data_4M7M # _entry.id 4M7M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4M7M RCSB RCSB081567 WWPDB D_1000081567 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2G7B . unspecified PDB 2G78 . unspecified PDB 2FR3 . unspecified PDB 3F8A . unspecified PDB 4EXZ . unspecified PDB 4EEJ . unspecified PDB 4EFG . unspecified PDB 3FEP . unspecified PDB 4I9R . unspecified PDB 4I9S . unspecified PDB 4M6S . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4M7M _pdbx_database_status.recvd_initial_deposition_date 2013-08-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nosrati, M.' 1 'Geiger, J.H.' 2 # _citation.id primary _citation.title 'Rational Design of a Colorimetric pH Sensor from a Soluble Retinoic Acid Chaperone.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 135 _citation.page_first 16111 _citation.page_last 16119 _citation.year 2013 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24059243 _citation.pdbx_database_id_DOI 10.1021/ja404900k # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Berbasova, T.' 1 primary 'Nosrati, M.' 2 primary 'Vasileiou, C.' 3 primary 'Wang, W.' 4 primary 'Lee, K.S.' 5 primary 'Yapici, I.' 6 primary 'Geiger, J.H.' 7 primary 'Borhan, B.' 8 # _cell.entry_id 4M7M _cell.length_a 56.457 _cell.length_b 56.457 _cell.length_c 109.775 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4M7M _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cellular retinoic acid-binding protein 2' 15650.901 1 ? R111K:R132Q:Y134F:T54V:R59W:A32W ? ? 2 non-polymer syn RETINAL 284.436 1 ? ? ? ? 3 water nat water 18.015 9 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cellular retinoic acid-binding protein II, CRABP-II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIWVAAASKPAVEIKQEGDTFYIKVSTTVWTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE ; _entity_poly.pdbx_seq_one_letter_code_can ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIWVAAASKPAVEIKQEGDTFYIKVSTTVWTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ASN n 1 3 PHE n 1 4 SER n 1 5 GLY n 1 6 ASN n 1 7 TRP n 1 8 LYS n 1 9 ILE n 1 10 ILE n 1 11 ARG n 1 12 SER n 1 13 GLU n 1 14 ASN n 1 15 PHE n 1 16 GLU n 1 17 GLU n 1 18 LEU n 1 19 LEU n 1 20 LYS n 1 21 VAL n 1 22 LEU n 1 23 GLY n 1 24 VAL n 1 25 ASN n 1 26 VAL n 1 27 MET n 1 28 LEU n 1 29 ARG n 1 30 LYS n 1 31 ILE n 1 32 TRP n 1 33 VAL n 1 34 ALA n 1 35 ALA n 1 36 ALA n 1 37 SER n 1 38 LYS n 1 39 PRO n 1 40 ALA n 1 41 VAL n 1 42 GLU n 1 43 ILE n 1 44 LYS n 1 45 GLN n 1 46 GLU n 1 47 GLY n 1 48 ASP n 1 49 THR n 1 50 PHE n 1 51 TYR n 1 52 ILE n 1 53 LYS n 1 54 VAL n 1 55 SER n 1 56 THR n 1 57 THR n 1 58 VAL n 1 59 TRP n 1 60 THR n 1 61 THR n 1 62 GLU n 1 63 ILE n 1 64 ASN n 1 65 PHE n 1 66 LYS n 1 67 VAL n 1 68 GLY n 1 69 GLU n 1 70 GLU n 1 71 PHE n 1 72 GLU n 1 73 GLU n 1 74 GLN n 1 75 THR n 1 76 VAL n 1 77 ASP n 1 78 GLY n 1 79 ARG n 1 80 PRO n 1 81 CYS n 1 82 LYS n 1 83 SER n 1 84 LEU n 1 85 VAL n 1 86 LYS n 1 87 TRP n 1 88 GLU n 1 89 SER n 1 90 GLU n 1 91 ASN n 1 92 LYS n 1 93 MET n 1 94 VAL n 1 95 CYS n 1 96 GLU n 1 97 GLN n 1 98 LYS n 1 99 LEU n 1 100 LEU n 1 101 LYS n 1 102 GLY n 1 103 GLU n 1 104 GLY n 1 105 PRO n 1 106 LYS n 1 107 THR n 1 108 SER n 1 109 TRP n 1 110 THR n 1 111 LYS n 1 112 GLU n 1 113 LEU n 1 114 THR n 1 115 ASN n 1 116 ASP n 1 117 GLY n 1 118 GLU n 1 119 LEU n 1 120 ILE n 1 121 LEU n 1 122 THR n 1 123 MET n 1 124 THR n 1 125 ALA n 1 126 ASP n 1 127 ASP n 1 128 VAL n 1 129 VAL n 1 130 CYS n 1 131 THR n 1 132 GLN n 1 133 VAL n 1 134 PHE n 1 135 VAL n 1 136 ARG n 1 137 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CRABP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET17b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RABP2_HUMAN _struct_ref.pdbx_db_accession P29373 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4M7M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29373 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 137 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4M7M TRP A 32 ? UNP P29373 ALA 33 'ENGINEERED MUTATION' 32 1 1 4M7M VAL A 54 ? UNP P29373 THR 55 'ENGINEERED MUTATION' 54 2 1 4M7M TRP A 59 ? UNP P29373 ARG 60 'ENGINEERED MUTATION' 59 3 1 4M7M LYS A 111 ? UNP P29373 ARG 112 'ENGINEERED MUTATION' 111 4 1 4M7M GLN A 132 ? UNP P29373 ARG 133 'ENGINEERED MUTATION' 132 5 1 4M7M PHE A 134 ? UNP P29373 TYR 135 'ENGINEERED MUTATION' 134 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4M7M _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.23 _exptl_crystal.density_percent_sol 61.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1 M malonate, pH 7.0, 12% PEG3350, VAPOR DIFFUSION, SITTING DROP, temperature 277K' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0782 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0782 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4M7M _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 48.893 _reflns.d_resolution_high 2.528 _reflns.number_obs 7165 _reflns.number_all 7211 _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.528 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4M7M _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 6808 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.663 _refine.ls_d_res_high 2.571 _refine.ls_percent_reflns_obs 99.44 _refine.ls_R_factor_obs 0.2054 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2030 _refine.ls_R_factor_R_free 0.2526 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.70 _refine.ls_number_reflns_R_free 320 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -1.1236 _refine.aniso_B[2][2] -1.1236 _refine.aniso_B[3][3] 2.2472 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.328 _refine.solvent_model_param_bsol 58.926 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.98 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.72 _refine.pdbx_overall_phase_error 30.46 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1062 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 1091 _refine_hist.d_res_high 2.571 _refine_hist.d_res_low 44.663 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 1133 'X-RAY DIFFRACTION' ? f_angle_d 1.334 ? ? 1561 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 17.126 ? ? 415 'X-RAY DIFFRACTION' ? f_chiral_restr 0.082 ? ? 178 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 203 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.571 3.2384 3150 0.2604 99.00 0.3193 . . 162 . . . . 'X-RAY DIFFRACTION' . 3.2384 44.6701 3338 0.1892 100.00 0.2340 . . 158 . . . . # _struct.entry_id 4M7M _struct.title ;Crystal structure of the R111K:R132Q:Y134F:T54V:R59W:A32W mutant of the Cellular Retinoic Acid Binding Protein Type II in complex with All-Trans Retinal at 2.57 Angstrom Resolution ; _struct.pdbx_descriptor 'Cellular retinoic acid-binding protein 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4M7M _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'protein engineering, wavelength regulation, pH-sensing, Retinylidene PSB, Iminium, TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 14 ? GLY A 23 ? ASN A 14 GLY A 23 1 ? 10 HELX_P HELX_P2 2 ASN A 25 ? SER A 37 ? ASN A 25 SER A 37 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 111 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id RET _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C15 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 111 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id RET _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.255 _struct_conn.pdbx_value_order doub # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 10 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 A 2 THR A 49 ? SER A 55 ? THR A 49 SER A 55 A 3 ALA A 40 ? GLN A 45 ? ALA A 40 GLN A 45 A 4 GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 A 5 VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 A 6 LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 A 7 THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 A 8 LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 A 9 PRO A 80 ? TRP A 87 ? PRO A 80 TRP A 87 A 10 PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 65 ? O PHE A 65 N PHE A 50 ? N PHE A 50 A 2 3 O LYS A 53 ? O LYS A 53 N GLU A 42 ? N GLU A 42 A 3 4 O VAL A 41 ? O VAL A 41 N TRP A 7 ? N TRP A 7 A 4 5 N GLU A 13 ? N GLU A 13 O THR A 131 ? O THR A 131 A 5 6 O PHE A 134 ? O PHE A 134 N LEU A 119 ? N LEU A 119 A 6 7 O ILE A 120 ? O ILE A 120 N GLU A 112 ? N GLU A 112 A 7 8 O LYS A 111 ? O LYS A 111 N MET A 93 ? N MET A 93 A 8 9 O VAL A 94 ? O VAL A 94 N LYS A 86 ? N LYS A 86 A 9 10 O SER A 83 ? O SER A 83 N PHE A 71 ? N PHE A 71 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'BINDING SITE FOR RESIDUE RET A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 PHE A 15 ? PHE A 15 . ? 1_555 ? 2 AC1 12 MET A 27 ? MET A 27 . ? 5_554 ? 3 AC1 12 TRP A 32 ? TRP A 32 . ? 1_555 ? 4 AC1 12 ALA A 36 ? ALA A 36 . ? 1_555 ? 5 AC1 12 PRO A 39 ? PRO A 39 . ? 1_555 ? 6 AC1 12 ILE A 52 ? ILE A 52 . ? 1_555 ? 7 AC1 12 VAL A 76 ? VAL A 76 . ? 1_555 ? 8 AC1 12 TRP A 109 ? TRP A 109 . ? 1_555 ? 9 AC1 12 LYS A 111 ? LYS A 111 . ? 1_555 ? 10 AC1 12 LEU A 121 ? LEU A 121 . ? 1_555 ? 11 AC1 12 MET A 123 ? MET A 123 . ? 1_555 ? 12 AC1 12 HOH C . ? HOH A 306 . ? 1_555 ? # _database_PDB_matrix.entry_id 4M7M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4M7M _atom_sites.fract_transf_matrix[1][1] 0.017713 _atom_sites.fract_transf_matrix[1][2] 0.010226 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020453 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009110 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 GLU 137 137 137 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-10-09 2 'Structure model' 1 1 2014-02-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 23.6116 _pdbx_refine_tls.origin_y -11.8369 _pdbx_refine_tls.origin_z -5.1770 _pdbx_refine_tls.T[1][1] 0.4080 _pdbx_refine_tls.T[2][2] 0.3035 _pdbx_refine_tls.T[3][3] 0.3700 _pdbx_refine_tls.T[1][2] -0.0926 _pdbx_refine_tls.T[1][3] -0.0524 _pdbx_refine_tls.T[2][3] 0.0361 _pdbx_refine_tls.L[1][1] -0.0465 _pdbx_refine_tls.L[2][2] 6.4204 _pdbx_refine_tls.L[3][3] 3.0910 _pdbx_refine_tls.L[1][2] 1.8113 _pdbx_refine_tls.L[1][3] -2.4146 _pdbx_refine_tls.L[2][3] -2.7725 _pdbx_refine_tls.S[1][1] 0.0688 _pdbx_refine_tls.S[1][2] -0.1614 _pdbx_refine_tls.S[1][3] -0.2530 _pdbx_refine_tls.S[2][1] 0.2569 _pdbx_refine_tls.S[2][2] -0.4025 _pdbx_refine_tls.S[2][3] -0.4667 _pdbx_refine_tls.S[3][1] -0.2438 _pdbx_refine_tls.S[3][2] 0.0892 _pdbx_refine_tls.S[3][3] -0.1391 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing . ? 2 PHENIX refinement '(phenix.refine: 1.7.2_869)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 38 ? ? -118.30 61.25 2 1 THR A 56 ? ? -94.43 -152.18 3 1 GLU A 73 ? ? -154.89 -156.65 4 1 ASP A 116 ? ? -85.29 32.40 5 1 ASP A 126 ? ? 44.80 -108.94 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 17 ? CG ? A GLU 17 CG 2 1 Y 1 A GLU 17 ? CD ? A GLU 17 CD 3 1 Y 1 A GLU 17 ? OE1 ? A GLU 17 OE1 4 1 Y 1 A GLU 17 ? OE2 ? A GLU 17 OE2 5 1 Y 1 A LYS 38 ? CG ? A LYS 38 CG 6 1 Y 1 A LYS 38 ? CD ? A LYS 38 CD 7 1 Y 1 A LYS 38 ? CE ? A LYS 38 CE 8 1 Y 1 A LYS 38 ? NZ ? A LYS 38 NZ 9 1 Y 1 A LYS 44 ? CG ? A LYS 44 CG 10 1 Y 1 A LYS 44 ? CD ? A LYS 44 CD 11 1 Y 1 A LYS 44 ? CE ? A LYS 44 CE 12 1 Y 1 A LYS 44 ? NZ ? A LYS 44 NZ 13 1 Y 1 A GLU 46 ? CG ? A GLU 46 CG 14 1 Y 1 A GLU 46 ? CD ? A GLU 46 CD 15 1 Y 1 A GLU 46 ? OE1 ? A GLU 46 OE1 16 1 Y 1 A GLU 46 ? OE2 ? A GLU 46 OE2 17 1 Y 1 A LYS 66 ? CG ? A LYS 66 CG 18 1 Y 1 A LYS 66 ? CD ? A LYS 66 CD 19 1 Y 1 A LYS 66 ? CE ? A LYS 66 CE 20 1 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 21 1 Y 1 A GLU 72 ? CG ? A GLU 72 CG 22 1 Y 1 A GLU 72 ? CD ? A GLU 72 CD 23 1 Y 1 A GLU 72 ? OE1 ? A GLU 72 OE1 24 1 Y 1 A GLU 72 ? OE2 ? A GLU 72 OE2 25 1 Y 1 A LYS 98 ? CG ? A LYS 98 CG 26 1 Y 1 A LYS 98 ? CD ? A LYS 98 CD 27 1 Y 1 A LYS 98 ? CE ? A LYS 98 CE 28 1 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 29 1 Y 1 A LYS 101 ? CG ? A LYS 101 CG 30 1 Y 1 A LYS 101 ? CD ? A LYS 101 CD 31 1 Y 1 A LYS 101 ? CE ? A LYS 101 CE 32 1 Y 1 A LYS 101 ? NZ ? A LYS 101 NZ 33 1 Y 1 A GLU 103 ? CG ? A GLU 103 CG 34 1 Y 1 A GLU 103 ? CD ? A GLU 103 CD 35 1 Y 1 A GLU 103 ? OE1 ? A GLU 103 OE1 36 1 Y 1 A GLU 103 ? OE2 ? A GLU 103 OE2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 RETINAL RET 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RET 1 201 1 RET RET A . C 3 HOH 1 301 1 HOH HOH A . C 3 HOH 2 302 2 HOH HOH A . C 3 HOH 3 303 3 HOH HOH A . C 3 HOH 4 304 4 HOH HOH A . C 3 HOH 5 305 5 HOH HOH A . C 3 HOH 6 306 6 HOH HOH A . C 3 HOH 7 307 7 HOH HOH A . C 3 HOH 8 308 8 HOH HOH A . C 3 HOH 9 309 9 HOH HOH A . #