data_4O92 # _entry.id 4O92 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4O92 RCSB RCSB084195 WWPDB D_1000084195 # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id EFI-501747 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4O92 _pdbx_database_status.recvd_initial_deposition_date 2013-12-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, J.' 1 'Toro, R.' 2 'Bhosle, R.' 3 'Al Obaidi, N.F.' 4 'Morisco, L.L.' 5 'Wasserman, S.R.' 6 'Sojitra, S.' 7 'Washington, E.' 8 'Glenn, A.S.' 9 'Chowdhury, S.' 10 'Evans, B.' 11 'Stead, M.' 12 'Hillerich, B.' 13 'Love, J.' 14 'Seidel, R.D.' 15 'Imker, H.J.' 16 'Attonito, J.D.' 17 'Gerlt, J.A.' 18 'Almo, S.C.' 19 'Enzyme Function Initiative (EFI)' 20 # _citation.id primary _citation.title 'Crystal structure of a Glutathione S-transferase from Pichia kudriavzevii (Issatchenkia orientalis), target EFI-501747' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kim, J.' 1 primary 'Toro, R.' 2 primary 'Bhosle, R.' 3 primary 'Al Obaidi, N.F.' 4 primary 'Morisco, L.L.' 5 primary 'Wasserman, S.R.' 6 primary 'Sojitra, S.' 7 primary 'Washington, E.' 8 primary 'Glenn, A.S.' 9 primary 'Chowdhury, S.' 10 primary 'Evans, B.' 11 primary 'Stead, M.' 12 primary 'Hillerich, B.' 13 primary 'Love, J.' 14 primary 'Seidel, R.D.' 15 primary 'Imker, H.J.' 16 primary 'Attonito, J.D.' 17 primary 'Gerlt, J.A.' 18 primary 'Almo, S.C.' 19 primary 'Enzyme Function Initiative (EFI)' 20 # _cell.entry_id 4O92 _cell.length_a 48.207 _cell.length_b 48.207 _cell.length_c 187.068 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4O92 _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Glutathione S-transferase' 23470.398 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 20 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)TFGTLYILPPSPRSAWLPKLAKYLGLEINVKS(MSE)LEVEDFKSKFPLGKAPAFEGSDGFRLTETLAIIKYFID SSSKPEFAGSSLKEKALNEKWLSFANSDLCGA(MSE)VGVWFCKDESKKPELVSKLNSLLQYIDNELNNSKFLVGDSVLV ADILLYVTLQHIVEIGVDISSFSHLKKYSEEVAKHELLAEAENLYFQGHHHHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MTFGTLYILPPSPRSAWLPKLAKYLGLEINVKSMLEVEDFKSKFPLGKAPAFEGSDGFRLTETLAIIKYFIDSSSKPEFA GSSLKEKALNEKWLSFANSDLCGAMVGVWFCKDESKKPELVSKLNSLLQYIDNELNNSKFLVGDSVLVADILLYVTLQHI VEIGVDISSFSHLKKYSEEVAKHELLAEAENLYFQGHHHHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier EFI-501747 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 THR n 1 3 PHE n 1 4 GLY n 1 5 THR n 1 6 LEU n 1 7 TYR n 1 8 ILE n 1 9 LEU n 1 10 PRO n 1 11 PRO n 1 12 SER n 1 13 PRO n 1 14 ARG n 1 15 SER n 1 16 ALA n 1 17 TRP n 1 18 LEU n 1 19 PRO n 1 20 LYS n 1 21 LEU n 1 22 ALA n 1 23 LYS n 1 24 TYR n 1 25 LEU n 1 26 GLY n 1 27 LEU n 1 28 GLU n 1 29 ILE n 1 30 ASN n 1 31 VAL n 1 32 LYS n 1 33 SER n 1 34 MSE n 1 35 LEU n 1 36 GLU n 1 37 VAL n 1 38 GLU n 1 39 ASP n 1 40 PHE n 1 41 LYS n 1 42 SER n 1 43 LYS n 1 44 PHE n 1 45 PRO n 1 46 LEU n 1 47 GLY n 1 48 LYS n 1 49 ALA n 1 50 PRO n 1 51 ALA n 1 52 PHE n 1 53 GLU n 1 54 GLY n 1 55 SER n 1 56 ASP n 1 57 GLY n 1 58 PHE n 1 59 ARG n 1 60 LEU n 1 61 THR n 1 62 GLU n 1 63 THR n 1 64 LEU n 1 65 ALA n 1 66 ILE n 1 67 ILE n 1 68 LYS n 1 69 TYR n 1 70 PHE n 1 71 ILE n 1 72 ASP n 1 73 SER n 1 74 SER n 1 75 SER n 1 76 LYS n 1 77 PRO n 1 78 GLU n 1 79 PHE n 1 80 ALA n 1 81 GLY n 1 82 SER n 1 83 SER n 1 84 LEU n 1 85 LYS n 1 86 GLU n 1 87 LYS n 1 88 ALA n 1 89 LEU n 1 90 ASN n 1 91 GLU n 1 92 LYS n 1 93 TRP n 1 94 LEU n 1 95 SER n 1 96 PHE n 1 97 ALA n 1 98 ASN n 1 99 SER n 1 100 ASP n 1 101 LEU n 1 102 CYS n 1 103 GLY n 1 104 ALA n 1 105 MSE n 1 106 VAL n 1 107 GLY n 1 108 VAL n 1 109 TRP n 1 110 PHE n 1 111 CYS n 1 112 LYS n 1 113 ASP n 1 114 GLU n 1 115 SER n 1 116 LYS n 1 117 LYS n 1 118 PRO n 1 119 GLU n 1 120 LEU n 1 121 VAL n 1 122 SER n 1 123 LYS n 1 124 LEU n 1 125 ASN n 1 126 SER n 1 127 LEU n 1 128 LEU n 1 129 GLN n 1 130 TYR n 1 131 ILE n 1 132 ASP n 1 133 ASN n 1 134 GLU n 1 135 LEU n 1 136 ASN n 1 137 ASN n 1 138 SER n 1 139 LYS n 1 140 PHE n 1 141 LEU n 1 142 VAL n 1 143 GLY n 1 144 ASP n 1 145 SER n 1 146 VAL n 1 147 LEU n 1 148 VAL n 1 149 ALA n 1 150 ASP n 1 151 ILE n 1 152 LEU n 1 153 LEU n 1 154 TYR n 1 155 VAL n 1 156 THR n 1 157 LEU n 1 158 GLN n 1 159 HIS n 1 160 ILE n 1 161 VAL n 1 162 GLU n 1 163 ILE n 1 164 GLY n 1 165 VAL n 1 166 ASP n 1 167 ILE n 1 168 SER n 1 169 SER n 1 170 PHE n 1 171 SER n 1 172 HIS n 1 173 LEU n 1 174 LYS n 1 175 LYS n 1 176 TYR n 1 177 SER n 1 178 GLU n 1 179 GLU n 1 180 VAL n 1 181 ALA n 1 182 LYS n 1 183 HIS n 1 184 GLU n 1 185 LEU n 1 186 LEU n 1 187 ALA n 1 188 GLU n 1 189 ALA n 1 190 GLU n 1 191 ASN n 1 192 LEU n 1 193 TYR n 1 194 PHE n 1 195 GLN n 1 196 GLY n 1 197 HIS n 1 198 HIS n 1 199 HIS n 1 200 HIS n 1 201 HIS n 1 202 HIS n 1 203 HIS n 1 204 HIS n 1 205 HIS n 1 206 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'GSTY-1, Q9Y727' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'Issatchenkia orientalis' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pichia kudriavzevii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4909 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain B834 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9Y727_ISSOR _struct_ref.pdbx_db_accession Q9Y727 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTFGTLYILPPSPRSAWLPKLAKYLGLEINVKSMLEVEDFKSKFPLGKAPAFEGSDGFRLTETLAIIKYFIDSSSKPEFA GSSLKEKALNEKWLSFANSDLCGAMVGVWFCKDESKKPELVSKLNSLLQYIDNELNNSKFLVGDSVLVADILLYVTLQHI VEIGVDISSFSHLKKYSEEVAKHELLAE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4O92 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 188 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y727 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 188 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 188 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4O92 ALA A 189 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 189 1 1 4O92 GLU A 190 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 190 2 1 4O92 ASN A 191 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 191 3 1 4O92 LEU A 192 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 192 4 1 4O92 TYR A 193 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 193 5 1 4O92 PHE A 194 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 194 6 1 4O92 GLN A 195 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 195 7 1 4O92 GLY A 196 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 196 8 1 4O92 HIS A 197 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 197 9 1 4O92 HIS A 198 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 198 10 1 4O92 HIS A 199 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 199 11 1 4O92 HIS A 200 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 200 12 1 4O92 HIS A 201 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 201 13 1 4O92 HIS A 202 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 202 14 1 4O92 HIS A 203 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 203 15 1 4O92 HIS A 204 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 204 16 1 4O92 HIS A 205 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 205 17 1 4O92 HIS A 206 ? UNP Q9Y727 ? ? 'EXPRESSION TAG' 206 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4O92 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_percent_sol 46.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 273 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pdbx_details '0.1 M Na2HPO4:Citric Acid, 2.0 M Ammonium Sulfate, pH 4.2, VAPOR DIFFUSION, SITTING DROP, temperature 273K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2011-11-11 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Double silicon(111) crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9793 # _reflns.entry_id 4O92 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.50 _reflns.number_obs 8243 _reflns.number_all 8254 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.127 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 46.2 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 12.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.54 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.57 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 7.7 _reflns_shell.pdbx_redundancy 12.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4O92 _refine.ls_number_reflns_obs 7790 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 46.77 _refine.ls_d_res_high 2.51 _refine.ls_percent_reflns_obs 99.54 _refine.ls_R_factor_obs 0.22636 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.22469 _refine.ls_R_factor_R_free 0.25807 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 378 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.942 _refine.correlation_coeff_Fo_to_Fc_free 0.934 _refine.B_iso_mean 53.340 _refine.aniso_B[1][1] 2.89 _refine.aniso_B[2][2] 2.89 _refine.aniso_B[3][3] -5.78 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.556 _refine.pdbx_overall_ESU_R_Free 0.293 _refine.overall_SU_ML 0.256 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 11.866 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1513 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 1538 _refine_hist.d_res_high 2.51 _refine_hist.d_res_low 46.77 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.012 0.019 ? 1552 ? 'X-RAY DIFFRACTION' r_bond_other_d 0.003 0.020 ? 1472 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.520 1.989 ? 2105 ? 'X-RAY DIFFRACTION' r_angle_other_deg 0.784 3.000 ? 3401 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 5.894 5.000 ? 195 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 40.629 25.167 ? 60 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 17.679 15.000 ? 254 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 28.513 15.000 ? 2 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.076 0.200 ? 241 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.006 0.021 ? 1723 ? 'X-RAY DIFFRACTION' r_gen_planes_other 0.001 0.020 ? 333 ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it 3.705 5.170 ? 783 ? 'X-RAY DIFFRACTION' r_mcbond_other 3.709 5.166 ? 782 ? 'X-RAY DIFFRACTION' r_mcangle_it 5.646 7.738 ? 977 ? 'X-RAY DIFFRACTION' r_mcangle_other 5.644 7.744 ? 978 ? 'X-RAY DIFFRACTION' r_scbond_it 4.817 5.653 ? 769 ? 'X-RAY DIFFRACTION' r_scbond_other 4.819 5.663 ? 766 ? 'X-RAY DIFFRACTION' r_scangle_it ? ? ? ? ? 'X-RAY DIFFRACTION' r_scangle_other 7.424 8.244 ? 1123 ? 'X-RAY DIFFRACTION' r_long_range_B_refined 9.343 41.239 ? 1745 ? 'X-RAY DIFFRACTION' r_long_range_B_other 9.338 41.234 ? 1743 ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.509 _refine_ls_shell.d_res_low 2.574 _refine_ls_shell.number_reflns_R_work 535 _refine_ls_shell.R_factor_R_work 0.300 _refine_ls_shell.percent_reflns_obs 96.72 _refine_ls_shell.R_factor_R_free 0.380 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 26 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4O92 _struct.title 'Crystal structure of a Glutathione S-transferase from Pichia kudriavzevii (Issatchenkia orientalis), target EFI-501747' _struct.pdbx_descriptor 'Glutathione S-transferase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4O92 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Structural Genomics, Enzyme Function Initiative, EFI, transferase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? SER A 15 ? SER A 12 SER A 15 5 ? 4 HELX_P HELX_P2 2 ALA A 16 ? GLY A 26 ? ALA A 16 GLY A 26 1 ? 11 HELX_P HELX_P3 3 LEU A 35 ? VAL A 37 ? LEU A 35 VAL A 37 5 ? 3 HELX_P HELX_P4 4 ASP A 39 ? PHE A 44 ? ASP A 39 PHE A 44 1 ? 6 HELX_P HELX_P5 5 GLU A 62 ? SER A 73 ? GLU A 62 SER A 73 1 ? 12 HELX_P HELX_P6 6 SER A 83 ? PHE A 110 ? SER A 83 PHE A 110 1 ? 28 HELX_P HELX_P7 7 LYS A 116 ? LEU A 135 ? LYS A 116 LEU A 135 1 ? 20 HELX_P HELX_P8 8 LEU A 147 ? ILE A 163 ? LEU A 147 ILE A 163 1 ? 17 HELX_P HELX_P9 9 PHE A 170 ? PHE A 194 ? PHE A 170 PHE A 194 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A THR 2 N ? ? A MSE 1 A THR 2 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale ? ? A SER 33 C ? ? ? 1_555 A MSE 34 N ? ? A SER 33 A MSE 34 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale ? ? A MSE 34 C ? ? ? 1_555 A LEU 35 N ? ? A MSE 34 A LEU 35 1_555 ? ? ? ? ? ? ? 1.322 ? covale4 covale ? ? A ALA 104 C ? ? ? 1_555 A MSE 105 N ? ? A ALA 104 A MSE 105 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale ? ? A MSE 105 C ? ? ? 1_555 A VAL 106 N ? ? A MSE 105 A VAL 106 1_555 ? ? ? ? ? ? ? 1.318 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 49 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 49 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 50 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 50 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.40 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 29 ? SER A 33 ? ILE A 29 SER A 33 A 2 GLY A 4 ? ILE A 8 ? GLY A 4 ILE A 8 A 3 ALA A 51 ? GLY A 54 ? ALA A 51 GLY A 54 A 4 ARG A 59 ? THR A 61 ? ARG A 59 THR A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 32 ? O LYS A 32 N ILE A 8 ? N ILE A 8 A 2 3 N TYR A 7 ? N TYR A 7 O ALA A 51 ? O ALA A 51 A 3 4 N PHE A 52 ? N PHE A 52 O LEU A 60 ? O LEU A 60 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ARG A 14 ? ARG A 14 . ? 1_555 ? 2 AC1 6 PRO A 50 ? PRO A 50 . ? 1_555 ? 3 AC1 6 GLU A 62 ? GLU A 62 . ? 1_555 ? 4 AC1 6 THR A 63 ? THR A 63 . ? 1_555 ? 5 AC1 6 ASN A 98 ? ASN A 98 . ? 1_555 ? 6 AC1 6 HOH C . ? HOH A 401 . ? 1_555 ? # _database_PDB_matrix.entry_id 4O92 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4O92 _atom_sites.fract_transf_matrix[1][1] 0.020744 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020744 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005346 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 MSE 34 34 34 MSE MSE A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 MSE 105 105 105 MSE MSE A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 CYS 111 111 111 CYS CYS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 TYR 130 130 130 TYR TYR A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ASP 166 166 166 ASP ASP A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 LYS 175 175 175 LYS LYS A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ALA 187 187 187 ALA ALA A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 GLN 195 195 195 GLN GLN A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 HIS 197 197 ? ? ? A . n A 1 198 HIS 198 198 ? ? ? A . n A 1 199 HIS 199 199 ? ? ? A . n A 1 200 HIS 200 200 ? ? ? A . n A 1 201 HIS 201 201 ? ? ? A . n A 1 202 HIS 202 202 ? ? ? A . n A 1 203 HIS 203 203 ? ? ? A . n A 1 204 HIS 204 204 ? ? ? A . n A 1 205 HIS 205 205 ? ? ? A . n A 1 206 HIS 206 206 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'Enzyme Function Initiative' _pdbx_SG_project.full_name_of_center ? _pdbx_SG_project.initial_of_center ? # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 34 A MSE 34 ? MET SELENOMETHIONINE 3 A MSE 105 A MSE 105 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 2 1,2 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 2970 ? 2 MORE -54 ? 2 'SSA (A^2)' 18440 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 187.0680000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2014-01-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CBASS 'data collection' . ? 1 AutoSol phasing . ? 2 REFMAC refinement 5.8.0049 ? 3 HKL-3000 'data reduction' . ? 4 HKL-3000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 39 ? ? -107.44 77.27 2 1 GLU A 62 ? ? 75.43 120.34 3 1 LYS A 76 ? ? -118.88 70.01 4 1 SER A 99 ? ? -91.19 -66.32 5 1 PHE A 140 ? ? -118.31 -169.96 6 1 PHE A 194 ? ? -67.94 2.32 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 20 ? CG ? A LYS 20 CG 2 1 Y 1 A LYS 20 ? CD ? A LYS 20 CD 3 1 Y 1 A LYS 20 ? CE ? A LYS 20 CE 4 1 Y 1 A LYS 20 ? NZ ? A LYS 20 NZ 5 1 Y 1 A GLU 38 ? CG ? A GLU 38 CG 6 1 Y 1 A GLU 38 ? CD ? A GLU 38 CD 7 1 Y 1 A GLU 38 ? OE1 ? A GLU 38 OE1 8 1 Y 1 A GLU 38 ? OE2 ? A GLU 38 OE2 9 1 Y 1 A ASP 39 ? CG ? A ASP 39 CG 10 1 Y 1 A ASP 39 ? OD1 ? A ASP 39 OD1 11 1 Y 1 A ASP 39 ? OD2 ? A ASP 39 OD2 12 1 Y 1 A LYS 43 ? CG ? A LYS 43 CG 13 1 Y 1 A LYS 43 ? CD ? A LYS 43 CD 14 1 Y 1 A LYS 43 ? CE ? A LYS 43 CE 15 1 Y 1 A LYS 43 ? NZ ? A LYS 43 NZ 16 1 Y 1 A LYS 48 ? CG ? A LYS 48 CG 17 1 Y 1 A LYS 48 ? CD ? A LYS 48 CD 18 1 Y 1 A LYS 48 ? CE ? A LYS 48 CE 19 1 Y 1 A LYS 48 ? NZ ? A LYS 48 NZ 20 1 Y 1 A LYS 112 ? CG ? A LYS 112 CG 21 1 Y 1 A LYS 112 ? CD ? A LYS 112 CD 22 1 Y 1 A LYS 112 ? CE ? A LYS 112 CE 23 1 Y 1 A LYS 112 ? NZ ? A LYS 112 NZ 24 1 Y 1 A ASN 137 ? CG ? A ASN 137 CG 25 1 Y 1 A ASN 137 ? OD1 ? A ASN 137 OD1 26 1 Y 1 A ASN 137 ? ND2 ? A ASN 137 ND2 27 1 Y 1 A LYS 174 ? CG ? A LYS 174 CG 28 1 Y 1 A LYS 174 ? CD ? A LYS 174 CD 29 1 Y 1 A LYS 174 ? CE ? A LYS 174 CE 30 1 Y 1 A LYS 174 ? NZ ? A LYS 174 NZ 31 1 Y 1 A GLU 178 ? CG ? A GLU 178 CG 32 1 Y 1 A GLU 178 ? CD ? A GLU 178 CD 33 1 Y 1 A GLU 178 ? OE1 ? A GLU 178 OE1 34 1 Y 1 A GLU 178 ? OE2 ? A GLU 178 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 197 ? A HIS 197 2 1 Y 1 A HIS 198 ? A HIS 198 3 1 Y 1 A HIS 199 ? A HIS 199 4 1 Y 1 A HIS 200 ? A HIS 200 5 1 Y 1 A HIS 201 ? A HIS 201 6 1 Y 1 A HIS 202 ? A HIS 202 7 1 Y 1 A HIS 203 ? A HIS 203 8 1 Y 1 A HIS 204 ? A HIS 204 9 1 Y 1 A HIS 205 ? A HIS 205 10 1 Y 1 A HIS 206 ? A HIS 206 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 3 HOH 1 401 1 HOH HOH A . C 3 HOH 2 402 2 HOH HOH A . C 3 HOH 3 403 3 HOH HOH A . C 3 HOH 4 404 5 HOH HOH A . C 3 HOH 5 405 6 HOH HOH A . C 3 HOH 6 406 7 HOH HOH A . C 3 HOH 7 407 11 HOH HOH A . C 3 HOH 8 408 12 HOH HOH A . C 3 HOH 9 409 13 HOH HOH A . C 3 HOH 10 410 17 HOH HOH A . C 3 HOH 11 411 19 HOH HOH A . C 3 HOH 12 412 21 HOH HOH A . C 3 HOH 13 413 24 HOH HOH A . C 3 HOH 14 414 31 HOH HOH A . C 3 HOH 15 415 33 HOH HOH A . C 3 HOH 16 416 34 HOH HOH A . C 3 HOH 17 417 37 HOH HOH A . C 3 HOH 18 418 41 HOH HOH A . C 3 HOH 19 419 42 HOH HOH A . C 3 HOH 20 420 48 HOH HOH A . #