data_4N30 # _entry.id 4N30 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4N30 RCSB RCSB082687 WWPDB D_1000082687 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4N30 _pdbx_database_status.recvd_initial_deposition_date 2013-10-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tamu, V.D.' 1 'Wahni, K.' 2 'Messens, J.' 3 # _citation.id primary _citation.title 'Dissecting the machinery that introduces disulfide bonds in Pseudomonas aeruginosa.' _citation.journal_abbrev MBio _citation.journal_volume 4 _citation.page_first e00912 _citation.page_last e00913 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 2150-7511 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24327342 _citation.pdbx_database_id_DOI 10.1128/mBio.00912-13 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Arts, I.S.' 1 primary 'Ball, G.' 2 primary 'Leverrier, P.' 3 primary 'Garvis, S.' 4 primary 'Nicolaes, V.' 5 primary 'Vertommen, D.' 6 primary 'Ize, B.' 7 primary 'Tamu Dufe, V.' 8 primary 'Messens, J.' 9 primary 'Voulhoux, R.' 10 primary 'Collet, J.F.' 11 # _cell.entry_id 4N30 _cell.length_a 47.797 _cell.length_b 59.380 _cell.length_c 59.553 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4N30 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein disulfide isomerase' 24091.699 1 ? ? ? ? 2 water nat water 18.015 136 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRLLKGGWAAKRFQGPALPWAGLLLVLLAASAVGVELLVKGLPANHSLYGDAKARWTINEYADLECPFCKVYTPRLKRWV DSHPDVNLVWRHLPLQMHGEAARHQARLVECAGIQGGAKAFWSAIDAIFAQSAGNGGGLPGGTLDFPELDQARLEKCAKD NELIDSDIKLDIDIARSKGITATPTLVIRDNQTGRSVKLEGMADETTLLSAIDWLAKDLLE ; _entity_poly.pdbx_seq_one_letter_code_can ;MRLLKGGWAAKRFQGPALPWAGLLLVLLAASAVGVELLVKGLPANHSLYGDAKARWTINEYADLECPFCKVYTPRLKRWV DSHPDVNLVWRHLPLQMHGEAARHQARLVECAGIQGGAKAFWSAIDAIFAQSAGNGGGLPGGTLDFPELDQARLEKCAKD NELIDSDIKLDIDIARSKGITATPTLVIRDNQTGRSVKLEGMADETTLLSAIDWLAKDLLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 LEU n 1 4 LEU n 1 5 LYS n 1 6 GLY n 1 7 GLY n 1 8 TRP n 1 9 ALA n 1 10 ALA n 1 11 LYS n 1 12 ARG n 1 13 PHE n 1 14 GLN n 1 15 GLY n 1 16 PRO n 1 17 ALA n 1 18 LEU n 1 19 PRO n 1 20 TRP n 1 21 ALA n 1 22 GLY n 1 23 LEU n 1 24 LEU n 1 25 LEU n 1 26 VAL n 1 27 LEU n 1 28 LEU n 1 29 ALA n 1 30 ALA n 1 31 SER n 1 32 ALA n 1 33 VAL n 1 34 GLY n 1 35 VAL n 1 36 GLU n 1 37 LEU n 1 38 LEU n 1 39 VAL n 1 40 LYS n 1 41 GLY n 1 42 LEU n 1 43 PRO n 1 44 ALA n 1 45 ASN n 1 46 HIS n 1 47 SER n 1 48 LEU n 1 49 TYR n 1 50 GLY n 1 51 ASP n 1 52 ALA n 1 53 LYS n 1 54 ALA n 1 55 ARG n 1 56 TRP n 1 57 THR n 1 58 ILE n 1 59 ASN n 1 60 GLU n 1 61 TYR n 1 62 ALA n 1 63 ASP n 1 64 LEU n 1 65 GLU n 1 66 CYS n 1 67 PRO n 1 68 PHE n 1 69 CYS n 1 70 LYS n 1 71 VAL n 1 72 TYR n 1 73 THR n 1 74 PRO n 1 75 ARG n 1 76 LEU n 1 77 LYS n 1 78 ARG n 1 79 TRP n 1 80 VAL n 1 81 ASP n 1 82 SER n 1 83 HIS n 1 84 PRO n 1 85 ASP n 1 86 VAL n 1 87 ASN n 1 88 LEU n 1 89 VAL n 1 90 TRP n 1 91 ARG n 1 92 HIS n 1 93 LEU n 1 94 PRO n 1 95 LEU n 1 96 GLN n 1 97 MET n 1 98 HIS n 1 99 GLY n 1 100 GLU n 1 101 ALA n 1 102 ALA n 1 103 ARG n 1 104 HIS n 1 105 GLN n 1 106 ALA n 1 107 ARG n 1 108 LEU n 1 109 VAL n 1 110 GLU n 1 111 CYS n 1 112 ALA n 1 113 GLY n 1 114 ILE n 1 115 GLN n 1 116 GLY n 1 117 GLY n 1 118 ALA n 1 119 LYS n 1 120 ALA n 1 121 PHE n 1 122 TRP n 1 123 SER n 1 124 ALA n 1 125 ILE n 1 126 ASP n 1 127 ALA n 1 128 ILE n 1 129 PHE n 1 130 ALA n 1 131 GLN n 1 132 SER n 1 133 ALA n 1 134 GLY n 1 135 ASN n 1 136 GLY n 1 137 GLY n 1 138 GLY n 1 139 LEU n 1 140 PRO n 1 141 GLY n 1 142 GLY n 1 143 THR n 1 144 LEU n 1 145 ASP n 1 146 PHE n 1 147 PRO n 1 148 GLU n 1 149 LEU n 1 150 ASP n 1 151 GLN n 1 152 ALA n 1 153 ARG n 1 154 LEU n 1 155 GLU n 1 156 LYS n 1 157 CYS n 1 158 ALA n 1 159 LYS n 1 160 ASP n 1 161 ASN n 1 162 GLU n 1 163 LEU n 1 164 ILE n 1 165 ASP n 1 166 SER n 1 167 ASP n 1 168 ILE n 1 169 LYS n 1 170 LEU n 1 171 ASP n 1 172 ILE n 1 173 ASP n 1 174 ILE n 1 175 ALA n 1 176 ARG n 1 177 SER n 1 178 LYS n 1 179 GLY n 1 180 ILE n 1 181 THR n 1 182 ALA n 1 183 THR n 1 184 PRO n 1 185 THR n 1 186 LEU n 1 187 VAL n 1 188 ILE n 1 189 ARG n 1 190 ASP n 1 191 ASN n 1 192 GLN n 1 193 THR n 1 194 GLY n 1 195 ARG n 1 196 SER n 1 197 VAL n 1 198 LYS n 1 199 LEU n 1 200 GLU n 1 201 GLY n 1 202 MET n 1 203 ALA n 1 204 ASP n 1 205 GLU n 1 206 THR n 1 207 THR n 1 208 LEU n 1 209 LEU n 1 210 SER n 1 211 ALA n 1 212 ILE n 1 213 ASP n 1 214 TRP n 1 215 LEU n 1 216 ALA n 1 217 LYS n 1 218 ASP n 1 219 LEU n 1 220 LEU n 1 221 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dsbG, EXA31, RL020' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7WY37_PSEAI _struct_ref.pdbx_db_accession Q7WY37 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRLLKGGWAAKRFQGPALPWAGLLLVLLAASAVGVELLVKGLPANHSLYGDAKARWTINEYADLECPFCKVYTPRLKRWV DSHPDVNLVWRHLPLQMHGEAARHQARLVECAGIQGGAKAFWSAIDAIFAQSAGNGGGLPGGTLDFPELDQARLEKCAKD NELIDSDIKLDIDIARSKGITATPTLVIRDNQTGRSVKLEGMADETTLLSAIDWLAKDL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4N30 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 219 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7WY37 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 219 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 219 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4N30 LEU A 220 ? UNP Q7WY37 ? ? 'EXPRESSION TAG' 220 1 1 4N30 GLU A 221 ? UNP Q7WY37 ? ? 'EXPRESSION TAG' 221 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4N30 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 2 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.75 _exptl_crystal.density_percent_sol 29.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_details '0.1mM Bis-Tris, pH 5.5, 1.5M ammonium sulphate, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RIGAKU SATURN 944+' _diffrn_detector.pdbx_collection_date 2012-05-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator CU _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.54178 # _reflns.entry_id 4N30 _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 42.05 _reflns.d_resolution_high 1.3 _reflns.number_obs 38970 _reflns.number_all 41039 _reflns.percent_possible_obs 98.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.3 _reflns_shell.d_res_low 1.331 _reflns_shell.percent_possible_all 96.17 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4N30 _refine.ls_number_reflns_obs 38970 _refine.ls_number_reflns_all 41039 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 42.05 _refine.ls_d_res_high 1.30 _refine.ls_percent_reflns_obs 96.17 _refine.ls_R_factor_obs 0.19460 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19325 _refine.ls_R_factor_R_free 0.21969 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 2069 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.963 _refine.correlation_coeff_Fo_to_Fc_free 0.952 _refine.B_iso_mean 16.420 _refine.aniso_B[1][1] -0.83 _refine.aniso_B[2][2] 0.74 _refine.aniso_B[3][3] 0.09 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.057 _refine.pdbx_overall_ESU_R_Free 0.060 _refine.overall_SU_ML 0.034 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 0.794 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1406 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 136 _refine_hist.number_atoms_total 1542 _refine_hist.d_res_high 1.30 _refine_hist.d_res_low 42.05 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.023 0.019 ? 1505 ? 'X-RAY DIFFRACTION' r_bond_other_d ? ? ? ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 2.283 1.960 ? 2057 ? 'X-RAY DIFFRACTION' r_angle_other_deg ? ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 6.317 5.000 ? 201 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 35.728 24.348 ? 69 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 12.369 15.000 ? 259 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 20.623 15.000 ? 11 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.146 0.200 ? 227 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.014 0.021 ? 1163 ? 'X-RAY DIFFRACTION' r_gen_planes_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_scbond_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_long_range_B_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_long_range_B_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.3 _refine_ls_shell.d_res_low 1.331 _refine_ls_shell.number_reflns_R_work 2300 _refine_ls_shell.R_factor_R_work 0.372 _refine_ls_shell.percent_reflns_obs 82.65 _refine_ls_shell.R_factor_R_free 0.446 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 144 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4N30 _struct.title 'Crystal structure of Pseudomonas aeruginosa DsbA2' _struct.pdbx_descriptor 'Protein disulfide isomerase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4N30 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'Thioredoxin fold, Oxidoreductase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 66 ? SER A 82 ? CYS A 66 SER A 82 1 ? 17 HELX_P HELX_P2 2 LEU A 95 ? MET A 97 ? LEU A 95 MET A 97 5 ? 3 HELX_P HELX_P3 3 HIS A 98 ? SER A 132 ? HIS A 98 SER A 132 1 ? 35 HELX_P HELX_P4 4 LEU A 139 ? THR A 143 ? LEU A 139 THR A 143 5 ? 5 HELX_P HELX_P5 5 ASP A 150 ? ASN A 161 ? ASP A 150 ASN A 161 1 ? 12 HELX_P HELX_P6 6 ASN A 161 ? LYS A 178 ? ASN A 161 LYS A 178 1 ? 18 HELX_P HELX_P7 7 ASP A 204 ? LYS A 217 ? ASP A 204 LYS A 217 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 111 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 157 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 111 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 157 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.998 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 183 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 183 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 184 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 184 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.36 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 48 ? TYR A 49 ? LEU A 48 TYR A 49 A 2 VAL A 86 ? HIS A 92 ? VAL A 86 HIS A 92 A 3 TRP A 56 ? ALA A 62 ? TRP A 56 ALA A 62 A 4 THR A 185 ? ASP A 190 ? THR A 185 ASP A 190 A 5 SER A 196 ? GLU A 200 ? SER A 196 GLU A 200 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 49 ? N TYR A 49 O LEU A 88 ? O LEU A 88 A 2 3 O ASN A 87 ? O ASN A 87 N ILE A 58 ? N ILE A 58 A 3 4 N TYR A 61 ? N TYR A 61 O THR A 185 ? O THR A 185 A 4 5 N LEU A 186 ? N LEU A 186 O LEU A 199 ? O LEU A 199 # _database_PDB_matrix.entry_id 4N30 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4N30 _atom_sites.fract_transf_matrix[1][1] 0.020922 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016841 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016792 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 TRP 8 8 ? ? ? A . n A 1 9 ALA 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 LYS 11 11 ? ? ? A . n A 1 12 ARG 12 12 ? ? ? A . n A 1 13 PHE 13 13 ? ? ? A . n A 1 14 GLN 14 14 ? ? ? A . n A 1 15 GLY 15 15 ? ? ? A . n A 1 16 PRO 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 LEU 18 18 ? ? ? A . n A 1 19 PRO 19 19 ? ? ? A . n A 1 20 TRP 20 20 ? ? ? A . n A 1 21 ALA 21 21 ? ? ? A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 LEU 23 23 ? ? ? A . n A 1 24 LEU 24 24 ? ? ? A . n A 1 25 LEU 25 25 ? ? ? A . n A 1 26 VAL 26 26 ? ? ? A . n A 1 27 LEU 27 27 ? ? ? A . n A 1 28 LEU 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 SER 31 31 ? ? ? A . n A 1 32 ALA 32 32 ? ? ? A . n A 1 33 VAL 33 33 ? ? ? A . n A 1 34 GLY 34 34 ? ? ? A . n A 1 35 VAL 35 35 ? ? ? A . n A 1 36 GLU 36 36 ? ? ? A . n A 1 37 LEU 37 37 ? ? ? A . n A 1 38 LEU 38 38 ? ? ? A . n A 1 39 VAL 39 39 ? ? ? A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 CYS 111 111 111 CYS CYS A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 TRP 122 122 122 TRP TRP A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 CYS 157 157 157 CYS CYS A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 THR 185 185 185 THR THR A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 MET 202 202 202 MET MET A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 ASP 204 204 204 ASP ASP A . n A 1 205 GLU 205 205 205 GLU GLU A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 ILE 212 212 212 ILE ILE A . n A 1 213 ASP 213 213 213 ASP ASP A . n A 1 214 TRP 214 214 214 TRP TRP A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 GLU 221 221 221 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-12-04 2 'Structure model' 1 1 2014-01-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-3000 'data collection' . ? 1 MLPHARE phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 HKL-3000 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 151 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 427 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.97 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.417 1.354 0.063 0.009 N 2 1 CD A GLU 60 ? ? OE1 A GLU 60 ? ? 1.179 1.252 -0.073 0.011 N 3 1 CG A HIS 83 ? ? CD2 A HIS 83 ? ? 1.410 1.354 0.056 0.009 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 85 ? B CG A ASP 85 ? B OD1 A ASP 85 ? B 129.69 118.30 11.39 0.90 N 2 1 CB A ASP 85 ? B CG A ASP 85 ? B OD2 A ASP 85 ? B 109.86 118.30 -8.44 0.90 N 3 1 NE A ARG 103 ? ? CZ A ARG 103 ? ? NH1 A ARG 103 ? ? 123.41 120.30 3.11 0.50 N 4 1 NE A ARG 103 ? ? CZ A ARG 103 ? ? NH2 A ARG 103 ? ? 116.81 120.30 -3.49 0.50 N 5 1 NE A ARG 107 ? ? CZ A ARG 107 ? ? NH2 A ARG 107 ? ? 115.38 120.30 -4.92 0.50 N 6 1 CB A ASP 173 ? ? CG A ASP 173 ? ? OD2 A ASP 173 ? ? 110.24 118.30 -8.06 0.90 N 7 1 NE A ARG 176 ? ? CZ A ARG 176 ? ? NH2 A ARG 176 ? ? 116.44 120.30 -3.86 0.50 N 8 1 NE A ARG 195 ? ? CZ A ARG 195 ? ? NH2 A ARG 195 ? ? 116.30 120.30 -4.00 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 45 ? ? -132.21 -78.18 2 1 ALA A 216 ? ? -153.15 28.84 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A TRP 8 ? A TRP 8 9 1 Y 1 A ALA 9 ? A ALA 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A LYS 11 ? A LYS 11 12 1 Y 1 A ARG 12 ? A ARG 12 13 1 Y 1 A PHE 13 ? A PHE 13 14 1 Y 1 A GLN 14 ? A GLN 14 15 1 Y 1 A GLY 15 ? A GLY 15 16 1 Y 1 A PRO 16 ? A PRO 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A LEU 18 ? A LEU 18 19 1 Y 1 A PRO 19 ? A PRO 19 20 1 Y 1 A TRP 20 ? A TRP 20 21 1 Y 1 A ALA 21 ? A ALA 21 22 1 Y 1 A GLY 22 ? A GLY 22 23 1 Y 1 A LEU 23 ? A LEU 23 24 1 Y 1 A LEU 24 ? A LEU 24 25 1 Y 1 A LEU 25 ? A LEU 25 26 1 Y 1 A VAL 26 ? A VAL 26 27 1 Y 1 A LEU 27 ? A LEU 27 28 1 Y 1 A LEU 28 ? A LEU 28 29 1 Y 1 A ALA 29 ? A ALA 29 30 1 Y 1 A ALA 30 ? A ALA 30 31 1 Y 1 A SER 31 ? A SER 31 32 1 Y 1 A ALA 32 ? A ALA 32 33 1 Y 1 A VAL 33 ? A VAL 33 34 1 Y 1 A GLY 34 ? A GLY 34 35 1 Y 1 A VAL 35 ? A VAL 35 36 1 Y 1 A GLU 36 ? A GLU 36 37 1 Y 1 A LEU 37 ? A LEU 37 38 1 Y 1 A LEU 38 ? A LEU 38 39 1 Y 1 A VAL 39 ? A VAL 39 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 1 HOH HOH A . B 2 HOH 2 302 2 HOH HOH A . B 2 HOH 3 303 3 HOH HOH A . B 2 HOH 4 304 4 HOH HOH A . B 2 HOH 5 305 5 HOH HOH A . B 2 HOH 6 306 6 HOH HOH A . B 2 HOH 7 307 7 HOH HOH A . B 2 HOH 8 308 8 HOH HOH A . B 2 HOH 9 309 9 HOH HOH A . B 2 HOH 10 310 10 HOH HOH A . B 2 HOH 11 311 11 HOH HOH A . B 2 HOH 12 312 12 HOH HOH A . B 2 HOH 13 313 13 HOH HOH A . B 2 HOH 14 314 14 HOH HOH A . B 2 HOH 15 315 15 HOH HOH A . B 2 HOH 16 316 16 HOH HOH A . B 2 HOH 17 317 17 HOH HOH A . B 2 HOH 18 318 18 HOH HOH A . B 2 HOH 19 319 19 HOH HOH A . B 2 HOH 20 320 20 HOH HOH A . B 2 HOH 21 321 21 HOH HOH A . B 2 HOH 22 322 22 HOH HOH A . B 2 HOH 23 323 23 HOH HOH A . B 2 HOH 24 324 24 HOH HOH A . B 2 HOH 25 325 25 HOH HOH A . B 2 HOH 26 326 26 HOH HOH A . B 2 HOH 27 327 27 HOH HOH A . B 2 HOH 28 328 28 HOH HOH A . B 2 HOH 29 329 29 HOH HOH A . B 2 HOH 30 330 30 HOH HOH A . B 2 HOH 31 331 31 HOH HOH A . B 2 HOH 32 332 32 HOH HOH A . B 2 HOH 33 333 33 HOH HOH A . B 2 HOH 34 334 34 HOH HOH A . B 2 HOH 35 335 35 HOH HOH A . B 2 HOH 36 336 36 HOH HOH A . B 2 HOH 37 337 37 HOH HOH A . B 2 HOH 38 338 38 HOH HOH A . B 2 HOH 39 339 39 HOH HOH A . B 2 HOH 40 340 40 HOH HOH A . B 2 HOH 41 341 41 HOH HOH A . B 2 HOH 42 342 42 HOH HOH A . B 2 HOH 43 343 43 HOH HOH A . B 2 HOH 44 344 44 HOH HOH A . B 2 HOH 45 345 45 HOH HOH A . B 2 HOH 46 346 46 HOH HOH A . B 2 HOH 47 347 47 HOH HOH A . B 2 HOH 48 348 48 HOH HOH A . B 2 HOH 49 349 49 HOH HOH A . B 2 HOH 50 350 50 HOH HOH A . B 2 HOH 51 351 51 HOH HOH A . B 2 HOH 52 352 52 HOH HOH A . B 2 HOH 53 353 53 HOH HOH A . B 2 HOH 54 354 54 HOH HOH A . B 2 HOH 55 355 55 HOH HOH A . B 2 HOH 56 356 56 HOH HOH A . B 2 HOH 57 357 57 HOH HOH A . B 2 HOH 58 358 58 HOH HOH A . B 2 HOH 59 359 59 HOH HOH A . B 2 HOH 60 360 60 HOH HOH A . B 2 HOH 61 361 61 HOH HOH A . B 2 HOH 62 362 62 HOH HOH A . B 2 HOH 63 363 63 HOH HOH A . B 2 HOH 64 364 64 HOH HOH A . B 2 HOH 65 365 65 HOH HOH A . B 2 HOH 66 366 66 HOH HOH A . B 2 HOH 67 367 67 HOH HOH A . B 2 HOH 68 368 68 HOH HOH A . B 2 HOH 69 369 69 HOH HOH A . B 2 HOH 70 370 70 HOH HOH A . B 2 HOH 71 371 71 HOH HOH A . B 2 HOH 72 372 72 HOH HOH A . B 2 HOH 73 373 73 HOH HOH A . B 2 HOH 74 374 74 HOH HOH A . B 2 HOH 75 375 75 HOH HOH A . B 2 HOH 76 376 76 HOH HOH A . B 2 HOH 77 377 77 HOH HOH A . B 2 HOH 78 378 78 HOH HOH A . B 2 HOH 79 379 79 HOH HOH A . B 2 HOH 80 380 80 HOH HOH A . B 2 HOH 81 381 81 HOH HOH A . B 2 HOH 82 382 82 HOH HOH A . B 2 HOH 83 383 83 HOH HOH A . B 2 HOH 84 384 84 HOH HOH A . B 2 HOH 85 385 85 HOH HOH A . B 2 HOH 86 386 86 HOH HOH A . B 2 HOH 87 387 87 HOH HOH A . B 2 HOH 88 388 88 HOH HOH A . B 2 HOH 89 389 89 HOH HOH A . B 2 HOH 90 390 90 HOH HOH A . B 2 HOH 91 391 91 HOH HOH A . B 2 HOH 92 392 92 HOH HOH A . B 2 HOH 93 393 93 HOH HOH A . B 2 HOH 94 394 94 HOH HOH A . B 2 HOH 95 395 95 HOH HOH A . B 2 HOH 96 396 96 HOH HOH A . B 2 HOH 97 397 97 HOH HOH A . B 2 HOH 98 398 98 HOH HOH A . B 2 HOH 99 399 99 HOH HOH A . B 2 HOH 100 400 100 HOH HOH A . B 2 HOH 101 401 101 HOH HOH A . B 2 HOH 102 402 102 HOH HOH A . B 2 HOH 103 403 103 HOH HOH A . B 2 HOH 104 404 104 HOH HOH A . B 2 HOH 105 405 105 HOH HOH A . B 2 HOH 106 406 106 HOH HOH A . B 2 HOH 107 407 107 HOH HOH A . B 2 HOH 108 408 108 HOH HOH A . B 2 HOH 109 409 109 HOH HOH A . B 2 HOH 110 410 112 HOH HOH A . B 2 HOH 111 411 114 HOH HOH A . B 2 HOH 112 412 115 HOH HOH A . B 2 HOH 113 413 116 HOH HOH A . B 2 HOH 114 414 117 HOH HOH A . B 2 HOH 115 415 118 HOH HOH A . B 2 HOH 116 416 119 HOH HOH A . B 2 HOH 117 417 120 HOH HOH A . B 2 HOH 118 418 121 HOH HOH A . B 2 HOH 119 419 122 HOH HOH A . B 2 HOH 120 420 123 HOH HOH A . B 2 HOH 121 421 124 HOH HOH A . B 2 HOH 122 422 125 HOH HOH A . B 2 HOH 123 423 126 HOH HOH A . B 2 HOH 124 424 127 HOH HOH A . B 2 HOH 125 425 128 HOH HOH A . B 2 HOH 126 426 129 HOH HOH A . B 2 HOH 127 427 130 HOH HOH A . B 2 HOH 128 428 131 HOH HOH A . B 2 HOH 129 429 132 HOH HOH A . B 2 HOH 130 430 133 HOH HOH A . B 2 HOH 131 431 134 HOH HOH A . B 2 HOH 132 432 135 HOH HOH A . B 2 HOH 133 433 136 HOH HOH A . B 2 HOH 134 434 137 HOH HOH A . B 2 HOH 135 435 138 HOH HOH A . B 2 HOH 136 436 139 HOH HOH A . #