data_4NX2 # _entry.id 4NX2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.360 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4NX2 pdb_00004nx2 10.2210/pdb4nx2/pdb RCSB RCSB083763 ? ? WWPDB D_1000083763 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4NX2 _pdbx_database_status.recvd_initial_deposition_date 2013-12-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, J.' 1 'Gong, W.' 2 'Li, J.' 3 'Gao, F.' 4 'Li, H.' 5 # _citation.id primary _citation.title ;Significant expansion of fluorescent protein sensing ability through the genetic incorporation of superior photo-induced electron-transfer quenchers. ; _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 136 _citation.page_first 13094 _citation.page_last 13097 _citation.year 2014 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 1520-5126 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25197956 _citation.pdbx_database_id_DOI 10.1021/ja505219r # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, X.' 1 ? primary 'Jiang, L.' 2 ? primary 'Li, J.' 3 ? primary 'Wang, L.' 4 ? primary 'Yu, Y.' 5 ? primary 'Zhou, Q.' 6 ? primary 'Lv, X.' 7 ? primary 'Gong, W.' 8 ? primary 'Lu, Y.' 9 ? primary 'Wang, J.' 10 ? # _cell.entry_id 4NX2 _cell.length_a 53.099 _cell.length_b 160.955 _cell.length_c 39.009 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4NX2 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine--tRNA ligase' 35706.574 1 6.1.1.1 'Y32L, L65I, H70G, F108I, Q109L, Y114G, D158S, L162M' ? ? 2 non-polymer syn 3,5-dichloro-L-tyrosine 250.079 1 ? ? ? ? 3 water nat water 18.015 224 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Tyrosyl-tRNA synthetase, TyrRS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIIILADLGAYLNQKGELD EIRKIGDYNKKVFEAMGLKAKYVYGSEILLDKDGTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNSIH YMGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNP IMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPIRKRLAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIIILADLGAYLNQKGELD EIRKIGDYNKKVFEAMGLKAKYVYGSEILLDKDGTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNSIH YMGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNP IMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPIRKRLAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLU n 1 4 PHE n 1 5 GLU n 1 6 MET n 1 7 ILE n 1 8 LYS n 1 9 ARG n 1 10 ASN n 1 11 THR n 1 12 SER n 1 13 GLU n 1 14 ILE n 1 15 ILE n 1 16 SER n 1 17 GLU n 1 18 GLU n 1 19 GLU n 1 20 LEU n 1 21 ARG n 1 22 GLU n 1 23 VAL n 1 24 LEU n 1 25 LYS n 1 26 LYS n 1 27 ASP n 1 28 GLU n 1 29 LYS n 1 30 SER n 1 31 ALA n 1 32 LEU n 1 33 ILE n 1 34 GLY n 1 35 PHE n 1 36 GLU n 1 37 PRO n 1 38 SER n 1 39 GLY n 1 40 LYS n 1 41 ILE n 1 42 HIS n 1 43 LEU n 1 44 GLY n 1 45 HIS n 1 46 TYR n 1 47 LEU n 1 48 GLN n 1 49 ILE n 1 50 LYS n 1 51 LYS n 1 52 MET n 1 53 ILE n 1 54 ASP n 1 55 LEU n 1 56 GLN n 1 57 ASN n 1 58 ALA n 1 59 GLY n 1 60 PHE n 1 61 ASP n 1 62 ILE n 1 63 ILE n 1 64 ILE n 1 65 ILE n 1 66 LEU n 1 67 ALA n 1 68 ASP n 1 69 LEU n 1 70 GLY n 1 71 ALA n 1 72 TYR n 1 73 LEU n 1 74 ASN n 1 75 GLN n 1 76 LYS n 1 77 GLY n 1 78 GLU n 1 79 LEU n 1 80 ASP n 1 81 GLU n 1 82 ILE n 1 83 ARG n 1 84 LYS n 1 85 ILE n 1 86 GLY n 1 87 ASP n 1 88 TYR n 1 89 ASN n 1 90 LYS n 1 91 LYS n 1 92 VAL n 1 93 PHE n 1 94 GLU n 1 95 ALA n 1 96 MET n 1 97 GLY n 1 98 LEU n 1 99 LYS n 1 100 ALA n 1 101 LYS n 1 102 TYR n 1 103 VAL n 1 104 TYR n 1 105 GLY n 1 106 SER n 1 107 GLU n 1 108 ILE n 1 109 LEU n 1 110 LEU n 1 111 ASP n 1 112 LYS n 1 113 ASP n 1 114 GLY n 1 115 THR n 1 116 LEU n 1 117 ASN n 1 118 VAL n 1 119 TYR n 1 120 ARG n 1 121 LEU n 1 122 ALA n 1 123 LEU n 1 124 LYS n 1 125 THR n 1 126 THR n 1 127 LEU n 1 128 LYS n 1 129 ARG n 1 130 ALA n 1 131 ARG n 1 132 ARG n 1 133 SER n 1 134 MET n 1 135 GLU n 1 136 LEU n 1 137 ILE n 1 138 ALA n 1 139 ARG n 1 140 GLU n 1 141 ASP n 1 142 GLU n 1 143 ASN n 1 144 PRO n 1 145 LYS n 1 146 VAL n 1 147 ALA n 1 148 GLU n 1 149 VAL n 1 150 ILE n 1 151 TYR n 1 152 PRO n 1 153 ILE n 1 154 MET n 1 155 GLN n 1 156 VAL n 1 157 ASN n 1 158 SER n 1 159 ILE n 1 160 HIS n 1 161 TYR n 1 162 MET n 1 163 GLY n 1 164 VAL n 1 165 ASP n 1 166 VAL n 1 167 ALA n 1 168 VAL n 1 169 GLY n 1 170 GLY n 1 171 MET n 1 172 GLU n 1 173 GLN n 1 174 ARG n 1 175 LYS n 1 176 ILE n 1 177 HIS n 1 178 MET n 1 179 LEU n 1 180 ALA n 1 181 ARG n 1 182 GLU n 1 183 LEU n 1 184 LEU n 1 185 PRO n 1 186 LYS n 1 187 LYS n 1 188 VAL n 1 189 VAL n 1 190 CYS n 1 191 ILE n 1 192 HIS n 1 193 ASN n 1 194 PRO n 1 195 VAL n 1 196 LEU n 1 197 THR n 1 198 GLY n 1 199 LEU n 1 200 ASP n 1 201 GLY n 1 202 GLU n 1 203 GLY n 1 204 LYS n 1 205 MET n 1 206 SER n 1 207 SER n 1 208 SER n 1 209 LYS n 1 210 GLY n 1 211 ASN n 1 212 PHE n 1 213 ILE n 1 214 ALA n 1 215 VAL n 1 216 ASP n 1 217 ASP n 1 218 SER n 1 219 PRO n 1 220 GLU n 1 221 GLU n 1 222 ILE n 1 223 ARG n 1 224 ALA n 1 225 LYS n 1 226 ILE n 1 227 LYS n 1 228 LYS n 1 229 ALA n 1 230 TYR n 1 231 CYS n 1 232 PRO n 1 233 ALA n 1 234 GLY n 1 235 VAL n 1 236 VAL n 1 237 GLU n 1 238 GLY n 1 239 ASN n 1 240 PRO n 1 241 ILE n 1 242 MET n 1 243 GLU n 1 244 ILE n 1 245 ALA n 1 246 LYS n 1 247 TYR n 1 248 PHE n 1 249 LEU n 1 250 GLU n 1 251 TYR n 1 252 PRO n 1 253 LEU n 1 254 THR n 1 255 ILE n 1 256 LYS n 1 257 ARG n 1 258 PRO n 1 259 GLU n 1 260 LYS n 1 261 PHE n 1 262 GLY n 1 263 GLY n 1 264 ASP n 1 265 LEU n 1 266 THR n 1 267 VAL n 1 268 ASN n 1 269 SER n 1 270 TYR n 1 271 GLU n 1 272 GLU n 1 273 LEU n 1 274 GLU n 1 275 SER n 1 276 LEU n 1 277 PHE n 1 278 LYS n 1 279 ASN n 1 280 LYS n 1 281 GLU n 1 282 LEU n 1 283 HIS n 1 284 PRO n 1 285 MET n 1 286 ASP n 1 287 LEU n 1 288 LYS n 1 289 ASN n 1 290 ALA n 1 291 VAL n 1 292 ALA n 1 293 GLU n 1 294 GLU n 1 295 LEU n 1 296 ILE n 1 297 LYS n 1 298 ILE n 1 299 LEU n 1 300 GLU n 1 301 PRO n 1 302 ILE n 1 303 ARG n 1 304 LYS n 1 305 ARG n 1 306 LEU n 1 307 ALA n 1 308 HIS n 1 309 HIS n 1 310 HIS n 1 311 HIS n 1 312 HIS n 1 313 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'tyrS, MJ0389' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243232 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SYY_METJA _struct_ref.pdbx_db_accession Q57834 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDEFEMIKRNTSEIISEEELREVLKKDEKSAYIGFEPSGKIHLGHYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELD EIRKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNDIH YLGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEIRAKIKKAYCPAGVVEGNP IMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPIRKRL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4NX2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 306 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q57834 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 306 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 306 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4NX2 LEU A 32 ? UNP Q57834 TYR 32 'engineered mutation' 32 1 1 4NX2 ILE A 65 ? UNP Q57834 LEU 65 'engineered mutation' 65 2 1 4NX2 GLY A 70 ? UNP Q57834 HIS 70 'engineered mutation' 70 3 1 4NX2 ILE A 108 ? UNP Q57834 PHE 108 'engineered mutation' 108 4 1 4NX2 LEU A 109 ? UNP Q57834 GLN 109 'engineered mutation' 109 5 1 4NX2 GLY A 114 ? UNP Q57834 TYR 114 'engineered mutation' 114 6 1 4NX2 SER A 158 ? UNP Q57834 ASP 158 'engineered mutation' 158 7 1 4NX2 MET A 162 ? UNP Q57834 LEU 162 'engineered mutation' 162 8 1 4NX2 ALA A 307 ? UNP Q57834 ? ? 'expression tag' 307 9 1 4NX2 HIS A 308 ? UNP Q57834 ? ? 'expression tag' 308 10 1 4NX2 HIS A 309 ? UNP Q57834 ? ? 'expression tag' 309 11 1 4NX2 HIS A 310 ? UNP Q57834 ? ? 'expression tag' 310 12 1 4NX2 HIS A 311 ? UNP Q57834 ? ? 'expression tag' 311 13 1 4NX2 HIS A 312 ? UNP Q57834 ? ? 'expression tag' 312 14 1 4NX2 HIS A 313 ? UNP Q57834 ? ? 'expression tag' 313 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2LT 'L-peptide linking' n 3,5-dichloro-L-tyrosine ? 'C9 H9 Cl2 N O3' 250.079 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4NX2 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_percent_sol 47.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 289.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;0.2M MgCl2, 0.1M Bis-Tris pH5.5, 25% PEG 3350 , VAPOR DIFFUSION, SITTING DROP, temperature 289.0K ; # _diffrn.id 1 _diffrn.ambient_temp 200.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2012-06-27 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.pdbx_synchrotron_site SSRF _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_wavelength 0.979 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4NX2 _reflns.observed_criterion_sigma_I 1.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 2.000 _reflns.number_obs 22437 _reflns.number_all ? _reflns.percent_possible_obs 96.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 86.5 _reflns_shell.Rmerge_I_obs 0.30300 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.000 _reflns_shell.pdbx_redundancy 5.30 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4NX2 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 21693 _refine.ls_number_reflns_all 22484 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 39.01 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 95.5 _refine.ls_R_factor_obs 0.174 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.172 _refine.ls_R_factor_R_free 0.220 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.130 _refine.ls_number_reflns_R_free 1150 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.210 _refine.pdbx_overall_phase_error 21.530 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2466 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 224 _refine_hist.number_atoms_total 2705 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 39.01 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.007 ? ? 2535 'X-RAY DIFFRACTION' ? f_angle_d 1.152 ? ? 3408 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.310 ? ? 998 'X-RAY DIFFRACTION' ? f_chiral_restr 0.079 ? ? 381 'X-RAY DIFFRACTION' ? f_plane_restr 0.004 ? ? 436 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.9993 2.0903 2347 0.2004 87.00 0.2734 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.0903 2.2004 2491 0.1791 90.00 0.2379 . . 117 . . . . 'X-RAY DIFFRACTION' . 2.2004 2.3383 2537 0.1750 93.00 0.2601 . . 147 . . . . 'X-RAY DIFFRACTION' . 2.3383 2.5188 2693 0.1774 97.00 0.2320 . . 127 . . . . 'X-RAY DIFFRACTION' . 2.5188 2.7722 2709 0.1842 98.00 0.2422 . . 170 . . . . 'X-RAY DIFFRACTION' . 2.7722 3.1732 2750 0.1790 99.00 0.2343 . . 125 . . . . 'X-RAY DIFFRACTION' . 3.1732 3.9973 2795 0.1607 100.00 0.2080 . . 159 . . . . 'X-RAY DIFFRACTION' . 3.9973 39.0164 2965 0.1634 99.00 0.1877 . . 162 . . . . # _struct.entry_id 4NX2 _struct.title 'Crystal structure of DCYRS complexed with DCY' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4NX2 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'Ligase Activity, Translation, Nucleotide, LIGASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? ARG A 9 ? ASP A 2 ARG A 9 1 ? 8 HELX_P HELX_P2 2 SER A 16 ? LYS A 26 ? SER A 16 LYS A 26 1 ? 11 HELX_P HELX_P3 3 HIS A 42 ? ALA A 58 ? HIS A 42 ALA A 58 1 ? 17 HELX_P HELX_P4 4 ALA A 67 ? ASN A 74 ? ALA A 67 ASN A 74 1 ? 8 HELX_P HELX_P5 5 GLU A 78 ? MET A 96 ? GLU A 78 MET A 96 1 ? 19 HELX_P HELX_P6 6 GLY A 105 ? LYS A 112 ? GLY A 105 LYS A 112 1 ? 8 HELX_P HELX_P7 7 GLY A 114 ? THR A 125 ? GLY A 114 THR A 125 1 ? 12 HELX_P HELX_P8 8 THR A 126 ? MET A 134 ? THR A 126 MET A 134 1 ? 9 HELX_P HELX_P9 9 VAL A 146 ? GLY A 163 ? VAL A 146 GLY A 163 1 ? 18 HELX_P HELX_P10 10 GLN A 173 ? LEU A 184 ? GLN A 173 LEU A 184 1 ? 12 HELX_P HELX_P11 11 SER A 218 ? LYS A 228 ? SER A 218 LYS A 228 1 ? 11 HELX_P HELX_P12 12 ASN A 239 ? LEU A 249 ? ASN A 239 LEU A 249 1 ? 11 HELX_P HELX_P13 13 SER A 269 ? ASN A 279 ? SER A 269 ASN A 279 1 ? 11 HELX_P HELX_P14 14 HIS A 283 ? HIS A 310 ? HIS A 283 HIS A 310 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 15 A . ? ILE 15 A SER 16 A ? SER 16 A 1 -7.54 2 ASP 113 A . ? ASP 113 A GLY 114 A ? GLY 114 A 1 -10.39 3 TYR 251 A . ? TYR 251 A PRO 252 A ? PRO 252 A 1 3.00 4 PRO 258 A . ? PRO 258 A GLU 259 A ? GLU 259 A 1 11.70 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 13 ? ILE A 15 ? GLU A 13 ILE A 15 A 2 VAL A 189 ? ASN A 193 ? VAL A 189 ASN A 193 A 3 VAL A 166 ? GLY A 170 ? VAL A 166 GLY A 170 A 4 LYS A 29 ? PHE A 35 ? LYS A 29 PHE A 35 A 5 PHE A 60 ? LEU A 66 ? PHE A 60 LEU A 66 A 6 LYS A 101 ? TYR A 104 ? LYS A 101 TYR A 104 B 1 LEU A 253 ? ILE A 255 ? LEU A 253 ILE A 255 B 2 LEU A 265 ? VAL A 267 ? LEU A 265 VAL A 267 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 15 ? N ILE A 15 O CYS A 190 ? O CYS A 190 A 2 3 O VAL A 189 ? O VAL A 189 N ALA A 167 ? N ALA A 167 A 3 4 O VAL A 168 ? O VAL A 168 N LEU A 32 ? N LEU A 32 A 4 5 N LYS A 29 ? N LYS A 29 O ASP A 61 ? O ASP A 61 A 5 6 N ILE A 64 ? N ILE A 64 O LYS A 101 ? O LYS A 101 B 1 2 N ILE A 255 ? N ILE A 255 O LEU A 265 ? O LEU A 265 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 2LT _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'BINDING SITE FOR RESIDUE 2LT A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 GLY A 34 ? GLY A 34 . ? 1_555 ? 2 AC1 10 GLU A 36 ? GLU A 36 . ? 1_555 ? 3 AC1 10 ALA A 67 ? ALA A 67 . ? 1_555 ? 4 AC1 10 TYR A 151 ? TYR A 151 . ? 1_555 ? 5 AC1 10 GLN A 155 ? GLN A 155 . ? 1_555 ? 6 AC1 10 SER A 158 ? SER A 158 . ? 1_555 ? 7 AC1 10 GLN A 173 ? GLN A 173 . ? 1_555 ? 8 AC1 10 HOH C . ? HOH A 701 . ? 1_555 ? 9 AC1 10 HOH C . ? HOH A 711 . ? 1_555 ? 10 AC1 10 HOH C . ? HOH A 712 . ? 1_555 ? # _database_PDB_matrix.entry_id 4NX2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4NX2 _atom_sites.fract_transf_matrix[1][1] 0.018833 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006213 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.025635 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 PRO 152 152 152 PRO PRO A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 MET 154 154 154 MET MET A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 TYR 161 161 161 TYR TYR A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 MET 171 171 171 MET MET A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 MET 178 178 178 MET MET A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 LYS 187 187 187 LYS LYS A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 CYS 190 190 190 CYS CYS A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 HIS 192 192 192 HIS HIS A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 MET 205 205 205 MET MET A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 SER 208 208 208 SER SER A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 PRO 219 219 219 PRO PRO A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 GLU 221 221 221 GLU GLU A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 ARG 223 223 223 ARG ARG A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 LYS 228 228 228 LYS LYS A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 CYS 231 231 231 CYS CYS A . n A 1 232 PRO 232 232 232 PRO PRO A . n A 1 233 ALA 233 233 233 ALA ALA A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 VAL 235 235 235 VAL VAL A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 GLU 237 237 237 GLU GLU A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 ASN 239 239 239 ASN ASN A . n A 1 240 PRO 240 240 240 PRO PRO A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 MET 242 242 242 MET MET A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 PHE 248 248 248 PHE PHE A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 PRO 252 252 252 PRO PRO A . n A 1 253 LEU 253 253 253 LEU LEU A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 ILE 255 255 255 ILE ILE A . n A 1 256 LYS 256 256 256 LYS LYS A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 PRO 258 258 258 PRO PRO A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 PHE 261 261 261 PHE PHE A . n A 1 262 GLY 262 262 262 GLY GLY A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 ASP 264 264 264 ASP ASP A . n A 1 265 LEU 265 265 265 LEU LEU A . n A 1 266 THR 266 266 266 THR THR A . n A 1 267 VAL 267 267 267 VAL VAL A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 TYR 270 270 270 TYR TYR A . n A 1 271 GLU 271 271 271 GLU GLU A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 LEU 273 273 273 LEU LEU A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 SER 275 275 275 SER SER A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 PHE 277 277 277 PHE PHE A . n A 1 278 LYS 278 278 278 LYS LYS A . n A 1 279 ASN 279 279 279 ASN ASN A . n A 1 280 LYS 280 280 280 LYS LYS A . n A 1 281 GLU 281 281 281 GLU GLU A . n A 1 282 LEU 282 282 282 LEU LEU A . n A 1 283 HIS 283 283 283 HIS HIS A . n A 1 284 PRO 284 284 284 PRO PRO A . n A 1 285 MET 285 285 285 MET MET A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 LYS 288 288 288 LYS LYS A . n A 1 289 ASN 289 289 289 ASN ASN A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 VAL 291 291 291 VAL VAL A . n A 1 292 ALA 292 292 292 ALA ALA A . n A 1 293 GLU 293 293 293 GLU GLU A . n A 1 294 GLU 294 294 294 GLU GLU A . n A 1 295 LEU 295 295 295 LEU LEU A . n A 1 296 ILE 296 296 296 ILE ILE A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 ILE 298 298 298 ILE ILE A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 GLU 300 300 300 GLU GLU A . n A 1 301 PRO 301 301 301 PRO PRO A . n A 1 302 ILE 302 302 302 ILE ILE A . n A 1 303 ARG 303 303 303 ARG ARG A . n A 1 304 LYS 304 304 304 LYS LYS A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 ALA 307 307 307 ALA ALA A . n A 1 308 HIS 308 308 308 HIS HIS A . n A 1 309 HIS 309 309 309 HIS HIS A . n A 1 310 HIS 310 310 310 HIS HIS A . n A 1 311 HIS 311 311 311 HIS HIS A . n A 1 312 HIS 312 312 312 HIS HIS A . n A 1 313 HIS 313 313 313 HIS HIS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 2LT 1 401 401 2LT DCY A . C 3 HOH 1 501 1 HOH HOH A . C 3 HOH 2 502 3 HOH HOH A . C 3 HOH 3 503 4 HOH HOH A . C 3 HOH 4 504 5 HOH HOH A . C 3 HOH 5 505 6 HOH HOH A . C 3 HOH 6 506 7 HOH HOH A . C 3 HOH 7 507 8 HOH HOH A . C 3 HOH 8 508 9 HOH HOH A . C 3 HOH 9 509 10 HOH HOH A . C 3 HOH 10 510 11 HOH HOH A . C 3 HOH 11 511 12 HOH HOH A . C 3 HOH 12 512 13 HOH HOH A . C 3 HOH 13 513 14 HOH HOH A . C 3 HOH 14 514 15 HOH HOH A . C 3 HOH 15 515 16 HOH HOH A . C 3 HOH 16 516 18 HOH HOH A . C 3 HOH 17 517 19 HOH HOH A . C 3 HOH 18 518 20 HOH HOH A . C 3 HOH 19 519 21 HOH HOH A . C 3 HOH 20 520 22 HOH HOH A . C 3 HOH 21 521 23 HOH HOH A . C 3 HOH 22 522 24 HOH HOH A . C 3 HOH 23 523 25 HOH HOH A . C 3 HOH 24 524 26 HOH HOH A . C 3 HOH 25 525 27 HOH HOH A . C 3 HOH 26 526 28 HOH HOH A . C 3 HOH 27 527 29 HOH HOH A . C 3 HOH 28 528 30 HOH HOH A . C 3 HOH 29 529 31 HOH HOH A . C 3 HOH 30 530 32 HOH HOH A . C 3 HOH 31 531 33 HOH HOH A . C 3 HOH 32 532 35 HOH HOH A . C 3 HOH 33 533 36 HOH HOH A . C 3 HOH 34 534 37 HOH HOH A . C 3 HOH 35 535 38 HOH HOH A . C 3 HOH 36 536 39 HOH HOH A . C 3 HOH 37 537 40 HOH HOH A . C 3 HOH 38 538 41 HOH HOH A . C 3 HOH 39 539 42 HOH HOH A . C 3 HOH 40 540 43 HOH HOH A . C 3 HOH 41 541 44 HOH HOH A . C 3 HOH 42 542 45 HOH HOH A . C 3 HOH 43 543 46 HOH HOH A . C 3 HOH 44 544 47 HOH HOH A . C 3 HOH 45 545 48 HOH HOH A . C 3 HOH 46 546 49 HOH HOH A . C 3 HOH 47 547 50 HOH HOH A . C 3 HOH 48 548 51 HOH HOH A . C 3 HOH 49 549 52 HOH HOH A . C 3 HOH 50 550 53 HOH HOH A . C 3 HOH 51 551 54 HOH HOH A . C 3 HOH 52 552 55 HOH HOH A . C 3 HOH 53 553 56 HOH HOH A . C 3 HOH 54 554 57 HOH HOH A . C 3 HOH 55 555 58 HOH HOH A . C 3 HOH 56 556 59 HOH HOH A . C 3 HOH 57 557 60 HOH HOH A . C 3 HOH 58 558 61 HOH HOH A . C 3 HOH 59 559 62 HOH HOH A . C 3 HOH 60 560 63 HOH HOH A . C 3 HOH 61 561 64 HOH HOH A . C 3 HOH 62 562 65 HOH HOH A . C 3 HOH 63 563 66 HOH HOH A . C 3 HOH 64 564 67 HOH HOH A . C 3 HOH 65 565 68 HOH HOH A . C 3 HOH 66 566 69 HOH HOH A . C 3 HOH 67 567 70 HOH HOH A . C 3 HOH 68 568 71 HOH HOH A . C 3 HOH 69 569 72 HOH HOH A . C 3 HOH 70 570 73 HOH HOH A . C 3 HOH 71 571 74 HOH HOH A . C 3 HOH 72 572 75 HOH HOH A . C 3 HOH 73 573 76 HOH HOH A . C 3 HOH 74 574 77 HOH HOH A . C 3 HOH 75 575 78 HOH HOH A . C 3 HOH 76 576 79 HOH HOH A . C 3 HOH 77 577 80 HOH HOH A . C 3 HOH 78 578 81 HOH HOH A . C 3 HOH 79 579 82 HOH HOH A . C 3 HOH 80 580 83 HOH HOH A . C 3 HOH 81 581 84 HOH HOH A . C 3 HOH 82 582 85 HOH HOH A . C 3 HOH 83 583 86 HOH HOH A . C 3 HOH 84 584 87 HOH HOH A . C 3 HOH 85 585 88 HOH HOH A . C 3 HOH 86 586 89 HOH HOH A . C 3 HOH 87 587 90 HOH HOH A . C 3 HOH 88 588 91 HOH HOH A . C 3 HOH 89 589 92 HOH HOH A . C 3 HOH 90 590 93 HOH HOH A . C 3 HOH 91 591 94 HOH HOH A . C 3 HOH 92 592 95 HOH HOH A . C 3 HOH 93 593 96 HOH HOH A . C 3 HOH 94 594 97 HOH HOH A . C 3 HOH 95 595 98 HOH HOH A . C 3 HOH 96 596 99 HOH HOH A . C 3 HOH 97 597 100 HOH HOH A . C 3 HOH 98 598 101 HOH HOH A . C 3 HOH 99 599 102 HOH HOH A . C 3 HOH 100 600 103 HOH HOH A . C 3 HOH 101 601 104 HOH HOH A . C 3 HOH 102 602 105 HOH HOH A . C 3 HOH 103 603 106 HOH HOH A . C 3 HOH 104 604 107 HOH HOH A . C 3 HOH 105 605 108 HOH HOH A . C 3 HOH 106 606 109 HOH HOH A . C 3 HOH 107 607 110 HOH HOH A . C 3 HOH 108 608 111 HOH HOH A . C 3 HOH 109 609 112 HOH HOH A . C 3 HOH 110 610 113 HOH HOH A . C 3 HOH 111 611 114 HOH HOH A . C 3 HOH 112 612 115 HOH HOH A . C 3 HOH 113 613 116 HOH HOH A . C 3 HOH 114 614 117 HOH HOH A . C 3 HOH 115 615 118 HOH HOH A . C 3 HOH 116 616 119 HOH HOH A . C 3 HOH 117 617 120 HOH HOH A . C 3 HOH 118 618 121 HOH HOH A . C 3 HOH 119 619 122 HOH HOH A . C 3 HOH 120 620 123 HOH HOH A . C 3 HOH 121 621 124 HOH HOH A . C 3 HOH 122 622 125 HOH HOH A . C 3 HOH 123 623 126 HOH HOH A . C 3 HOH 124 624 127 HOH HOH A . C 3 HOH 125 625 128 HOH HOH A . C 3 HOH 126 626 129 HOH HOH A . C 3 HOH 127 627 130 HOH HOH A . C 3 HOH 128 628 131 HOH HOH A . C 3 HOH 129 629 132 HOH HOH A . C 3 HOH 130 630 133 HOH HOH A . C 3 HOH 131 631 134 HOH HOH A . C 3 HOH 132 632 135 HOH HOH A . C 3 HOH 133 633 136 HOH HOH A . C 3 HOH 134 634 137 HOH HOH A . C 3 HOH 135 635 138 HOH HOH A . C 3 HOH 136 636 139 HOH HOH A . C 3 HOH 137 637 140 HOH HOH A . C 3 HOH 138 638 141 HOH HOH A . C 3 HOH 139 639 142 HOH HOH A . C 3 HOH 140 640 143 HOH HOH A . C 3 HOH 141 641 144 HOH HOH A . C 3 HOH 142 642 145 HOH HOH A . C 3 HOH 143 643 146 HOH HOH A . C 3 HOH 144 644 147 HOH HOH A . C 3 HOH 145 645 148 HOH HOH A . C 3 HOH 146 646 149 HOH HOH A . C 3 HOH 147 647 150 HOH HOH A . C 3 HOH 148 648 151 HOH HOH A . C 3 HOH 149 649 152 HOH HOH A . C 3 HOH 150 650 153 HOH HOH A . C 3 HOH 151 651 154 HOH HOH A . C 3 HOH 152 652 155 HOH HOH A . C 3 HOH 153 653 156 HOH HOH A . C 3 HOH 154 654 157 HOH HOH A . C 3 HOH 155 655 158 HOH HOH A . C 3 HOH 156 656 159 HOH HOH A . C 3 HOH 157 657 160 HOH HOH A . C 3 HOH 158 658 161 HOH HOH A . C 3 HOH 159 659 162 HOH HOH A . C 3 HOH 160 660 163 HOH HOH A . C 3 HOH 161 661 164 HOH HOH A . C 3 HOH 162 662 165 HOH HOH A . C 3 HOH 163 663 166 HOH HOH A . C 3 HOH 164 664 167 HOH HOH A . C 3 HOH 165 665 168 HOH HOH A . C 3 HOH 166 666 169 HOH HOH A . C 3 HOH 167 667 170 HOH HOH A . C 3 HOH 168 668 171 HOH HOH A . C 3 HOH 169 669 172 HOH HOH A . C 3 HOH 170 670 173 HOH HOH A . C 3 HOH 171 671 175 HOH HOH A . C 3 HOH 172 672 176 HOH HOH A . C 3 HOH 173 673 177 HOH HOH A . C 3 HOH 174 674 178 HOH HOH A . C 3 HOH 175 675 179 HOH HOH A . C 3 HOH 176 676 180 HOH HOH A . C 3 HOH 177 677 181 HOH HOH A . C 3 HOH 178 678 182 HOH HOH A . C 3 HOH 179 679 183 HOH HOH A . C 3 HOH 180 680 184 HOH HOH A . C 3 HOH 181 681 185 HOH HOH A . C 3 HOH 182 682 186 HOH HOH A . C 3 HOH 183 683 187 HOH HOH A . C 3 HOH 184 684 188 HOH HOH A . C 3 HOH 185 685 189 HOH HOH A . C 3 HOH 186 686 190 HOH HOH A . C 3 HOH 187 687 191 HOH HOH A . C 3 HOH 188 688 192 HOH HOH A . C 3 HOH 189 689 193 HOH HOH A . C 3 HOH 190 690 194 HOH HOH A . C 3 HOH 191 691 195 HOH HOH A . C 3 HOH 192 692 196 HOH HOH A . C 3 HOH 193 693 197 HOH HOH A . C 3 HOH 194 694 198 HOH HOH A . C 3 HOH 195 695 199 HOH HOH A . C 3 HOH 196 696 200 HOH HOH A . C 3 HOH 197 697 201 HOH HOH A . C 3 HOH 198 698 202 HOH HOH A . C 3 HOH 199 699 203 HOH HOH A . C 3 HOH 200 700 204 HOH HOH A . C 3 HOH 201 701 205 HOH HOH A . C 3 HOH 202 702 206 HOH HOH A . C 3 HOH 203 703 207 HOH HOH A . C 3 HOH 204 704 208 HOH HOH A . C 3 HOH 205 705 209 HOH HOH A . C 3 HOH 206 706 210 HOH HOH A . C 3 HOH 207 707 211 HOH HOH A . C 3 HOH 208 708 212 HOH HOH A . C 3 HOH 209 709 213 HOH HOH A . C 3 HOH 210 710 214 HOH HOH A . C 3 HOH 211 711 215 HOH HOH A . C 3 HOH 212 712 216 HOH HOH A . C 3 HOH 213 713 217 HOH HOH A . C 3 HOH 214 714 218 HOH HOH A . C 3 HOH 215 715 219 HOH HOH A . C 3 HOH 216 716 220 HOH HOH A . C 3 HOH 217 717 221 HOH HOH A . C 3 HOH 218 718 222 HOH HOH A . C 3 HOH 219 719 223 HOH HOH A . C 3 HOH 220 720 224 HOH HOH A . C 3 HOH 221 721 225 HOH HOH A . C 3 HOH 222 722 226 HOH HOH A . C 3 HOH 223 723 227 HOH HOH A . C 3 HOH 224 724 228 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 579 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-09-24 2 'Structure model' 1 1 2022-08-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' struct_ref_seq_dif 4 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_database_2.pdbx_DOI' 6 2 'Structure model' '_database_2.pdbx_database_accession' 7 2 'Structure model' '_struct_ref_seq_dif.details' 8 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 9 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 10 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 MOLREP phasing '- auto MR' ? 2 PHENIX refinement '(phenix.refine: 1.8.1_1168)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CD A PRO 258 ? ? CA A GLU 259 ? ? 1.78 2 1 O A PHE 261 ? ? N A GLY 263 ? ? 1.96 3 1 CG A PRO 258 ? ? O A PHE 261 ? ? 2.00 4 1 O A HOH 527 ? ? O A HOH 712 ? ? 2.13 5 1 OXT A 2LT 401 ? ? O A HOH 711 ? ? 2.17 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ARG 257 ? ? N A PRO 258 ? ? CD A PRO 258 ? ? 135.62 120.60 15.02 2.20 Y 2 1 CA A PRO 258 ? ? N A PRO 258 ? ? CD A PRO 258 ? ? 101.27 111.50 -10.23 1.40 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 137 ? ? -124.67 -50.37 2 1 CYS A 231 ? ? -167.80 76.04 3 1 ARG A 257 ? ? 162.40 175.13 4 1 PRO A 258 ? ? -127.64 -50.72 5 1 HIS A 310 ? ? -63.71 6.45 6 1 HIS A 311 ? ? -106.00 -71.66 7 1 HIS A 312 ? ? 130.84 32.92 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ARG _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 257 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PRO _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 258 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -39.47 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 109 ? CG ? A LEU 109 CG 2 1 Y 1 A LEU 109 ? CD1 ? A LEU 109 CD1 3 1 Y 1 A LEU 109 ? CD2 ? A LEU 109 CD2 4 1 Y 1 A ASP 113 ? CG ? A ASP 113 CG 5 1 Y 1 A ASP 113 ? OD1 ? A ASP 113 OD1 6 1 Y 1 A ASP 113 ? OD2 ? A ASP 113 OD2 7 1 Y 1 A LYS 260 ? CG ? A LYS 260 CG 8 1 Y 1 A LYS 260 ? CD ? A LYS 260 CD 9 1 Y 1 A LYS 260 ? CE ? A LYS 260 CE 10 1 Y 1 A LYS 260 ? NZ ? A LYS 260 NZ 11 1 Y 1 A PHE 261 ? CG ? A PHE 261 CG 12 1 Y 1 A PHE 261 ? CD1 ? A PHE 261 CD1 13 1 Y 1 A PHE 261 ? CD2 ? A PHE 261 CD2 14 1 Y 1 A PHE 261 ? CE1 ? A PHE 261 CE1 15 1 Y 1 A PHE 261 ? CE2 ? A PHE 261 CE2 16 1 Y 1 A PHE 261 ? CZ ? A PHE 261 CZ 17 1 Y 1 A HIS 310 ? CG ? A HIS 310 CG 18 1 Y 1 A HIS 310 ? ND1 ? A HIS 310 ND1 19 1 Y 1 A HIS 310 ? CD2 ? A HIS 310 CD2 20 1 Y 1 A HIS 310 ? CE1 ? A HIS 310 CE1 21 1 Y 1 A HIS 310 ? NE2 ? A HIS 310 NE2 22 1 Y 1 A HIS 311 ? CG ? A HIS 311 CG 23 1 Y 1 A HIS 311 ? ND1 ? A HIS 311 ND1 24 1 Y 1 A HIS 311 ? CD2 ? A HIS 311 CD2 25 1 Y 1 A HIS 311 ? CE1 ? A HIS 311 CE1 26 1 Y 1 A HIS 311 ? NE2 ? A HIS 311 NE2 27 1 Y 1 A HIS 312 ? CG ? A HIS 312 CG 28 1 Y 1 A HIS 312 ? ND1 ? A HIS 312 ND1 29 1 Y 1 A HIS 312 ? CD2 ? A HIS 312 CD2 30 1 Y 1 A HIS 312 ? CE1 ? A HIS 312 CE1 31 1 Y 1 A HIS 312 ? NE2 ? A HIS 312 NE2 32 1 Y 1 A HIS 313 ? CG ? A HIS 313 CG 33 1 Y 1 A HIS 313 ? ND1 ? A HIS 313 ND1 34 1 Y 1 A HIS 313 ? CD2 ? A HIS 313 CD2 35 1 Y 1 A HIS 313 ? CE1 ? A HIS 313 CE1 36 1 Y 1 A HIS 313 ? NE2 ? A HIS 313 NE2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 3,5-dichloro-L-tyrosine 2LT 3 water HOH #