data_4M6G # _entry.id 4M6G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4M6G pdb_00004m6g 10.2210/pdb4m6g/pdb RCSB RCSB081525 ? ? WWPDB D_1000081525 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4M6H . unspecified PDB 4M6I . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4M6G _pdbx_database_status.recvd_initial_deposition_date 2013-08-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Prigozhin, D.M.' 1 ? 'Mavrici, D.' 2 ? 'Huizar, J.P.' 3 ? 'Vansell, H.J.' 4 ? 'Alber, T.' 5 ? 'TB Structural Genomics Consortium (TBSGC)' 6 ? # _citation.id primary _citation.title ;Structural and Biochemical Analyses of Mycobacterium tuberculosis N-Acetylmuramyl-L-alanine Amidase Rv3717 Point to a Role in Peptidoglycan Fragment Recycling. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 288 _citation.page_first 31549 _citation.page_last 31555 _citation.year 2013 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24019530 _citation.pdbx_database_id_DOI 10.1074/jbc.M113.510792 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Prigozhin, D.M.' 1 ? primary 'Mavrici, D.' 2 ? primary 'Huizar, J.P.' 3 ? primary 'Vansell, H.J.' 4 ? primary 'Alber, T.' 5 ? # _cell.entry_id 4M6G _cell.length_a 55.982 _cell.length_b 75.958 _cell.length_c 49.454 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4M6G _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidoglycan Amidase Rv3717' 23432.195 1 3.5.1.28 ? 'UNP residues 20-241' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn ALANINE 89.093 1 ? ? ? ? 4 non-polymer syn D-alpha-glutamine 146.144 1 ? ? ? ? 5 water nat water 18.015 66 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'N-acetylmuramoyl-L-alanine amidase Rv3717' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMTPANIAGMVVFIDPGHNGANDASIGRQVPTGRGGTKNCQASGTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSR GNDNALGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIG QDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQGQAR ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMTPANIAGMVVFIDPGHNGANDASIGRQVPTGRGGTKNCQASGTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSR GNDNALGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIG QDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQGQAR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 THR n 1 5 PRO n 1 6 ALA n 1 7 ASN n 1 8 ILE n 1 9 ALA n 1 10 GLY n 1 11 MET n 1 12 VAL n 1 13 VAL n 1 14 PHE n 1 15 ILE n 1 16 ASP n 1 17 PRO n 1 18 GLY n 1 19 HIS n 1 20 ASN n 1 21 GLY n 1 22 ALA n 1 23 ASN n 1 24 ASP n 1 25 ALA n 1 26 SER n 1 27 ILE n 1 28 GLY n 1 29 ARG n 1 30 GLN n 1 31 VAL n 1 32 PRO n 1 33 THR n 1 34 GLY n 1 35 ARG n 1 36 GLY n 1 37 GLY n 1 38 THR n 1 39 LYS n 1 40 ASN n 1 41 CYS n 1 42 GLN n 1 43 ALA n 1 44 SER n 1 45 GLY n 1 46 THR n 1 47 SER n 1 48 THR n 1 49 ASN n 1 50 SER n 1 51 GLY n 1 52 TYR n 1 53 PRO n 1 54 GLU n 1 55 HIS n 1 56 THR n 1 57 PHE n 1 58 THR n 1 59 TRP n 1 60 GLU n 1 61 THR n 1 62 GLY n 1 63 LEU n 1 64 ARG n 1 65 LEU n 1 66 ARG n 1 67 ALA n 1 68 ALA n 1 69 LEU n 1 70 ASN n 1 71 ALA n 1 72 LEU n 1 73 GLY n 1 74 VAL n 1 75 ARG n 1 76 THR n 1 77 ALA n 1 78 LEU n 1 79 SER n 1 80 ARG n 1 81 GLY n 1 82 ASN n 1 83 ASP n 1 84 ASN n 1 85 ALA n 1 86 LEU n 1 87 GLY n 1 88 PRO n 1 89 CYS n 1 90 VAL n 1 91 ASP n 1 92 GLU n 1 93 ARG n 1 94 ALA n 1 95 ASN n 1 96 MET n 1 97 ALA n 1 98 ASN n 1 99 ALA n 1 100 LEU n 1 101 ARG n 1 102 PRO n 1 103 ASN n 1 104 ALA n 1 105 ILE n 1 106 VAL n 1 107 SER n 1 108 LEU n 1 109 HIS n 1 110 ALA n 1 111 ASP n 1 112 GLY n 1 113 GLY n 1 114 PRO n 1 115 ALA n 1 116 SER n 1 117 GLY n 1 118 ARG n 1 119 GLY n 1 120 PHE n 1 121 HIS n 1 122 VAL n 1 123 ASN n 1 124 TYR n 1 125 SER n 1 126 ALA n 1 127 PRO n 1 128 PRO n 1 129 LEU n 1 130 ASN n 1 131 ALA n 1 132 ILE n 1 133 GLN n 1 134 ALA n 1 135 GLY n 1 136 PRO n 1 137 SER n 1 138 VAL n 1 139 GLN n 1 140 PHE n 1 141 ALA n 1 142 ARG n 1 143 ILE n 1 144 MET n 1 145 ARG n 1 146 ASP n 1 147 GLN n 1 148 LEU n 1 149 GLN n 1 150 ALA n 1 151 SER n 1 152 GLY n 1 153 ILE n 1 154 PRO n 1 155 LYS n 1 156 ALA n 1 157 ASN n 1 158 TYR n 1 159 ILE n 1 160 GLY n 1 161 GLN n 1 162 ASP n 1 163 GLY n 1 164 LEU n 1 165 TYR n 1 166 GLY n 1 167 ARG n 1 168 SER n 1 169 ASP n 1 170 LEU n 1 171 ALA n 1 172 GLY n 1 173 LEU n 1 174 ASN n 1 175 LEU n 1 176 ALA n 1 177 GLN n 1 178 TYR n 1 179 PRO n 1 180 SER n 1 181 ILE n 1 182 LEU n 1 183 VAL n 1 184 GLU n 1 185 LEU n 1 186 GLY n 1 187 ASN n 1 188 MET n 1 189 LYS n 1 190 ASN n 1 191 PRO n 1 192 ALA n 1 193 ASP n 1 194 SER n 1 195 ALA n 1 196 LEU n 1 197 MET n 1 198 GLU n 1 199 SER n 1 200 ALA n 1 201 GLU n 1 202 GLY n 1 203 ARG n 1 204 GLN n 1 205 LYS n 1 206 TYR n 1 207 ALA n 1 208 ASN n 1 209 ALA n 1 210 LEU n 1 211 VAL n 1 212 ARG n 1 213 GLY n 1 214 VAL n 1 215 ALA n 1 216 GLY n 1 217 PHE n 1 218 LEU n 1 219 ALA n 1 220 THR n 1 221 GLN n 1 222 GLY n 1 223 GLN n 1 224 ALA n 1 225 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 225 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Rv3717 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 25618 / H37Rv' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PEPAM_MYCTU _struct_ref.pdbx_db_accession I6Y4D2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TPANIAGMVVFIDPGHNGANDASIGRQVPTGRGGTKNCQASGTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGND NALGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDG LYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQGQAR ; _struct_ref.pdbx_align_begin 20 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4M6G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 225 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession I6Y4D2 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 241 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 20 _struct_ref_seq.pdbx_auth_seq_align_end 241 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4M6G GLY A 1 ? UNP I6Y4D2 ? ? 'expression tag' 17 1 1 4M6G HIS A 2 ? UNP I6Y4D2 ? ? 'expression tag' 18 2 1 4M6G MET A 3 ? UNP I6Y4D2 ? ? 'expression tag' 19 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZGL 'D-peptide linking' . D-alpha-glutamine Iso-D-glutamine 'C5 H10 N2 O3' 146.144 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 4M6G _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_percent_sol 44.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_details '200 mM sodium chloride, 100 mM TRIS, 25% PEG3350, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2011-04-07 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double flat crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.115869 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.115869 # _reflns.entry_id 4M6G _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.100 _reflns.number_obs 12482 _reflns.number_all ? _reflns.percent_possible_obs 97.6 _reflns.pdbx_Rmerge_I_obs 0.158 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 5.7 _reflns.B_iso_Wilson_estimate 22.440 _reflns.pdbx_redundancy 6.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.100 _reflns_shell.d_res_low 2.14 _reflns_shell.percent_possible_all 87.31 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.527 _reflns_shell.meanI_over_sigI_obs 3.27 _reflns_shell.pdbx_redundancy 5.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4M6G _refine.ls_number_reflns_obs 12431 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 45.065 _refine.ls_d_res_high 2.104 _refine.ls_percent_reflns_obs 97.37 _refine.ls_R_factor_obs 0.2082 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2063 _refine.ls_R_factor_R_free 0.2446 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.05 _refine.ls_number_reflns_R_free 628 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 3NE8' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.21 _refine.pdbx_overall_phase_error 29.27 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1580 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 66 _refine_hist.number_atoms_total 1648 _refine_hist.d_res_high 2.104 _refine_hist.d_res_low 45.065 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.008 ? ? 1614 ? 'X-RAY DIFFRACTION' f_angle_d 0.850 ? ? 2189 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 11.804 ? ? 583 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.046 ? ? 237 ? 'X-RAY DIFFRACTION' f_plane_restr 0.002 ? ? 300 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 2.104 2.3161 2682 0.2600 90.0 0.3427 . . 148 . . . . 'X-RAY DIFFRACTION' . 2.3161 2.6512 2953 0.2222 99.0 0.2857 . . 156 . . . . 'X-RAY DIFFRACTION' . 2.6512 3.3401 3010 0.2058 100.0 0.2335 . . 158 . . . . 'X-RAY DIFFRACTION' . 3.3401 45.0753 3158 0.1867 100.0 0.2115 . . 166 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4M6G _struct.title 'Structure of the Mycobacterium tuberculosis peptidoglycan amidase Rv3717 in complex with L-Alanine-iso-D-Glutamine reaction product' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4M6G _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, TB Structural Genomics Consortium, TBSGC, Zn Binding, HYDROLASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 24 ? GLY A 28 ? ASP A 40 GLY A 44 5 ? 5 HELX_P HELX_P2 2 PRO A 53 ? LEU A 72 ? PRO A 69 LEU A 88 1 ? 20 HELX_P HELX_P3 3 CYS A 89 ? LEU A 100 ? CYS A 105 LEU A 116 1 ? 12 HELX_P HELX_P4 4 ASN A 130 ? GLY A 135 ? ASN A 146 GLY A 151 1 ? 6 HELX_P HELX_P5 5 GLY A 135 ? SER A 151 ? GLY A 151 SER A 167 1 ? 17 HELX_P HELX_P6 6 LEU A 170 ? LEU A 175 ? LEU A 186 LEU A 191 1 ? 6 HELX_P HELX_P7 7 ASN A 190 ? GLU A 198 ? ASN A 206 GLU A 214 1 ? 9 HELX_P HELX_P8 8 SER A 199 ? ALA A 219 ? SER A 215 ALA A 235 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 41 SG ? ? ? 1_555 A CYS 89 SG ? ? A CYS 57 A CYS 105 1_555 ? ? ? ? ? ? ? 2.049 ? ? covale1 covale both ? D ALA . C ? ? ? 1_555 E ZGL . N ? ? A ALA 403 A ZGL 404 1_555 ? ? ? ? ? ? ? 1.417 ? ? metalc1 metalc ? ? A HIS 19 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 35 A ZN 401 1_555 ? ? ? ? ? ? ? 2.019 ? ? metalc2 metalc ? ? A GLU 54 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 70 A ZN 401 1_555 ? ? ? ? ? ? ? 1.980 ? ? metalc3 metalc ? ? A GLU 54 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 70 A ZN 401 1_555 ? ? ? ? ? ? ? 2.172 ? ? metalc4 metalc ? ? A HIS 55 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 71 A ZN 402 1_555 ? ? ? ? ? ? ? 2.040 ? ? metalc5 metalc ? ? A HIS 109 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 125 A ZN 401 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 D ALA . N ? ? A ZN 401 A ALA 403 1_555 ? ? ? ? ? ? ? 2.256 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 126 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 142 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 127 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 143 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.66 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 75 ? LEU A 78 ? ARG A 91 LEU A 94 A 2 VAL A 12 ? PRO A 17 ? VAL A 28 PRO A 33 A 3 ALA A 104 ? ASP A 111 ? ALA A 120 ASP A 127 A 4 SER A 180 ? ASN A 187 ? SER A 196 ASN A 203 A 5 HIS A 121 ? SER A 125 ? HIS A 137 SER A 141 A 6 LEU A 164 ? ARG A 167 ? LEU A 180 ARG A 183 B 1 GLN A 30 ? PRO A 32 ? GLN A 46 PRO A 48 B 2 THR A 38 ? ASN A 40 ? THR A 54 ASN A 56 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 77 ? O ALA A 93 N ILE A 15 ? N ILE A 31 A 2 3 N ASP A 16 ? N ASP A 32 O LEU A 108 ? O LEU A 124 A 3 4 N ASP A 111 ? N ASP A 127 O GLY A 186 ? O GLY A 202 A 4 5 O LEU A 182 ? O LEU A 198 N ASN A 123 ? N ASN A 139 A 5 6 N TYR A 124 ? N TYR A 140 O ARG A 167 ? O ARG A 183 B 1 2 N VAL A 31 ? N VAL A 47 O LYS A 39 ? O LYS A 55 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 401 ? 4 'BINDING SITE FOR RESIDUE ZN A 401' AC2 Software A ZN 402 ? 1 'BINDING SITE FOR RESIDUE ZN A 402' AC3 Software ? ? ? ? 14 'BINDING SITE FOR L-ALANINE-ISO-D-GLUTAMINE' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 19 ? HIS A 35 . ? 1_555 ? 2 AC1 4 GLU A 54 ? GLU A 70 . ? 1_555 ? 3 AC1 4 HIS A 109 ? HIS A 125 . ? 1_555 ? 4 AC1 4 ALA D . ? ALA A 403 . ? 1_555 ? 5 AC2 1 HIS A 55 ? HIS A 71 . ? 1_555 ? 6 AC3 14 HIS A 19 ? HIS A 35 . ? 1_555 ? 7 AC3 14 LYS A 39 ? LYS A 55 . ? 1_555 ? 8 AC3 14 GLN A 42 ? GLN A 58 . ? 1_555 ? 9 AC3 14 ALA A 43 ? ALA A 59 . ? 1_555 ? 10 AC3 14 GLU A 54 ? GLU A 70 . ? 1_555 ? 11 AC3 14 VAL A 90 ? VAL A 106 . ? 1_555 ? 12 AC3 14 HIS A 109 ? HIS A 125 . ? 1_555 ? 13 AC3 14 LEU A 170 ? LEU A 186 . ? 1_555 ? 14 AC3 14 ALA A 171 ? ALA A 187 . ? 1_555 ? 15 AC3 14 GLY A 172 ? GLY A 188 . ? 1_555 ? 16 AC3 14 ZN B . ? ZN A 401 . ? 1_555 ? 17 AC3 14 HOH F . ? HOH A 522 . ? 1_555 ? 18 AC3 14 HOH F . ? HOH A 512 . ? 1_555 ? 19 AC3 14 HOH F . ? HOH A 541 . ? 1_555 ? # _database_PDB_matrix.entry_id 4M6G _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4M6G _atom_sites.fract_transf_matrix[1][1] 0.017863 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013165 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020221 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 17 ? ? ? A . n A 1 2 HIS 2 18 ? ? ? A . n A 1 3 MET 3 19 ? ? ? A . n A 1 4 THR 4 20 ? ? ? A . n A 1 5 PRO 5 21 ? ? ? A . n A 1 6 ALA 6 22 ? ? ? A . n A 1 7 ASN 7 23 ? ? ? A . n A 1 8 ILE 8 24 24 ILE ILE A . n A 1 9 ALA 9 25 25 ALA ALA A . n A 1 10 GLY 10 26 26 GLY GLY A . n A 1 11 MET 11 27 27 MET MET A . n A 1 12 VAL 12 28 28 VAL VAL A . n A 1 13 VAL 13 29 29 VAL VAL A . n A 1 14 PHE 14 30 30 PHE PHE A . n A 1 15 ILE 15 31 31 ILE ILE A . n A 1 16 ASP 16 32 32 ASP ASP A . n A 1 17 PRO 17 33 33 PRO PRO A . n A 1 18 GLY 18 34 34 GLY GLY A . n A 1 19 HIS 19 35 35 HIS HIS A . n A 1 20 ASN 20 36 36 ASN ASN A . n A 1 21 GLY 21 37 37 GLY GLY A . n A 1 22 ALA 22 38 38 ALA ALA A . n A 1 23 ASN 23 39 39 ASN ASN A . n A 1 24 ASP 24 40 40 ASP ASP A . n A 1 25 ALA 25 41 41 ALA ALA A . n A 1 26 SER 26 42 42 SER SER A . n A 1 27 ILE 27 43 43 ILE ILE A . n A 1 28 GLY 28 44 44 GLY GLY A . n A 1 29 ARG 29 45 45 ARG ARG A . n A 1 30 GLN 30 46 46 GLN GLN A . n A 1 31 VAL 31 47 47 VAL VAL A . n A 1 32 PRO 32 48 48 PRO PRO A . n A 1 33 THR 33 49 49 THR THR A . n A 1 34 GLY 34 50 50 GLY GLY A . n A 1 35 ARG 35 51 51 ARG ARG A . n A 1 36 GLY 36 52 52 GLY GLY A . n A 1 37 GLY 37 53 53 GLY GLY A . n A 1 38 THR 38 54 54 THR THR A . n A 1 39 LYS 39 55 55 LYS LYS A . n A 1 40 ASN 40 56 56 ASN ASN A . n A 1 41 CYS 41 57 57 CYS CYS A . n A 1 42 GLN 42 58 58 GLN GLN A . n A 1 43 ALA 43 59 59 ALA ALA A . n A 1 44 SER 44 60 60 SER SER A . n A 1 45 GLY 45 61 61 GLY GLY A . n A 1 46 THR 46 62 62 THR THR A . n A 1 47 SER 47 63 63 SER SER A . n A 1 48 THR 48 64 64 THR THR A . n A 1 49 ASN 49 65 65 ASN ASN A . n A 1 50 SER 50 66 66 SER SER A . n A 1 51 GLY 51 67 67 GLY GLY A . n A 1 52 TYR 52 68 68 TYR TYR A . n A 1 53 PRO 53 69 69 PRO PRO A . n A 1 54 GLU 54 70 70 GLU GLU A . n A 1 55 HIS 55 71 71 HIS HIS A . n A 1 56 THR 56 72 72 THR THR A . n A 1 57 PHE 57 73 73 PHE PHE A . n A 1 58 THR 58 74 74 THR THR A . n A 1 59 TRP 59 75 75 TRP TRP A . n A 1 60 GLU 60 76 76 GLU GLU A . n A 1 61 THR 61 77 77 THR THR A . n A 1 62 GLY 62 78 78 GLY GLY A . n A 1 63 LEU 63 79 79 LEU LEU A . n A 1 64 ARG 64 80 80 ARG ARG A . n A 1 65 LEU 65 81 81 LEU LEU A . n A 1 66 ARG 66 82 82 ARG ARG A . n A 1 67 ALA 67 83 83 ALA ALA A . n A 1 68 ALA 68 84 84 ALA ALA A . n A 1 69 LEU 69 85 85 LEU LEU A . n A 1 70 ASN 70 86 86 ASN ASN A . n A 1 71 ALA 71 87 87 ALA ALA A . n A 1 72 LEU 72 88 88 LEU LEU A . n A 1 73 GLY 73 89 89 GLY GLY A . n A 1 74 VAL 74 90 90 VAL VAL A . n A 1 75 ARG 75 91 91 ARG ARG A . n A 1 76 THR 76 92 92 THR THR A . n A 1 77 ALA 77 93 93 ALA ALA A . n A 1 78 LEU 78 94 94 LEU LEU A . n A 1 79 SER 79 95 95 SER SER A . n A 1 80 ARG 80 96 96 ARG ARG A . n A 1 81 GLY 81 97 97 GLY GLY A . n A 1 82 ASN 82 98 98 ASN ASN A . n A 1 83 ASP 83 99 99 ASP ASP A . n A 1 84 ASN 84 100 100 ASN ASN A . n A 1 85 ALA 85 101 101 ALA ALA A . n A 1 86 LEU 86 102 102 LEU LEU A . n A 1 87 GLY 87 103 103 GLY GLY A . n A 1 88 PRO 88 104 104 PRO PRO A . n A 1 89 CYS 89 105 105 CYS CYS A . n A 1 90 VAL 90 106 106 VAL VAL A . n A 1 91 ASP 91 107 107 ASP ASP A . n A 1 92 GLU 92 108 108 GLU GLU A . n A 1 93 ARG 93 109 109 ARG ARG A . n A 1 94 ALA 94 110 110 ALA ALA A . n A 1 95 ASN 95 111 111 ASN ASN A . n A 1 96 MET 96 112 112 MET MET A . n A 1 97 ALA 97 113 113 ALA ALA A . n A 1 98 ASN 98 114 114 ASN ASN A . n A 1 99 ALA 99 115 115 ALA ALA A . n A 1 100 LEU 100 116 116 LEU LEU A . n A 1 101 ARG 101 117 117 ARG ARG A . n A 1 102 PRO 102 118 118 PRO PRO A . n A 1 103 ASN 103 119 119 ASN ASN A . n A 1 104 ALA 104 120 120 ALA ALA A . n A 1 105 ILE 105 121 121 ILE ILE A . n A 1 106 VAL 106 122 122 VAL VAL A . n A 1 107 SER 107 123 123 SER SER A . n A 1 108 LEU 108 124 124 LEU LEU A . n A 1 109 HIS 109 125 125 HIS HIS A . n A 1 110 ALA 110 126 126 ALA ALA A . n A 1 111 ASP 111 127 127 ASP ASP A . n A 1 112 GLY 112 128 128 GLY GLY A . n A 1 113 GLY 113 129 129 GLY GLY A . n A 1 114 PRO 114 130 130 PRO PRO A . n A 1 115 ALA 115 131 131 ALA ALA A . n A 1 116 SER 116 132 132 SER SER A . n A 1 117 GLY 117 133 133 GLY GLY A . n A 1 118 ARG 118 134 134 ARG ARG A . n A 1 119 GLY 119 135 135 GLY GLY A . n A 1 120 PHE 120 136 136 PHE PHE A . n A 1 121 HIS 121 137 137 HIS HIS A . n A 1 122 VAL 122 138 138 VAL VAL A . n A 1 123 ASN 123 139 139 ASN ASN A . n A 1 124 TYR 124 140 140 TYR TYR A . n A 1 125 SER 125 141 141 SER SER A . n A 1 126 ALA 126 142 142 ALA ALA A . n A 1 127 PRO 127 143 143 PRO PRO A . n A 1 128 PRO 128 144 144 PRO PRO A . n A 1 129 LEU 129 145 145 LEU LEU A . n A 1 130 ASN 130 146 146 ASN ASN A . n A 1 131 ALA 131 147 147 ALA ALA A . n A 1 132 ILE 132 148 148 ILE ILE A . n A 1 133 GLN 133 149 149 GLN GLN A . n A 1 134 ALA 134 150 150 ALA ALA A . n A 1 135 GLY 135 151 151 GLY GLY A . n A 1 136 PRO 136 152 152 PRO PRO A . n A 1 137 SER 137 153 153 SER SER A . n A 1 138 VAL 138 154 154 VAL VAL A . n A 1 139 GLN 139 155 155 GLN GLN A . n A 1 140 PHE 140 156 156 PHE PHE A . n A 1 141 ALA 141 157 157 ALA ALA A . n A 1 142 ARG 142 158 158 ARG ARG A . n A 1 143 ILE 143 159 159 ILE ILE A . n A 1 144 MET 144 160 160 MET MET A . n A 1 145 ARG 145 161 161 ARG ARG A . n A 1 146 ASP 146 162 162 ASP ASP A . n A 1 147 GLN 147 163 163 GLN GLN A . n A 1 148 LEU 148 164 164 LEU LEU A . n A 1 149 GLN 149 165 165 GLN GLN A . n A 1 150 ALA 150 166 166 ALA ALA A . n A 1 151 SER 151 167 167 SER SER A . n A 1 152 GLY 152 168 168 GLY GLY A . n A 1 153 ILE 153 169 169 ILE ILE A . n A 1 154 PRO 154 170 170 PRO PRO A . n A 1 155 LYS 155 171 171 LYS LYS A . n A 1 156 ALA 156 172 172 ALA ALA A . n A 1 157 ASN 157 173 173 ASN ASN A . n A 1 158 TYR 158 174 174 TYR TYR A . n A 1 159 ILE 159 175 175 ILE ILE A . n A 1 160 GLY 160 176 176 GLY GLY A . n A 1 161 GLN 161 177 177 GLN GLN A . n A 1 162 ASP 162 178 178 ASP ASP A . n A 1 163 GLY 163 179 179 GLY GLY A . n A 1 164 LEU 164 180 180 LEU LEU A . n A 1 165 TYR 165 181 181 TYR TYR A . n A 1 166 GLY 166 182 182 GLY GLY A . n A 1 167 ARG 167 183 183 ARG ARG A . n A 1 168 SER 168 184 184 SER SER A . n A 1 169 ASP 169 185 185 ASP ASP A . n A 1 170 LEU 170 186 186 LEU LEU A . n A 1 171 ALA 171 187 187 ALA ALA A . n A 1 172 GLY 172 188 188 GLY GLY A . n A 1 173 LEU 173 189 189 LEU LEU A . n A 1 174 ASN 174 190 190 ASN ASN A . n A 1 175 LEU 175 191 191 LEU LEU A . n A 1 176 ALA 176 192 192 ALA ALA A . n A 1 177 GLN 177 193 193 GLN GLN A . n A 1 178 TYR 178 194 194 TYR TYR A . n A 1 179 PRO 179 195 195 PRO PRO A . n A 1 180 SER 180 196 196 SER SER A . n A 1 181 ILE 181 197 197 ILE ILE A . n A 1 182 LEU 182 198 198 LEU LEU A . n A 1 183 VAL 183 199 199 VAL VAL A . n A 1 184 GLU 184 200 200 GLU GLU A . n A 1 185 LEU 185 201 201 LEU LEU A . n A 1 186 GLY 186 202 202 GLY GLY A . n A 1 187 ASN 187 203 203 ASN ASN A . n A 1 188 MET 188 204 204 MET MET A . n A 1 189 LYS 189 205 205 LYS LYS A . n A 1 190 ASN 190 206 206 ASN ASN A . n A 1 191 PRO 191 207 207 PRO PRO A . n A 1 192 ALA 192 208 208 ALA ALA A . n A 1 193 ASP 193 209 209 ASP ASP A . n A 1 194 SER 194 210 210 SER SER A . n A 1 195 ALA 195 211 211 ALA ALA A . n A 1 196 LEU 196 212 212 LEU LEU A . n A 1 197 MET 197 213 213 MET MET A . n A 1 198 GLU 198 214 214 GLU GLU A . n A 1 199 SER 199 215 215 SER SER A . n A 1 200 ALA 200 216 216 ALA ALA A . n A 1 201 GLU 201 217 217 GLU GLU A . n A 1 202 GLY 202 218 218 GLY GLY A . n A 1 203 ARG 203 219 219 ARG ARG A . n A 1 204 GLN 204 220 220 GLN GLN A . n A 1 205 LYS 205 221 221 LYS LYS A . n A 1 206 TYR 206 222 222 TYR TYR A . n A 1 207 ALA 207 223 223 ALA ALA A . n A 1 208 ASN 208 224 224 ASN ASN A . n A 1 209 ALA 209 225 225 ALA ALA A . n A 1 210 LEU 210 226 226 LEU LEU A . n A 1 211 VAL 211 227 227 VAL VAL A . n A 1 212 ARG 212 228 228 ARG ARG A . n A 1 213 GLY 213 229 229 GLY GLY A . n A 1 214 VAL 214 230 230 VAL VAL A . n A 1 215 ALA 215 231 231 ALA ALA A . n A 1 216 GLY 216 232 232 GLY GLY A . n A 1 217 PHE 217 233 233 PHE PHE A . n A 1 218 LEU 218 234 234 LEU LEU A . n A 1 219 ALA 219 235 235 ALA ALA A . n A 1 220 THR 220 236 236 THR THR A . n A 1 221 GLN 221 237 237 GLN GLN A . n A 1 222 GLY 222 238 ? ? ? A . n A 1 223 GLN 223 239 ? ? ? A . n A 1 224 ALA 224 240 ? ? ? A . n A 1 225 ARG 225 241 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'TB Structural Genomics Consortium' _pdbx_SG_project.initial_of_center TBSGC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 401 ZN ZN A . C 2 ZN 1 402 402 ZN ZN A . D 3 ALA 1 403 403 ALA ADG A . E 4 ZGL 1 404 403 ZGL ADG A . F 5 HOH 1 501 19 HOH HOH A . F 5 HOH 2 502 65 HOH HOH A . F 5 HOH 3 503 20 HOH HOH A . F 5 HOH 4 504 14 HOH HOH A . F 5 HOH 5 505 24 HOH HOH A . F 5 HOH 6 506 48 HOH HOH A . F 5 HOH 7 507 26 HOH HOH A . F 5 HOH 8 508 18 HOH HOH A . F 5 HOH 9 509 12 HOH HOH A . F 5 HOH 10 510 33 HOH HOH A . F 5 HOH 11 511 15 HOH HOH A . F 5 HOH 12 512 29 HOH HOH A . F 5 HOH 13 513 32 HOH HOH A . F 5 HOH 14 514 2 HOH HOH A . F 5 HOH 15 515 4 HOH HOH A . F 5 HOH 16 516 6 HOH HOH A . F 5 HOH 17 517 7 HOH HOH A . F 5 HOH 18 518 27 HOH HOH A . F 5 HOH 19 519 17 HOH HOH A . F 5 HOH 20 520 16 HOH HOH A . F 5 HOH 21 521 56 HOH HOH A . F 5 HOH 22 522 10 HOH HOH A . F 5 HOH 23 523 1 HOH HOH A . F 5 HOH 24 524 9 HOH HOH A . F 5 HOH 25 525 22 HOH HOH A . F 5 HOH 26 526 21 HOH HOH A . F 5 HOH 27 527 57 HOH HOH A . F 5 HOH 28 528 8 HOH HOH A . F 5 HOH 29 529 25 HOH HOH A . F 5 HOH 30 530 39 HOH HOH A . F 5 HOH 31 531 46 HOH HOH A . F 5 HOH 32 532 30 HOH HOH A . F 5 HOH 33 533 52 HOH HOH A . F 5 HOH 34 534 11 HOH HOH A . F 5 HOH 35 535 58 HOH HOH A . F 5 HOH 36 536 13 HOH HOH A . F 5 HOH 37 537 62 HOH HOH A . F 5 HOH 38 538 47 HOH HOH A . F 5 HOH 39 539 42 HOH HOH A . F 5 HOH 40 540 38 HOH HOH A . F 5 HOH 41 541 5 HOH HOH A . F 5 HOH 42 542 60 HOH HOH A . F 5 HOH 43 543 37 HOH HOH A . F 5 HOH 44 544 28 HOH HOH A . F 5 HOH 45 545 59 HOH HOH A . F 5 HOH 46 546 31 HOH HOH A . F 5 HOH 47 547 23 HOH HOH A . F 5 HOH 48 548 55 HOH HOH A . F 5 HOH 49 549 40 HOH HOH A . F 5 HOH 50 550 64 HOH HOH A . F 5 HOH 51 551 63 HOH HOH A . F 5 HOH 52 552 36 HOH HOH A . F 5 HOH 53 553 44 HOH HOH A . F 5 HOH 54 554 35 HOH HOH A . F 5 HOH 55 555 41 HOH HOH A . F 5 HOH 56 556 50 HOH HOH A . F 5 HOH 57 557 3 HOH HOH A . F 5 HOH 58 558 49 HOH HOH A . F 5 HOH 59 559 51 HOH HOH A . F 5 HOH 60 560 54 HOH HOH A . F 5 HOH 61 561 66 HOH HOH A . F 5 HOH 62 562 34 HOH HOH A . F 5 HOH 63 563 61 HOH HOH A . F 5 HOH 64 564 43 HOH HOH A . F 5 HOH 65 565 45 HOH HOH A . F 5 HOH 66 566 53 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 80 ? 1 MORE -21 ? 1 'SSA (A^2)' 8580 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 19 ? A HIS 35 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OE1 ? A GLU 54 ? A GLU 70 ? 1_555 114.2 ? 2 NE2 ? A HIS 19 ? A HIS 35 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OE2 ? A GLU 54 ? A GLU 70 ? 1_555 74.9 ? 3 OE1 ? A GLU 54 ? A GLU 70 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OE2 ? A GLU 54 ? A GLU 70 ? 1_555 61.9 ? 4 NE2 ? A HIS 19 ? A HIS 35 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 109 ? A HIS 125 ? 1_555 107.2 ? 5 OE1 ? A GLU 54 ? A GLU 70 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 109 ? A HIS 125 ? 1_555 88.1 ? 6 OE2 ? A GLU 54 ? A GLU 70 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 109 ? A HIS 125 ? 1_555 146.1 ? 7 NE2 ? A HIS 19 ? A HIS 35 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 N ? D ALA . ? A ALA 403 ? 1_555 96.3 ? 8 OE1 ? A GLU 54 ? A GLU 70 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 N ? D ALA . ? A ALA 403 ? 1_555 129.1 ? 9 OE2 ? A GLU 54 ? A GLU 70 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 N ? D ALA . ? A ALA 403 ? 1_555 91.0 ? 10 ND1 ? A HIS 109 ? A HIS 125 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 N ? D ALA . ? A ALA 403 ? 1_555 121.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-09-18 2 'Structure model' 1 1 2013-09-25 3 'Structure model' 1 2 2013-11-20 4 'Structure model' 2 0 2018-05-16 5 'Structure model' 2 1 2023-09-20 6 'Structure model' 3 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Polymer sequence' 8 4 'Structure model' 'Source and taxonomy' 9 4 'Structure model' 'Structure summary' 10 5 'Structure model' 'Data collection' 11 5 'Structure model' 'Database references' 12 5 'Structure model' 'Derived calculations' 13 5 'Structure model' 'Refinement description' 14 6 'Structure model' 'Atomic model' 15 6 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' entity 3 4 'Structure model' entity_name_com 4 4 'Structure model' entity_poly 5 4 'Structure model' entity_poly_seq 6 4 'Structure model' entity_src_gen 7 4 'Structure model' pdbx_entity_nonpoly 8 4 'Structure model' pdbx_nonpoly_scheme 9 4 'Structure model' pdbx_poly_seq_scheme 10 4 'Structure model' pdbx_struct_assembly 11 4 'Structure model' pdbx_struct_assembly_prop 12 4 'Structure model' pdbx_struct_conn_angle 13 4 'Structure model' struct_asym 14 4 'Structure model' struct_conn 15 4 'Structure model' struct_ref 16 4 'Structure model' struct_ref_seq 17 4 'Structure model' struct_ref_seq_dif 18 4 'Structure model' struct_site 19 4 'Structure model' struct_site_gen 20 5 'Structure model' chem_comp_atom 21 5 'Structure model' chem_comp_bond 22 5 'Structure model' database_2 23 5 'Structure model' pdbx_initial_refinement_model 24 5 'Structure model' pdbx_struct_conn_angle 25 5 'Structure model' struct_conn 26 5 'Structure model' struct_site 27 6 'Structure model' atom_site 28 6 'Structure model' chem_comp_atom 29 6 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_asym_id' 6 4 'Structure model' '_atom_site.auth_atom_id' 7 4 'Structure model' '_atom_site.auth_comp_id' 8 4 'Structure model' '_atom_site.auth_seq_id' 9 4 'Structure model' '_atom_site.group_PDB' 10 4 'Structure model' '_atom_site.label_asym_id' 11 4 'Structure model' '_atom_site.label_atom_id' 12 4 'Structure model' '_atom_site.label_comp_id' 13 4 'Structure model' '_atom_site.label_entity_id' 14 4 'Structure model' '_atom_site.label_seq_id' 15 4 'Structure model' '_atom_site.occupancy' 16 4 'Structure model' '_atom_site.type_symbol' 17 4 'Structure model' '_entity_name_com.name' 18 4 'Structure model' '_entity_src_gen.gene_src_strain' 19 4 'Structure model' '_entity_src_gen.pdbx_beg_seq_num' 20 4 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 21 4 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 22 4 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 23 4 'Structure model' '_entity_src_gen.pdbx_seq_type' 24 4 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 25 4 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 26 4 'Structure model' '_pdbx_struct_assembly_prop.value' 27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 32 4 'Structure model' '_struct_asym.entity_id' 33 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 34 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 35 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 36 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 37 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 38 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 39 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 40 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 41 4 'Structure model' '_struct_ref_seq_dif.details' 42 4 'Structure model' '_struct_ref_seq_dif.pdbx_seq_db_accession_code' 43 4 'Structure model' '_struct_site.details' 44 4 'Structure model' '_struct_site_gen.auth_asym_id' 45 4 'Structure model' '_struct_site_gen.auth_seq_id' 46 4 'Structure model' '_struct_site_gen.label_asym_id' 47 4 'Structure model' '_struct_site_gen.label_seq_id' 48 5 'Structure model' '_database_2.pdbx_DOI' 49 5 'Structure model' '_database_2.pdbx_database_accession' 50 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 51 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 52 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 53 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 54 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 55 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 56 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 57 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 58 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 59 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 60 5 'Structure model' '_pdbx_struct_conn_angle.value' 61 5 'Structure model' '_struct_conn.pdbx_dist_value' 62 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 63 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 64 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 65 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 66 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 67 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 68 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 69 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 70 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 71 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 72 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 73 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 74 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 75 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 76 5 'Structure model' '_struct_site.pdbx_auth_seq_id' 77 6 'Structure model' '_atom_site.auth_atom_id' 78 6 'Structure model' '_atom_site.label_atom_id' 79 6 'Structure model' '_chem_comp_atom.atom_id' 80 6 'Structure model' '_chem_comp_bond.atom_id_1' 81 6 'Structure model' '_chem_comp_bond.atom_id_2' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language Blu-Ice 'data collection' . ? 1 ? ? ? ? PHENIX 'model building' . ? 2 ? ? ? ? PHENIX refinement . ? 3 ? ? ? ? HKL-2000 'data reduction' . ? 4 ? ? ? ? HKL-2000 'data scaling' . ? 5 ? ? ? ? PHENIX phasing . ? 6 ? ? ? ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 35 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 70.32 _pdbx_validate_torsion.psi 179.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 17 ? A GLY 1 2 1 Y 1 A HIS 18 ? A HIS 2 3 1 Y 1 A MET 19 ? A MET 3 4 1 Y 1 A THR 20 ? A THR 4 5 1 Y 1 A PRO 21 ? A PRO 5 6 1 Y 1 A ALA 22 ? A ALA 6 7 1 Y 1 A ASN 23 ? A ASN 7 8 1 Y 1 A GLY 238 ? A GLY 222 9 1 Y 1 A GLN 239 ? A GLN 223 10 1 Y 1 A ALA 240 ? A ALA 224 11 1 Y 1 A ARG 241 ? A ARG 225 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZGL CD C N N 391 ZGL N N N N 392 ZGL O2 O N N 393 ZGL N1 N N N 394 ZGL CA C N R 395 ZGL CB C N N 396 ZGL C C N N 397 ZGL CG C N N 398 ZGL OXT O N N 399 ZGL O O N N 400 ZGL H H N N 401 ZGL H2 H N N 402 ZGL HN1 H N N 403 ZGL HN1A H N N 404 ZGL HA H N N 405 ZGL HB H N N 406 ZGL HBA H N N 407 ZGL HG H N N 408 ZGL HGA H N N 409 ZGL HXT H N N 410 ZN ZN ZN N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 ZGL N1 CD sing N N 376 ZGL CD O2 doub N N 377 ZGL CD CA sing N N 378 ZGL N CA sing N N 379 ZGL N H sing N N 380 ZGL N H2 sing N N 381 ZGL N1 HN1 sing N N 382 ZGL N1 HN1A sing N N 383 ZGL CB CA sing N N 384 ZGL CA HA sing N N 385 ZGL CB CG sing N N 386 ZGL CB HB sing N N 387 ZGL CB HBA sing N N 388 ZGL CG C sing N N 389 ZGL O C doub N N 390 ZGL C OXT sing N N 391 ZGL CG HG sing N N 392 ZGL CG HGA sing N N 393 ZGL OXT HXT sing N N 394 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 ALANINE ALA 4 D-alpha-glutamine ZGL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3NE8 _pdbx_initial_refinement_model.details 'PDB ENTRY 3NE8' #