 1 141 ALA 141 166 166 ALA ALA A . n A 1 142 GLY 142 167 167 GLY GLY A . n A 1 143 GLY 143 168 168 GLY GLY A . n A 1 144 THR 144 169 169 THR THR A . n A 1 145 VAL 145 170 170 VAL VAL A . n A 1 146 LEU 146 171 171 LEU LEU A . n A 1 147 LYS 147 172 172 LYS LYS A . n A 1 148 ILE 148 173 173 ILE ILE A . n A 1 149 CYS 149 174 174 CYS CYS A . n A 1 150 ASP 150 175 175 ASP ASP A . n A 1 151 PHE 151 176 176 PHE PHE A . n A 1 152 GLY 152 177 177 GLY GLY A . n A 1 153 THR 153 178 178 THR THR A . n A 1 154 ALA 154 179 ? ? ? A . n A 1 155 CYS 155 180 ? ? ? A . n A 1 156 ASP 156 181 ? ? ? A . n A 1 157 ILE 157 182 ? ? ? A . n A 1 158 GLN 158 183 ? ? ? A . n A 1 159 THR 159 184 ? ? ? A . n A 1 160 HIS 160 185 ? ? ? A . n A 1 161 MET 161 186 ? ? ? A . n A 1 162 THR 162 187 ? ? ? A . n A 1 163 ASN 163 188 ? ? ? A . n A 1 164 ASN 164 189 ? ? ? A . n A 1 165 LYS 165 190 ? ? ? A . n A 1 166 GLY 166 191 191 GLY GLY A . n A 1 167 SER 167 192 192 SER SER A . n A 1 168 ALA 168 193 193 ALA ALA A . n A 1 169 ALA 169 194 194 ALA ALA A . n A 1 170 TRP 170 195 195 TRP TRP A . n A 1 171 MET 171 196 196 MET MET A . n A 1 172 ALA 172 197 197 ALA ALA A . n A 1 173 PRO 173 198 198 PRO PRO A . n A 1 174 GLU 174 199 199 GLU GLU A . n A 1 175 VAL 175 200 200 VAL VAL A . n A 1 176 PHE 176 201 201 PHE PHE A . n A 1 177 GLU 177 202 202 GLU GLU A . n A 1 178 GLY 178 203 203 GLY GLY A . n A 1 179 SER 179 204 204 SER SER A . n A 1 180 ASN 180 205 205 ASN ASN A . n A 1 181 TYR 181 206 206 TYR TYR A . n A 1 182 SER 182 207 207 SER SER A . n A 1 183 GLU 183 208 208 GLU GLU A . n A 1 184 LYS 184 209 209 LYS LYS A . n A 1 185 CYS 185 210 210 CYS CYS A . n A 1 186 ASP 186 211 211 ASP ASP A . n A 1 187 VAL 187 212 212 VAL VAL A . n A 1 188 PHE 188 213 213 PHE PHE A . n A 1 189 SER 189 214 214 SER SER A . n A 1 190 TRP 190 215 215 TRP TRP A . n A 1 191 GLY 191 216 216 GLY GLY A . n A 1 192 ILE 192 217 217 ILE ILE A . n A 1 193 ILE 193 218 218 ILE ILE A . n A 1 194 LEU 194 219 219 LEU LEU A . n A 1 195 TRP 195 220 220 TRP TRP A . n A 1 196 GLU 196 221 221 GLU GLU A . n A 1 197 VAL 197 222 222 VAL VAL A . n A 1 198 ILE 198 223 223 ILE ILE A . n A 1 199 THR 199 224 224 THR THR A . n A 1 200 ARG 200 225 225 ARG ARG A . n A 1 201 ARG 201 226 226 ARG ARG A . n A 1 202 LYS 202 227 227 LYS LYS A . n A 1 203 PRO 203 228 228 PRO PRO A . n A 1 204 PHE 204 229 229 PHE PHE A . n A 1 205 ASP 205 230 230 ASP ASP A . n A 1 206 GLU 206 231 231 GLU GLU A . n A 1 207 ILE 207 232 232 ILE ILE A . n A 1 208 GLY 208 233 233 GLY GLY A . n A 1 209 GLY 209 234 234 GLY GLY A . n A 1 210 PRO 210 235 235 PRO PRO A . n A 1 211 ALA 211 236 236 ALA ALA A . n A 1 212 PHE 212 237 237 PHE PHE A . n A 1 213 ARG 213 238 238 ARG ARG A . n A 1 214 ILE 214 239 239 ILE ILE A . n A 1 215 MET 215 240 240 MET MET A . n A 1 216 TRP 216 241 241 TRP TRP A . n A 1 217 ALA 217 242 242 ALA ALA A . n A 1 218 VAL 218 243 243 VAL VAL A . n A 1 219 HIS 219 244 244 HIS HIS A . n A 1 220 ASN 220 245 245 ASN ASN A . n A 1 221 GLY 221 246 246 GLY GLY A . n A 1 222 THR 222 247 247 THR THR A . n A 1 223 ARG 223 248 248 ARG ARG A . n A 1 224 PRO 224 249 249 PRO PRO A . n A 1 225 PRO 225 250 250 PRO PRO A . n A 1 226 LEU 226 251 251 LEU LEU A . n A 1 227 ILE 227 252 252 ILE ILE A . n A 1 228 LYS 228 253 253 LYS LYS A . n A 1 229 ASN 229 254 254 ASN ASN A . n A 1 230 LEU 230 255 255 LEU LEU A . n A 1 231 PRO 231 256 256 PRO PRO A . n A 1 232 LYS 232 257 257 LYS LYS A . n A 1 233 PRO 233 258 258 PRO PRO A . n A 1 234 ILE 234 259 259 ILE ILE A . n A 1 235 GLU 235 260 260 GLU GLU A . n A 1 236 SER 236 261 261 SER SER A . n A 1 237 LEU 237 262 262 LEU LEU A . n A 1 238 MET 238 263 263 MET MET A . n A 1 239 THR 239 264 264 THR THR A . n A 1 240 ARG 240 265 265 ARG ARG A . n A 1 241 CYS 241 266 266 CYS CYS A . n A 1 242 TRP 242 267 267 TRP TRP A . n A 1 243 SER 243 268 268 SER SER A . n A 1 244 LYS 244 269 269 LYS LYS A . n A 1 245 ASP 245 270 270 ASP ASP A . n A 1 246 PRO 246 271 271 PRO PRO A . n A 1 247 SER 247 272 272 SER SER A . n A 1 248 GLN 248 273 273 GLN GLN A . n A 1 249 ARG 249 274 274 ARG ARG A . n A 1 250 PRO 250 275 275 PRO PRO A . n A 1 251 SER 251 276 276 SER SER A . n A 1 252 MET 252 277 277 MET MET A . n A 1 253 GLU 253 278 278 GLU GLU A . n A 1 254 GLU 254 279 279 GLU GLU A . n A 1 255 ILE 255 280 280 ILE ILE A . n A 1 256 VAL 256 281 281 VAL VAL A . n A 1 257 LYS 257 282 282 LYS LYS A . n A 1 258 ILE 258 283 283 ILE ILE A . n A 1 259 MET 259 284 284 MET MET A . n A 1 260 THR 260 285 285 THR THR A . n A 1 261 HIS 261 286 286 HIS HIS A . n A 1 262 LEU 262 287 287 LEU LEU A . n A 1 263 MET 263 288 288 MET MET A . n A 1 264 ARG 264 289 289 ARG ARG A . n A 1 265 TYR 265 290 290 TYR TYR A . n A 1 266 PHE 266 291 291 PHE PHE A . n A 1 267 PRO 267 292 292 PRO PRO A . n A 1 268 GLY 268 293 293 GLY GLY A . n A 1 269 ALA 269 294 294 ALA ALA A . n A 1 270 ASP 270 295 295 ASP ASP A . n A 1 271 GLU 271 296 296 GLU GLU A . n A 1 272 PRO 272 297 297 PRO PRO A . n A 1 273 LEU 273 298 298 LEU LEU A . n A 1 274 GLN 274 299 299 GLN GLN A . n A 1 275 TYR 275 300 300 TYR TYR A . n A 1 276 PRO 276 301 301 PRO PRO A . n A 1 277 CYS 277 302 302 CYS CYS A . n A 1 278 GLN 278 303 303 GLN GLN A . n A 1 279 HIS 279 468 468 HIS HIS A . n A 1 280 SER 280 469 469 SER SER A . n A 1 281 LEU 281 470 470 LEU LEU A . n A 1 282 PRO 282 471 471 PRO PRO A . n A 1 283 PRO 283 472 472 PRO PRO A . n A 1 284 GLY 284 473 473 GLY GLY A . n A 1 285 GLU 285 474 474 GLU GLU A . n A 1 286 ASP 286 475 475 ASP ASP A . n A 1 287 GLY 287 476 476 GLY GLY A . n A 1 288 ARG 288 477 477 ARG ARG A . n A 1 289 VAL 289 478 478 VAL VAL A . n A 1 290 GLU 290 479 479 GLU GLU A . n A 1 291 PRO 291 480 480 PRO PRO A . n A 1 292 TYR 292 481 481 TYR TYR A . n A 1 293 VAL 293 482 482 VAL VAL A . n A 1 294 ASP 294 483 483 ASP ASP A . n A 1 295 PHE 295 484 484 PHE PHE A . n A 1 296 ALA 296 485 485 ALA ALA A . n A 1 297 GLU 297 486 486 GLU GLU A . n A 1 298 PHE 298 487 487 PHE PHE A . n A 1 299 TYR 299 488 488 TYR TYR A . n A 1 300 ARG 300 489 489 ARG ARG A . n A 1 301 LEU 301 490 490 LEU LEU A . n A 1 302 TRP 302 491 491 TRP TRP A . n A 1 303 SER 303 492 492 SER SER A . n A 1 304 VAL 304 493 493 VAL VAL A . n A 1 305 ASP 305 494 494 ASP ASP A . n A 1 306 HIS 306 495 495 HIS HIS A . n A 1 307 GLY 307 496 496 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 1UL 1 501 1 1UL INX A . C 3 HOH 1 601 1 HOH HOH A . C 3 HOH 2 602 2 HOH HOH A . C 3 HOH 3 603 3 HOH HOH A . C 3 HOH 4 604 4 HOH HOH A . C 3 HOH 5 605 5 HOH HOH A . C 3 HOH 6 606 6 HOH HOH A . C 3 HOH 7 607 7 HOH HOH A . C 3 HOH 8 608 8 HOH HOH A . C 3 HOH 9 609 9 HOH HOH A . C 3 HOH 10 610 10 HOH HOH A . C 3 HOH 11 611 11 HOH HOH A . C 3 HOH 12 612 12 HOH HOH A . C 3 HOH 13 613 13 HOH HOH A . C 3 HOH 14 614 14 HOH HOH A . C 3 HOH 15 615 15 HOH HOH A . C 3 HOH 16 616 16 HOH HOH A . C 3 HOH 17 617 17 HOH HOH A . C 3 HOH 18 618 18 HOH HOH A . C 3 HOH 19 619 19 HOH HOH A . C 3 HOH 20 620 20 HOH HOH A . C 3 HOH 21 621 21 HOH HOH A . C 3 HOH 22 622 22 HOH HOH A . C 3 HOH 23 623 23 HOH HOH A . C 3 HOH 24 624 24 HOH HOH A . C 3 HOH 25 625 25 HOH HOH A . C 3 HOH 26 626 26 HOH HOH A . C 3 HOH 27 627 27 HOH HOH A . C 3 HOH 28 628 28 HOH HOH A . C 3 HOH 29 629 29 HOH HOH A . C 3 HOH 30 630 30 HOH HOH A . C 3 HOH 31 631 31 HOH HOH A . C 3 HOH 32 632 32 HOH HOH A . C 3 HOH 33 633 33 HOH HOH A . C 3 HOH 34 634 34 HOH HOH A . C 3 HOH 35 635 35 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-07-03 2 'Structure model' 1 1 2013-07-31 3 'Structure model' 1 2 2013-08-07 4 'Structure model' 1 3 2017-07-26 5 'Structure model' 1 4 2017-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Refinement description' 5 4 'Structure model' 'Source and taxonomy' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_src_gen 2 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 3 4 'Structure model' software 4 5 'Structure model' software # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -8.585 -50.504 -8.096 0.5247 0.4422 0.2092 -0.0361 0.0073 0.0538 3.7779 7.3677 6.5293 4.0625 -1.5515 -5.8721 0.4772 -0.8134 -0.3739 1.1196 -0.0305 -0.0175 0.2322 -0.3257 -0.4466 'X-RAY DIFFRACTION' 2 ? refined -6.238 -44.247 -33.602 -0.1167 -0.0982 -0.1613 -0.0189 -0.0041 0.0552 3.5654 3.7535 2.1241 -0.8899 -0.2047 -0.2281 -0.0453 -0.0080 -0.3720 -0.0312 0.0561 -0.0339 0.2111 -0.0395 -0.0107 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 26 ? ? A 106 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 107 ? ? A 496 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOLREP phasing . ? 1 REFMAC refinement 5.2.0005 ? 2 XDS 'data reduction' . ? 3 XSCALE 'data scaling' . ? 4 # _pdbx_entry_details.entry_id 4L52 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'PROTEIN IS A CHIMERA COMPRISING THE KINASE DOMAIN OF TAK1 (UNP O43318 RESIDUES 31-303) AND RESIDUES 468-496 OF TAB1 (UNP Q15750).' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 LEU _pdbx_validate_rmsd_bond.auth_seq_id_1 102 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 LEU _pdbx_validate_rmsd_bond.auth_seq_id_2 102 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.271 _pdbx_validate_rmsd_bond.bond_target_value 1.514 _pdbx_validate_rmsd_bond.bond_deviation -0.243 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.037 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 39 ? ? -137.11 -159.83 2 1 TRP A 55 ? ? -160.16 114.13 3 1 ASN A 85 ? ? -172.20 106.16 4 1 ASN A 98 ? ? -51.26 -70.49 5 1 ARG A 155 ? A 79.45 -19.36 6 1 ARG A 155 ? B 80.85 -28.97 7 1 ASP A 475 ? ? 130.03 -28.42 8 1 HIS A 495 ? ? -112.65 -115.91 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ASN _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 98 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PRO _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 99 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 135.37 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 179 ? A ALA 154 2 1 Y 1 A CYS 180 ? A CYS 155 3 1 Y 1 A ASP 181 ? A ASP 156 4 1 Y 1 A ILE 182 ? A ILE 157 5 1 Y 1 A GLN 183 ? A GLN 158 6 1 Y 1 A THR 184 ? A THR 159 7 1 Y 1 A HIS 185 ? A HIS 160 8 1 Y 1 A MET 186 ? A MET 161 9 1 Y 1 A THR 187 ? A THR 162 10 1 Y 1 A ASN 188 ? A ASN 163 11 1 Y 1 A ASN 189 ? A ASN 164 12 1 Y 1 A LYS 190 ? A LYS 165 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(4-{4-[7-amino-2-(1,2,3-benzothiadiazol-7-yl)furo[2,3-c]pyridin-4-yl]-1H-pyrazol-1-yl}piperidin-1-yl)ethanone' 1UL 3 water HOH #