data_4P0C # _entry.id 4P0C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.388 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4P0C pdb_00004p0c 10.2210/pdb4p0c/pdb WWPDB D_1000200411 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-05-21 2 'Structure model' 1 1 2015-02-04 3 'Structure model' 1 2 2023-12-27 4 'Structure model' 1 3 2024-03-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' Other 7 3 'Structure model' 'Refinement description' 8 3 'Structure model' 'Source and taxonomy' 9 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' citation 4 3 'Structure model' database_2 5 3 'Structure model' diffrn_radiation_wavelength 6 3 'Structure model' entity_src_gen 7 3 'Structure model' pdbx_database_status 8 3 'Structure model' pdbx_prerelease_seq 9 3 'Structure model' pdbx_struct_assembly 10 3 'Structure model' pdbx_struct_oper_list 11 3 'Structure model' pdbx_validate_close_contact 12 3 'Structure model' pdbx_validate_symm_contact 13 3 'Structure model' refine_hist 14 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 5 3 'Structure model' '_pdbx_database_status.pdb_format_compatible' 6 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 7 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 8 3 'Structure model' '_pdbx_validate_symm_contact.auth_atom_id_1' 9 3 'Structure model' '_pdbx_validate_symm_contact.auth_atom_id_2' 10 3 'Structure model' '_pdbx_validate_symm_contact.dist' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 4P0C _pdbx_database_status.recvd_initial_deposition_date 2014-02-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.methods_development_category . _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Holcomb, J.' 1 'Jiang, Y.' 2 'Lu, G.' 3 'Trescott, L.' 4 'Brunzelle, J.' 5 'Sirinupong, N.' 6 'Li, C.' 7 'Naren, A.' 8 'Yang, Z.' 9 # _citation.abstract . _citation.abstract_id_CAS . _citation.book_id_ISBN . _citation.book_publisher ? _citation.book_publisher_city . _citation.book_title . _citation.coordinate_linkage . _citation.country US _citation.database_id_Medline . _citation.details . _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full . _citation.journal_issue . _citation.journal_volume 446 _citation.language . _citation.page_first 399 _citation.page_last 403 _citation.title 'Structural insights into PDZ-mediated interaction of NHERF2 and LPA2, a cellular event implicated in CFTR channel regulation.' _citation.year 2014 _citation.database_id_CSD . _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2014.02.128 _citation.pdbx_database_id_PubMed 24613836 _citation.unpublished_flag . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Holcomb, J.' 1 ? primary 'Jiang, Y.' 2 ? primary 'Lu, G.' 3 ? primary 'Trescott, L.' 4 ? primary 'Brunzelle, J.' 5 ? primary 'Sirinupong, N.' 6 ? primary 'Li, C.' 7 ? primary 'Naren, A.P.' 8 ? primary 'Yang, Z.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Na(+)/H(+) exchange regulatory cofactor NHE-RF2/Lysophosphatidic acid receptor 2 chimeric protein' 9801.165 1 ? ? 'UNP Q15599 residues 9-90; UNP Q9HBW0 residues 347-351' ? 2 non-polymer syn 'THIOCYANATE ION' 58.082 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 4 water nat water 18.015 141 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLV VDQMDSTL ; _entity_poly.pdbx_seq_one_letter_code_can ;MPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLV VDQMDSTL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'THIOCYANATE ION' SCN 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 ARG n 1 4 LEU n 1 5 CYS n 1 6 ARG n 1 7 LEU n 1 8 VAL n 1 9 ARG n 1 10 GLY n 1 11 GLU n 1 12 GLN n 1 13 GLY n 1 14 TYR n 1 15 GLY n 1 16 PHE n 1 17 HIS n 1 18 LEU n 1 19 HIS n 1 20 GLY n 1 21 GLU n 1 22 LYS n 1 23 GLY n 1 24 ARG n 1 25 ARG n 1 26 GLY n 1 27 GLN n 1 28 PHE n 1 29 ILE n 1 30 ARG n 1 31 ARG n 1 32 VAL n 1 33 GLU n 1 34 PRO n 1 35 GLY n 1 36 SER n 1 37 PRO n 1 38 ALA n 1 39 GLU n 1 40 ALA n 1 41 ALA n 1 42 ALA n 1 43 LEU n 1 44 ARG n 1 45 ALA n 1 46 GLY n 1 47 ASP n 1 48 ARG n 1 49 LEU n 1 50 VAL n 1 51 GLU n 1 52 VAL n 1 53 ASN n 1 54 GLY n 1 55 VAL n 1 56 ASN n 1 57 VAL n 1 58 GLU n 1 59 GLY n 1 60 GLU n 1 61 THR n 1 62 HIS n 1 63 HIS n 1 64 GLN n 1 65 VAL n 1 66 VAL n 1 67 GLN n 1 68 ARG n 1 69 ILE n 1 70 LYS n 1 71 ALA n 1 72 VAL n 1 73 GLU n 1 74 GLY n 1 75 GLN n 1 76 THR n 1 77 ARG n 1 78 LEU n 1 79 LEU n 1 80 VAL n 1 81 VAL n 1 82 ASP n 1 83 GLN n 1 84 MET n 1 85 ASP n 1 86 SER n 1 87 THR n 1 88 LEU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 83 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pSUMO ? ? 1 2 sample 'Biological sequence' 84 88 Human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pSUMO ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SCN non-polymer . 'THIOCYANATE ION' ? 'C N S -1' 58.082 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 8 8 MET MET A . n A 1 2 PRO 2 9 9 PRO PRO A . n A 1 3 ARG 3 10 10 ARG ARG A . n A 1 4 LEU 4 11 11 LEU LEU A . n A 1 5 CYS 5 12 12 CYS CYS A . n A 1 6 ARG 6 13 13 ARG ARG A . n A 1 7 LEU 7 14 14 LEU LEU A . n A 1 8 VAL 8 15 15 VAL VAL A . n A 1 9 ARG 9 16 16 ARG ARG A . n A 1 10 GLY 10 17 17 GLY GLY A . n A 1 11 GLU 11 18 18 GLU GLU A . n A 1 12 GLN 12 19 19 GLN GLN A . n A 1 13 GLY 13 20 20 GLY GLY A . n A 1 14 TYR 14 21 21 TYR TYR A . n A 1 15 GLY 15 22 22 GLY GLY A . n A 1 16 PHE 16 23 23 PHE PHE A . n A 1 17 HIS 17 24 24 HIS HIS A . n A 1 18 LEU 18 25 25 LEU LEU A . n A 1 19 HIS 19 26 26 HIS HIS A . n A 1 20 GLY 20 27 27 GLY GLY A . n A 1 21 GLU 21 28 28 GLU GLU A . n A 1 22 LYS 22 29 29 LYS LYS A . n A 1 23 GLY 23 30 30 GLY GLY A . n A 1 24 ARG 24 31 31 ARG ARG A . n A 1 25 ARG 25 32 32 ARG ARG A . n A 1 26 GLY 26 33 33 GLY GLY A . n A 1 27 GLN 27 34 34 GLN GLN A . n A 1 28 PHE 28 35 35 PHE PHE A . n A 1 29 ILE 29 36 36 ILE ILE A . n A 1 30 ARG 30 37 37 ARG ARG A . n A 1 31 ARG 31 38 38 ARG ARG A . n A 1 32 VAL 32 39 39 VAL VAL A . n A 1 33 GLU 33 40 40 GLU GLU A . n A 1 34 PRO 34 41 41 PRO PRO A . n A 1 35 GLY 35 42 42 GLY GLY A . n A 1 36 SER 36 43 43 SER SER A . n A 1 37 PRO 37 44 44 PRO PRO A . n A 1 38 ALA 38 45 45 ALA ALA A . n A 1 39 GLU 39 46 46 GLU GLU A . n A 1 40 ALA 40 47 47 ALA ALA A . n A 1 41 ALA 41 48 48 ALA ALA A . n A 1 42 ALA 42 49 49 ALA ALA A . n A 1 43 LEU 43 50 50 LEU LEU A . n A 1 44 ARG 44 51 51 ARG ARG A . n A 1 45 ALA 45 52 52 ALA ALA A . n A 1 46 GLY 46 53 53 GLY GLY A . n A 1 47 ASP 47 54 54 ASP ASP A . n A 1 48 ARG 48 55 55 ARG ARG A . n A 1 49 LEU 49 56 56 LEU LEU A . n A 1 50 VAL 50 57 57 VAL VAL A . n A 1 51 GLU 51 58 58 GLU GLU A . n A 1 52 VAL 52 59 59 VAL VAL A . n A 1 53 ASN 53 60 60 ASN ASN A . n A 1 54 GLY 54 61 61 GLY GLY A . n A 1 55 VAL 55 62 62 VAL VAL A . n A 1 56 ASN 56 63 63 ASN ASN A . n A 1 57 VAL 57 64 64 VAL VAL A . n A 1 58 GLU 58 65 65 GLU GLU A . n A 1 59 GLY 59 66 66 GLY GLY A . n A 1 60 GLU 60 67 67 GLU GLU A . n A 1 61 THR 61 68 68 THR THR A . n A 1 62 HIS 62 69 69 HIS HIS A . n A 1 63 HIS 63 70 70 HIS HIS A . n A 1 64 GLN 64 71 71 GLN GLN A . n A 1 65 VAL 65 72 72 VAL VAL A . n A 1 66 VAL 66 73 73 VAL VAL A . n A 1 67 GLN 67 74 74 GLN GLN A . n A 1 68 ARG 68 75 75 ARG ARG A . n A 1 69 ILE 69 76 76 ILE ILE A . n A 1 70 LYS 70 77 77 LYS LYS A . n A 1 71 ALA 71 78 78 ALA ALA A . n A 1 72 VAL 72 79 79 VAL VAL A . n A 1 73 GLU 73 80 80 GLU GLU A . n A 1 74 GLY 74 81 81 GLY GLY A . n A 1 75 GLN 75 82 82 GLN GLN A . n A 1 76 THR 76 83 83 THR THR A . n A 1 77 ARG 77 84 84 ARG ARG A . n A 1 78 LEU 78 85 85 LEU LEU A . n A 1 79 LEU 79 86 86 LEU LEU A . n A 1 80 VAL 80 87 87 VAL VAL A . n A 1 81 VAL 81 88 88 VAL VAL A . n A 1 82 ASP 82 89 89 ASP ASP A . n A 1 83 GLN 83 90 90 GLN GLN A . n A 1 84 MET 84 91 91 MET MET A . n A 1 85 ASP 85 92 92 ASP ASP A . n A 1 86 SER 86 93 93 SER SER A . n A 1 87 THR 87 94 94 THR THR A . n A 1 88 LEU 88 95 95 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SCN 1 101 5712 SCN SCN A . C 3 CL 1 102 2 CL CL A . D 3 CL 1 103 3 CL CL A . E 4 HOH 1 201 99 HOH HOH A . E 4 HOH 2 202 105 HOH HOH A . E 4 HOH 3 203 80 HOH HOH A . E 4 HOH 4 204 24 HOH HOH A . E 4 HOH 5 205 90 HOH HOH A . E 4 HOH 6 206 39 HOH HOH A . E 4 HOH 7 207 75 HOH HOH A . E 4 HOH 8 208 73 HOH HOH A . E 4 HOH 9 209 97 HOH HOH A . E 4 HOH 10 210 60 HOH HOH A . E 4 HOH 11 211 48 HOH HOH A . E 4 HOH 12 212 53 HOH HOH A . E 4 HOH 13 213 126 HOH HOH A . E 4 HOH 14 214 11 HOH HOH A . E 4 HOH 15 215 122 HOH HOH A . E 4 HOH 16 216 7 HOH HOH A . E 4 HOH 17 217 31 HOH HOH A . E 4 HOH 18 218 89 HOH HOH A . E 4 HOH 19 219 65 HOH HOH A . E 4 HOH 20 220 36 HOH HOH A . E 4 HOH 21 221 68 HOH HOH A . E 4 HOH 22 222 76 HOH HOH A . E 4 HOH 23 223 52 HOH HOH A . E 4 HOH 24 224 58 HOH HOH A . E 4 HOH 25 225 42 HOH HOH A . E 4 HOH 26 226 38 HOH HOH A . E 4 HOH 27 227 9 HOH HOH A . E 4 HOH 28 228 5 HOH HOH A . E 4 HOH 29 229 61 HOH HOH A . E 4 HOH 30 230 13 HOH HOH A . E 4 HOH 31 231 25 HOH HOH A . E 4 HOH 32 232 27 HOH HOH A . E 4 HOH 33 233 67 HOH HOH A . E 4 HOH 34 234 22 HOH HOH A . E 4 HOH 35 235 2 HOH HOH A . E 4 HOH 36 236 29 HOH HOH A . E 4 HOH 37 237 111 HOH HOH A . E 4 HOH 38 238 100 HOH HOH A . E 4 HOH 39 239 26 HOH HOH A . E 4 HOH 40 240 64 HOH HOH A . E 4 HOH 41 241 138 HOH HOH A . E 4 HOH 42 242 44 HOH HOH A . E 4 HOH 43 243 19 HOH HOH A . E 4 HOH 44 244 21 HOH HOH A . E 4 HOH 45 245 63 HOH HOH A . E 4 HOH 46 246 15 HOH HOH A . E 4 HOH 47 247 82 HOH HOH A . E 4 HOH 48 248 104 HOH HOH A . E 4 HOH 49 249 107 HOH HOH A . E 4 HOH 50 250 114 HOH HOH A . E 4 HOH 51 251 55 HOH HOH A . E 4 HOH 52 252 10 HOH HOH A . E 4 HOH 53 253 69 HOH HOH A . E 4 HOH 54 254 47 HOH HOH A . E 4 HOH 55 255 66 HOH HOH A . E 4 HOH 56 256 59 HOH HOH A . E 4 HOH 57 257 88 HOH HOH A . E 4 HOH 58 258 37 HOH HOH A . E 4 HOH 59 259 83 HOH HOH A . E 4 HOH 60 260 133 HOH HOH A . E 4 HOH 61 261 71 HOH HOH A . E 4 HOH 62 262 23 HOH HOH A . E 4 HOH 63 263 74 HOH HOH A . E 4 HOH 64 264 112 HOH HOH A . E 4 HOH 65 265 94 HOH HOH A . E 4 HOH 66 266 116 HOH HOH A . E 4 HOH 67 267 16 HOH HOH A . E 4 HOH 68 268 46 HOH HOH A . E 4 HOH 69 269 142 HOH HOH A . E 4 HOH 70 270 28 HOH HOH A . E 4 HOH 71 271 135 HOH HOH A . E 4 HOH 72 272 33 HOH HOH A . E 4 HOH 73 273 143 HOH HOH A . E 4 HOH 74 274 108 HOH HOH A . E 4 HOH 75 275 127 HOH HOH A . E 4 HOH 76 276 81 HOH HOH A . E 4 HOH 77 277 140 HOH HOH A . E 4 HOH 78 278 86 HOH HOH A . E 4 HOH 79 279 87 HOH HOH A . E 4 HOH 80 280 84 HOH HOH A . E 4 HOH 81 281 123 HOH HOH A . E 4 HOH 82 282 102 HOH HOH A . E 4 HOH 83 283 93 HOH HOH A . E 4 HOH 84 284 109 HOH HOH A . E 4 HOH 85 285 119 HOH HOH A . E 4 HOH 86 286 32 HOH HOH A . E 4 HOH 87 287 92 HOH HOH A . E 4 HOH 88 288 121 HOH HOH A . E 4 HOH 89 289 103 HOH HOH A . E 4 HOH 90 290 30 HOH HOH A . E 4 HOH 91 291 141 HOH HOH A . E 4 HOH 92 292 131 HOH HOH A . E 4 HOH 93 293 54 HOH HOH A . E 4 HOH 94 294 132 HOH HOH A . E 4 HOH 95 295 101 HOH HOH A . E 4 HOH 96 296 50 HOH HOH A . E 4 HOH 97 297 129 HOH HOH A . E 4 HOH 98 298 117 HOH HOH A . E 4 HOH 99 299 35 HOH HOH A . E 4 HOH 100 300 139 HOH HOH A . E 4 HOH 101 301 113 HOH HOH A . E 4 HOH 102 302 57 HOH HOH A . E 4 HOH 103 303 62 HOH HOH A . E 4 HOH 104 304 134 HOH HOH A . E 4 HOH 105 305 120 HOH HOH A . E 4 HOH 106 306 110 HOH HOH A . E 4 HOH 107 307 79 HOH HOH A . E 4 HOH 108 308 43 HOH HOH A . E 4 HOH 109 309 118 HOH HOH A . E 4 HOH 110 310 1 HOH HOH A . E 4 HOH 111 311 3 HOH HOH A . E 4 HOH 112 312 4 HOH HOH A . E 4 HOH 113 313 6 HOH HOH A . E 4 HOH 114 314 8 HOH HOH A . E 4 HOH 115 315 12 HOH HOH A . E 4 HOH 116 316 14 HOH HOH A . E 4 HOH 117 317 17 HOH HOH A . E 4 HOH 118 318 18 HOH HOH A . E 4 HOH 119 319 20 HOH HOH A . E 4 HOH 120 320 34 HOH HOH A . E 4 HOH 121 321 40 HOH HOH A . E 4 HOH 122 322 41 HOH HOH A . E 4 HOH 123 323 45 HOH HOH A . E 4 HOH 124 324 49 HOH HOH A . E 4 HOH 125 325 51 HOH HOH A . E 4 HOH 126 326 56 HOH HOH A . E 4 HOH 127 327 70 HOH HOH A . E 4 HOH 128 328 77 HOH HOH A . E 4 HOH 129 329 78 HOH HOH A . E 4 HOH 130 330 85 HOH HOH A . E 4 HOH 131 331 91 HOH HOH A . E 4 HOH 132 332 95 HOH HOH A . E 4 HOH 133 333 96 HOH HOH A . E 4 HOH 134 334 98 HOH HOH A . E 4 HOH 135 335 106 HOH HOH A . E 4 HOH 136 336 115 HOH HOH A . E 4 HOH 137 337 124 HOH HOH A . E 4 HOH 138 338 125 HOH HOH A . E 4 HOH 139 339 130 HOH HOH A . E 4 HOH 140 340 136 HOH HOH A . E 4 HOH 141 341 137 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 31 ? CG ? A ARG 24 CG 2 1 Y 1 A ARG 31 ? CD ? A ARG 24 CD 3 1 Y 1 A ARG 31 ? NE ? A ARG 24 NE 4 1 Y 1 A ARG 31 ? CZ ? A ARG 24 CZ 5 1 Y 1 A ARG 31 ? NH1 ? A ARG 24 NH1 6 1 Y 1 A ARG 31 ? NH2 ? A ARG 24 NH2 # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version '(phenix.refine: 1.8.4_1496)' _software.pdbx_ordinal 1 # _cell.entry_id 4P0C _cell.length_a 26.360 _cell.length_b 40.250 _cell.length_c 37.100 _cell.angle_alpha 90.00 _cell.angle_beta 107.42 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4P0C _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # _exptl.absorpt_coefficient_mu . _exptl.absorpt_correction_T_max . _exptl.absorpt_correction_T_min . _exptl.absorpt_correction_type . _exptl.absorpt_process_details . _exptl.entry_id 4P0C _exptl.crystals_number 1 _exptl.details . _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details . # _exptl_crystal.colour . _exptl_crystal.density_diffrn . _exptl_crystal.density_Matthews 1.92 _exptl_crystal.density_method . _exptl_crystal.density_percent_sol 35.80 _exptl_crystal.description . _exptl_crystal.F_000 . _exptl_crystal.id 1 _exptl_crystal.preparation . _exptl_crystal.size_max . _exptl_crystal.size_mid . _exptl_crystal.size_min . _exptl_crystal.size_rad . _exptl_crystal.colour_lustre . _exptl_crystal.colour_modifier . _exptl_crystal.colour_primary . _exptl_crystal.density_meas . _exptl_crystal.density_meas_esd . _exptl_crystal.density_meas_gt . _exptl_crystal.density_meas_lt . _exptl_crystal.density_meas_temp . _exptl_crystal.density_meas_temp_esd . _exptl_crystal.density_meas_temp_gt . _exptl_crystal.density_meas_temp_lt . _exptl_crystal.pdbx_crystal_image_url . _exptl_crystal.pdbx_crystal_image_format . _exptl_crystal.pdbx_mosaicity . _exptl_crystal.pdbx_mosaicity_esd . # _exptl_crystal_grow.apparatus . _exptl_crystal_grow.atmosphere . _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details . _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref . _exptl_crystal_grow.pH . _exptl_crystal_grow.pressure . _exptl_crystal_grow.pressure_esd . _exptl_crystal_grow.seeding . _exptl_crystal_grow.seeding_ref . _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details . _exptl_crystal_grow.temp_esd . _exptl_crystal_grow.time . _exptl_crystal_grow.pdbx_details '100 mM sodium acetate, 0.2 M ammonium acetate' _exptl_crystal_grow.pdbx_pH_range 4.8 # _diffrn.ambient_environment . _diffrn.ambient_temp 100 _diffrn.ambient_temp_details . _diffrn.ambient_temp_esd . _diffrn.crystal_id 1 _diffrn.crystal_support . _diffrn.crystal_treatment . _diffrn.details . _diffrn.id 1 _diffrn.ambient_pressure . _diffrn.ambient_pressure_esd . _diffrn.ambient_pressure_gt . _diffrn.ambient_pressure_lt . _diffrn.ambient_temp_gt . _diffrn.ambient_temp_lt . # _diffrn_detector.details . _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean . _diffrn_detector.dtime . _diffrn_detector.pdbx_frames_total . _diffrn_detector.pdbx_collection_time_total . _diffrn_detector.pdbx_collection_date 2013-07-22 # _diffrn_radiation.collimation . _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge . _diffrn_radiation.inhomogeneity . _diffrn_radiation.monochromator Kohzu _diffrn_radiation.polarisn_norm . _diffrn_radiation.polarisn_ratio . _diffrn_radiation.probe . _diffrn_radiation.type . _diffrn_radiation.xray_symbol . _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l . _diffrn_radiation.pdbx_wavelength_list . _diffrn_radiation.pdbx_wavelength . _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer . _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.12719 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current . _diffrn_source.details . _diffrn_source.diffrn_id 1 _diffrn_source.power . _diffrn_source.size . _diffrn_source.source SYNCHROTRON _diffrn_source.target . _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage . _diffrn_source.take-off_angle . _diffrn_source.pdbx_wavelength_list 1.12719 _diffrn_source.pdbx_wavelength . _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate . _reflns.entry_id 4P0C _reflns.data_reduction_details . _reflns.data_reduction_method . _reflns.d_resolution_high 1.17 _reflns.d_resolution_low 24.21 _reflns.details . _reflns.limit_h_max . _reflns.limit_h_min . _reflns.limit_k_max . _reflns.limit_k_min . _reflns.limit_l_max . _reflns.limit_l_min . _reflns.number_all . _reflns.number_obs 24020 _reflns.observed_criterion . _reflns.observed_criterion_F_max . _reflns.observed_criterion_F_min . _reflns.observed_criterion_I_max . _reflns.observed_criterion_I_min . _reflns.observed_criterion_sigma_F . _reflns.observed_criterion_sigma_I . _reflns.percent_possible_obs 95.8 _reflns.R_free_details . _reflns.Rmerge_F_all . _reflns.Rmerge_F_obs . _reflns.Friedel_coverage . _reflns.number_gt . _reflns.threshold_expression . _reflns.pdbx_redundancy 3.8 _reflns.pdbx_Rmerge_I_obs .045 _reflns.pdbx_Rmerge_I_all . _reflns.pdbx_Rsym_value . _reflns.pdbx_netI_over_av_sigmaI . _reflns.pdbx_netI_over_sigmaI 15.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 . _reflns.pdbx_res_netI_over_sigmaI_2 . _reflns.pdbx_chi_squared . _reflns.pdbx_scaling_rejects . _reflns.pdbx_d_res_high_opt . _reflns.pdbx_d_res_low_opt . _reflns.pdbx_d_res_opt_method . _reflns.phase_calculation_details . _reflns.pdbx_Rrim_I_all . _reflns.pdbx_Rpim_I_all . _reflns.pdbx_d_opt . _reflns.pdbx_number_measured_all . _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4P0C _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 16738 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 24.208 _refine.ls_d_res_high 1.339 _refine.ls_percent_reflns_obs 99.74 _refine.ls_R_factor_obs 0.1466 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1449 _refine.ls_R_factor_R_free 0.1769 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.02 _refine.ls_number_reflns_R_free 841 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 20CS _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.13 _refine.pdbx_overall_phase_error 18.08 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 681 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 141 _refine_hist.number_atoms_total 827 _refine_hist.d_res_high 1.339 _refine_hist.d_res_low 24.208 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.007 ? ? 711 'X-RAY DIFFRACTION' ? f_angle_d 1.191 ? ? 955 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 15.408 ? ? 282 'X-RAY DIFFRACTION' ? f_chiral_restr 0.069 ? ? 102 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 131 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.3390 1.4229 2607 0.1414 100.00 0.2190 . . 145 . . 'X-RAY DIFFRACTION' . 1.4229 1.5327 2651 0.1297 100.00 0.1874 . . 130 . . 'X-RAY DIFFRACTION' . 1.5327 1.6869 2661 0.1268 100.00 0.1719 . . 127 . . 'X-RAY DIFFRACTION' . 1.6869 1.9310 2654 0.1346 100.00 0.2049 . . 135 . . 'X-RAY DIFFRACTION' . 1.9310 2.4324 2645 0.1402 100.00 0.1768 . . 148 . . 'X-RAY DIFFRACTION' . 2.4324 24.2121 2679 0.1594 99.00 0.1618 . . 156 . . # _struct.entry_id 4P0C _struct.title 'Crystal Structure of NHERF2 PDZ1 Domain in Complex with LPA2' _struct.pdbx_model_details . _struct.pdbx_formula_weight . _struct.pdbx_formula_weight_method . _struct.pdbx_model_type_details . _struct.pdbx_CASP_flag . # _struct_keywords.entry_id 4P0C _struct_keywords.text 'PDZ, protein-protein interaction, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP NHRF2_HUMAN Q15599 1 ;PRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVV DQ ; 9 ? 2 UNP LPAR2_HUMAN Q9HBW0 1 MDSTL 347 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4P0C A 2 ? 83 ? Q15599 9 ? 90 ? 9 90 2 2 4P0C A 84 ? 88 ? Q9HBW0 347 ? 351 ? 91 95 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4P0C _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q15599 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 8 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 36 ? ALA A 41 ? SER A 43 ALA A 48 1 ? 6 HELX_P HELX_P2 AA2 THR A 61 ? VAL A 72 ? THR A 68 VAL A 79 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 23 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 30 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ARG _struct_mon_prot_cis.pdbx_label_seq_id_2 24 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ARG _struct_mon_prot_cis.pdbx_auth_seq_id_2 31 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.62 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 3 ? VAL A 8 ? ARG A 10 VAL A 15 AA1 2 GLN A 75 ? VAL A 81 ? GLN A 82 VAL A 88 AA1 3 ARG A 48 ? VAL A 52 ? ARG A 55 VAL A 59 AA1 4 VAL A 55 ? ASN A 56 ? VAL A 62 ASN A 63 AA2 1 PHE A 16 ? GLY A 20 ? PHE A 23 GLY A 27 AA2 2 GLN A 27 ? VAL A 32 ? GLN A 34 VAL A 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 3 ? N ARG A 10 O VAL A 80 ? O VAL A 87 AA1 2 3 O LEU A 79 ? O LEU A 86 N VAL A 50 ? N VAL A 57 AA1 3 4 N VAL A 52 ? N VAL A 59 O VAL A 55 ? O VAL A 62 AA2 1 2 N HIS A 19 ? N HIS A 26 O PHE A 28 ? O PHE A 35 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SCN 101 ? 3 'binding site for residue SCN A 101' AC2 Software A CL 102 ? 5 'binding site for residue CL A 102' AC3 Software A CL 103 ? 3 'binding site for residue CL A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 19 ? HIS A 26 . ? 1_555 ? 2 AC1 3 ARG A 30 ? ARG A 37 . ? 1_555 ? 3 AC1 3 GLY A 46 ? GLY A 53 . ? 1_555 ? 4 AC2 5 GLY A 46 ? GLY A 53 . ? 1_555 ? 5 AC2 5 ASP A 82 ? ASP A 89 . ? 1_555 ? 6 AC2 5 GLN A 83 ? GLN A 90 . ? 1_555 ? 7 AC2 5 HOH E . ? HOH A 243 . ? 1_555 ? 8 AC2 5 HOH E . ? HOH A 318 . ? 1_555 ? 9 AC3 3 ARG A 44 ? ARG A 51 . ? 1_555 ? 10 AC3 3 ASP A 82 ? ASP A 89 . ? 1_555 ? 11 AC3 3 HOH E . ? HOH A 318 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HE22 A GLN 82 ? ? O A HOH 202 ? ? 1.60 2 1 O A HOH 288 ? ? O A HOH 309 ? ? 1.84 3 1 O A HOH 208 ? ? O A HOH 279 ? ? 1.96 4 1 O A HOH 236 ? ? O A HOH 303 ? ? 2.11 5 1 O A HOH 247 ? ? O A HOH 302 ? ? 2.17 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE2 A GLU 18 ? ? 1_555 O A GLY 30 ? ? 1_556 1.85 2 1 CD A GLU 18 ? ? 1_555 O A GLY 30 ? ? 1_556 1.96 3 1 OE2 A GLU 18 ? ? 1_555 N A GLY 30 ? ? 1_556 1.97 4 1 O A HOH 237 ? ? 1_555 O A HOH 249 ? ? 2_848 2.11 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 49 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 70.71 _pdbx_validate_torsion.psi 34.50 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SCN S S N N 291 SCN C C N N 292 SCN N N N N 293 SER N N N N 294 SER CA C N S 295 SER C C N N 296 SER O O N N 297 SER CB C N N 298 SER OG O N N 299 SER OXT O N N 300 SER H H N N 301 SER H2 H N N 302 SER HA H N N 303 SER HB2 H N N 304 SER HB3 H N N 305 SER HG H N N 306 SER HXT H N N 307 THR N N N N 308 THR CA C N S 309 THR C C N N 310 THR O O N N 311 THR CB C N R 312 THR OG1 O N N 313 THR CG2 C N N 314 THR OXT O N N 315 THR H H N N 316 THR H2 H N N 317 THR HA H N N 318 THR HB H N N 319 THR HG1 H N N 320 THR HG21 H N N 321 THR HG22 H N N 322 THR HG23 H N N 323 THR HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SCN S C sing N N 277 SCN C N trip N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_initial_refinement_model.accession_code 2OCS _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 4P0C _atom_sites.fract_transf_matrix[1][1] 0.037936 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.011903 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024845 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.028250 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H N O S # loop_